F371144

General Info

Members Datasets Scaffolds Average Seq Length
262 153 524 295

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10443297|Ga0207681_104432971
Length 317
Sequence MIAASPFDQYLDHIVAGGDLEASVVEALASSPDILPAGMLADALKRRLHGSRVTYLRVAVCAFDRSFADAVPPAAGEVRISGAPDTLDIALSAIGSARAVAGSRALTGFSWTDVERFASAAKERSVVVLTRLRDAGLEGLAVVALDTVGEPAAAVEAMAKAGFERVRLHLSKPHAGSPAAFWLAIGALQQRIPIIESINPLPLSLSAFKPTTGYEDVKAVAIARLAAPQVPHIQVDWLRYGPKLAQVALTFGADDVDGVSASDDAPEGRRRAPLEEIRRNVEAAGFEPVERGGRGVHTHTAARPEGGQSNTAGQGGA

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 16.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10443297 3300025923 Unclassified 1055
2 JGI24751J29686_10026882 3300002459 Bacteria 1194
3 JGI25406J46586_10000335 3300003203 Bacteria 21248
4 Ga0070676_10007011 3300005328 Bacteria 6035
5 Ga0070683_100040413 3300005329 Bacteria 4289
6 Ga0070690_100022194 3300005330 Bacteria 3882
7 Ga0070690_100025084 3300005330 Bacteria 3670
8 Ga0070690_100038841 3300005330 Bacteria 3006
9 Ga0070670_100013445 3300005331 Bacteria 7011
10 Ga0070670_100026638 3300005331 Bacteria 4974
11 Ga0068869_100002498 3300005334 Bacteria 11086
12 Ga0068869_100021509 3300005334 Bacteria 4439
13 Ga0068868_100104106 3300005338 Bacteria 2300
14 Ga0070689_100011230 3300005340 Bacteria 6409
15 Ga0070689_100035932 3300005340 Bacteria 3788
16 Ga0070689_100327412 3300005340 Unclassified 1281
17 Ga0070692_10008777 3300005345 Bacteria 4522
18 Ga0070668_100124140 3300005347 Bacteria 2067
19 Ga0070668_100154171 3300005347 Bacteria 1860
20 Ga0070668_100368975 3300005347 Unclassified 1219
21 Ga0070669_100000448 3300005353 Bacteria 31480
22 Ga0070669_100224825 3300005353 Unclassified 1485
23 Ga0070675_100001092 3300005354 Bacteria 19569
24 Ga0070675_100007171 3300005354 Bacteria 8592
25 Ga0070675_100015000 3300005354 Bacteria 6120
26 Ga0070675_100152798 3300005354 Bacteria 1980
27 Ga0070671_100009064 3300005355 Bacteria 7987
28 Ga0070673_100004167 3300005364 Bacteria 9112
29 Ga0070688_100052334 3300005365 Bacteria 2550
30 Ga0070659_100395988 3300005366 Bacteria 1165
31 Ga0070713_100066657 3300005436 Bacteria 3028
32 Ga0070701_10002254 3300005438 Bacteria 7381
33 Ga0070701_10057887 3300005438 Bacteria 2033
34 Ga0070705_100003620 3300005440 Bacteria 7565
35 Ga0070705_100059012 3300005440 Unclassified 2270
36 Ga0070700_100014689 3300005441 Bacteria 4425
37 Ga0070694_100001458 3300005444 Bacteria 13864
38 Ga0070694_100009292 3300005444 Bacteria 6033
39 Ga0070708_100433216 3300005445 Bacteria 1240
40 Ga0070678_100191253 3300005456 Bacteria 1683
41 Ga0070662_100117523 3300005457 Unclassified 2034
42 Ga0070662_100120363 3300005457 Bacteria 2011
43 Ga0070662_100181548 3300005457 Bacteria 1659
44 Ga0070681_10035801 3300005458 Bacteria 4986
45 Ga0068867_100000717 3300005459 Bacteria 22125
46 Ga0068867_100104851 3300005459 Bacteria 2164
47 Ga0070707_100195338 3300005468 Unclassified 1973
48 Ga0070698_100051383 3300005471 Unclassified 4198
49 Ga0070699_100009257 3300005518 Bacteria 8532
50 Ga0070699_100017167 3300005518 Bacteria 6216
51 Ga0070699_100030946 3300005518 Bacteria 4620
52 Ga0070679_100277099 3300005530 Unclassified 1630
53 Ga0070684_100021042 3300005535 Bacteria 5420
54 Ga0070697_100101380 3300005536 Bacteria 2392
55 Ga0070697_100201694 3300005536 Bacteria 1691
56 Ga0070672_100006035 3300005543 Bacteria 8093
57 Ga0070672_100077334 3300005543 Bacteria 2661
58 Ga0070672_100229219 3300005543 Bacteria 1560
59 Ga0070672_100249376 3300005543 Unclassified 1495
60 Ga0070695_100000171 3300005545 Bacteria 30974
61 Ga0070695_100243265 3300005545 Bacteria 1306
62 Ga0070696_100000124 3300005546 Bacteria 40765
63 Ga0070693_100106882 3300005547 Bacteria 1714
64 Ga0070704_100000145 3300005549 Bacteria 26912
65 Ga0070704_100081699 3300005549 Bacteria 2381
66 Ga0070704_100121764 3300005549 Bacteria 2006
67 Ga0070664_100061786 3300005564 Bacteria 3193
68 Ga0070664_100125140 3300005564 Bacteria 2254
69 Ga0068857_100018170 3300005577 Bacteria 6168
70 Ga0068857_100042939 3300005577 Bacteria 4011
71 Ga0070702_100008169 3300005615 Bacteria 5056
72 Ga0068852_100474459 3300005616 Bacteria 1242
73 Ga0068859_100002171 3300005617 Bacteria 19940
74 Ga0068859_100008413 3300005617 Bacteria 10451
75 Ga0068864_100106306 3300005618 Unclassified 2495
76 Ga0068864_100136749 3300005618 Unclassified 2207
77 Ga0068866_10003215 3300005718 Bacteria 6738
78 Ga0068861_100023806 3300005719 Bacteria 4421
79 Ga0068851_10045330 3300005834 Bacteria 2222
80 Ga0068870_10065258 3300005840 Bacteria 1969
81 Ga0068870_10081802 3300005840 Unclassified 1787
82 Ga0068870_10140869 3300005840 Unclassified 1411
83 Ga0068863_100161813 3300005841 Bacteria 2145
84 Ga0068863_100595069 3300005841 Bacteria 1094
85 Ga0068858_100006973 3300005842 Bacteria 10975
86 Ga0068858_100115424 3300005842 Bacteria 2509
87 Ga0068858_100182450 3300005842 Bacteria 1982
88 Ga0068860_100192757 3300005843 Bacteria 1973
89 Ga0068862_100013335 3300005844 Bacteria 6800
90 Ga0068862_100039485 3300005844 Bacteria 4009
91 Ga0068862_100601091 3300005844 Unclassified 1056
92 Ga0081539_10000251 3300005985 Bacteria 125220
93 Ga0081539_10001218 3300005985 Bacteria 45966
94 Ga0081539_10023830 3300005985 Bacteria 3993
95 Ga0075428_100006210 3300006844 Bacteria 13292
96 Ga0075428_100016111 3300006844 Bacteria 8264
97 Ga0075430_100004999 3300006846 Bacteria 11160
98 Ga0075430_100165343 3300006846 Bacteria 1841
99 Ga0075430_100330113 3300006846 Unclassified 1260
100 Ga0075433_10000117 3300006852 Bacteria 39826
101 Ga0075433_10101916 3300006852 Bacteria 2542
102 Ga0075434_100007494 3300006871 Bacteria 10099
103 Ga0075429_100046796 3300006880 Bacteria 3764
104 Ga0075429_100207764 3300006880 Unclassified 1715
105 Ga0068865_100007211 3300006881 Bacteria 6830
106 Ga0097620_100002171 3300006931 Bacteria 19940
107 Ga0097620_100008413 3300006931 Bacteria 10451
108 Ga0075435_100005321 3300007076 Bacteria 8965
109 Ga0075435_100104274 3300007076 Unclassified 2352
110 Ga0111539_10000325 3300009094 Bacteria 58382
111 Ga0111539_10001176 3300009094 Bacteria 34725
112 Ga0111539_10008450 3300009094 Bacteria 13096
113 Ga0111539_10041490 3300009094 Bacteria 5533
114 Ga0111539_10097864 3300009094 Unclassified 3447
115 Ga0114129_10002137 3300009147 Bacteria 27257
116 Ga0114129_10015682 3300009147 Bacteria 10775
117 Ga0114129_10016869 3300009147 Bacteria 10396
118 Ga0114129_10115128 3300009147 Bacteria 3707
119 Ga0105243_10063069 3300009148 Bacteria 2969
120 Ga0105242_10085931 3300009176 Bacteria 2639
121 Ga0105238_10017339 3300009551 Bacteria 7317
122 Ga0163162_10392526 3300013306 Bacteria 1520
123 Ga0157375_10152624 3300013308 Bacteria 2446
124 Ga0157375_10441824 3300013308 Unclassified 1466
125 Ga0157375_10614149 3300013308 Unclassified 1246
126 Ga0157375_10733514 3300013308 Bacteria 1140
127 Ga0163163_10019551 3300014325 Bacteria 6362
128 Ga0163163_10760200 3300014325 Unclassified 1032
129 Ga0157380_10027093 3300014326 Bacteria 4356
130 Ga0157380_10125732 3300014326 Bacteria 2179
131 Ga0207656_10094774 3300025321 Bacteria 1360
132 Ga0207653_10067054 3300025885 Bacteria 1220
133 Ga0207642_10008305 3300025899 Bacteria 3554
134 Ga0207645_10005008 3300025907 Bacteria 9707
135 Ga0207643_10006413 3300025908 Bacteria 6300
136 Ga0207643_10073512 3300025908 Bacteria 1971
137 Ga0207707_10184695 3300025912 Bacteria 1820
138 Ga0207646_10229706 3300025922 Bacteria 1676
139 Ga0207681_10004122 3300025923 Bacteria 9008
140 Ga0207694_10063944 3300025924 Bacteria 2867
141 Ga0207650_10013736 3300025925 Bacteria 5614
142 Ga0207650_10044468 3300025925 Bacteria 3264
143 Ga0207659_10000293 3300025926 Bacteria 30396
144 Ga0207659_10102605 3300025926 Bacteria 2159
145 Ga0207659_10103502 3300025926 Bacteria 2151
146 Ga0207659_10255754 3300025926 Unclassified 1423
147 Ga0207700_10022777 3300025928 Bacteria 4303
148 Ga0207644_10178766 3300025931 Bacteria 1662
149 Ga0207706_10014400 3300025933 Bacteria 7167
150 Ga0207706_10251733 3300025933 Bacteria 1543
151 Ga0207686_10010314 3300025934 Bacteria 5084
152 Ga0207709_10042663 3300025935 Bacteria 2730
153 Ga0207670_10031367 3300025936 Bacteria 3405
154 Ga0207670_10052730 3300025936 Bacteria 2736
155 Ga0207669_10010988 3300025937 Bacteria 4384
156 Ga0207704_10004934 3300025938 Bacteria 6132
157 Ga0207691_10003596 3300025940 Bacteria 15063
158 Ga0207691_10020079 3300025940 Bacteria 6320
159 Ga0207691_10167770 3300025940 Bacteria 1923
160 Ga0207691_10311487 3300025940 Bacteria 1351
161 Ga0207691_10315256 3300025940 Unclassified 1341
162 Ga0207691_10366428 3300025940 Unclassified 1231
163 Ga0207689_10031853 3300025942 Bacteria 4385
164 Ga0207679_10096714 3300025945 Bacteria 2298
165 Ga0207679_10101601 3300025945 Bacteria 2250
166 Ga0207679_10183888 3300025945 Bacteria 1731
167 Ga0207679_10465933 3300025945 Bacteria 1123
168 Ga0207651_10037494 3300025960 Unclassified 3176
169 Ga0207640_10075530 3300025981 Bacteria 2284
170 Ga0207677_10493752 3300026023 Bacteria 1057
171 Ga0207703_10058550 3300026035 Bacteria 3145
172 Ga0207703_10170688 3300026035 Unclassified 1913
173 Ga0207678_10045905 3300026067 Bacteria 3778
174 Ga0207708_10006100 3300026075 Bacteria 8937
175 Ga0207641_10654802 3300026088 Unclassified 1032
176 Ga0207648_10000066 3300026089 Bacteria 98414
177 Ga0207648_10001196 3300026089 Bacteria 29074
178 Ga0207676_10064110 3300026095 Bacteria 2920
179 Ga0207676_10250707 3300026095 Unclassified 1593
180 Ga0207674_10008960 3300026116 Bacteria 11499
181 Ga0207674_10121915 3300026116 Bacteria 2574
182 Ga0207675_100006154 3300026118 Bacteria 11400
183 Ga0207675_100033078 3300026118 Bacteria 4818
184 Ga0207683_10105477 3300026121 Bacteria 2519
185 Ga0207698_10467391 3300026142 Bacteria 1221
186 Ga0207428_10003877 3300027907 Bacteria 14336
187 Ga0207428_10004178 3300027907 Bacteria 13837
188 Ga0207428_10053924 3300027907 Bacteria 3204
189 Ga0268265_10000073 3300028380 Bacteria 128856
190 Ga0268264_10028265 3300028381 Bacteria 4585
191 Ga0268264_10407706 3300028381 Bacteria 1308
192 Ga0307408_100101342 3300031548 Bacteria 2194
193 Ga0307408_100301080 3300031548 Bacteria 1343
194 Ga0307405_10033452 3300031731 Bacteria 3049
195 Ga0307413_10020954 3300031824 Bacteria 3489
196 Ga0307410_10029014 3300031852 Bacteria 3517
197 Ga0307410_10065633 3300031852 Bacteria 2497
198 Ga0307407_10044015 3300031903 Bacteria 2513
199 Ga0307407_10113500 3300031903 Bacteria 1705
200 Ga0307412_10088970 3300031911 Bacteria 2155
201 Ga0307412_10199789 3300031911 Unclassified 1517
202 Ga0307409_100000785 3300031995 Bacteria 14419
203 Ga0307416_100013387 3300032002 Bacteria 5573
204 Ga0307416_100048025 3300032002 Bacteria 3383
205 Ga0307416_100114594 3300032002 Bacteria 2385
206 Ga0307414_10087356 3300032004 Bacteria 2304
207 Ga0307414_10315535 3300032004 Bacteria 1328
208 Ga0307411_10008606 3300032005 Bacteria 5300
209 Ga0307411_10323149 3300032005 Unclassified 1247
210 Ga0307411_10378926 3300032005 Bacteria 1163
211 Ga0307411_10555617 3300032005 Bacteria 980
212 Ga0307415_100024184 3300032126 Bacteria 3788
213 Ga0307415_100366535 3300032126 Unclassified 1218
214 Ga0373955_0046799 3300035172 Unclassified 2340
215 Ga0373937_0138149 3300036401 Unclassified 2279
216 Ga0450918_020159 3300042531 Unclassified 1165
217 Ga0451577_0327249 3300042876 Unclassified 1390
218 Ga0451576_0079838 3300045051 Unclassified 3404
219 Ga0451576_0396319 3300045051 Unclassified 1447
220 Ga0495603_0039971 3300046455 Bacteria 2809
221 Ga0495629_0086798 3300046459 Unclassified 2183
222 Ga0495594_0152497 3300046499 Bacteria 1312
223 Ga0495594_0156557 3300046499 Bacteria 1294
224 Ga0495644_0035991 3300046523 Bacteria 1868
225 Ga0495598_0010473 3300046537 Unclassified 2221
226 Ga0495621_0031365 3300046539 Unclassified 1823
227 Ga0495633_0022942 3300046558 Bacteria 3096
228 Ga0495659_0016552 3300046664 Unclassified 2434
229 Ga0495659_0047226 3300046664 Bacteria 1557
230 Ga0495647_0086592 3300046681 Bacteria 1278
231 Ga0495676_0074874 3300047321 Bacteria 2591
232 Ga0501040_0025001 3300049576 Bacteria 4013
233 Ga0501046_0069454 3300049580 Bacteria 2741
234 Ga0501071_0131072 3300049587 Unclassified 1863
235 Ga0501075_0342791 3300049591 Bacteria 1139
236 Ga0501079_0046177 3300049741 Bacteria 3361
237 Ga0501080_0191411 3300049742 Bacteria 1880
238 Ga0501081_0096980 3300049743 Bacteria 2080
239 Ga0501045_0004176 3300049824 Bacteria 9979
240 nmdc:mga05p37_12306_c1 3300050507 Bacteria 10218
241 nmdc:mga05p37_174611_c1 3300050507 Unclassified 2619
242 nmdc:mga05p37_68337_c1 3300050507 Bacteria 4369
243 nmdc:mga05p37_96694_c1 3300050507 Bacteria 3638
244 nmdc:mga09592_41930_c1 3300050508 Bacteria 3850
245 nmdc:mga09592_57167_c1 3300050508 Bacteria 3297
246 nmdc:mga09592_638982_c1 3300050508 Bacteria 909
247 nmdc:mga06r32_69286_c1 3300050510 Bacteria 3409
248 nmdc:mga08y16_11370_c1 3300050511 Bacteria 9353
249 nmdc:mga08y16_188621_c1 3300050511 Bacteria 2139
250 nmdc:mga08y16_198671_c1 3300050511 Bacteria 2078
251 nmdc:mga08y16_20431_c1 3300050511 Bacteria 6990
252 nmdc:mga08y16_6914_c1 3300050511 Bacteria 11895
253 nmdc:mga0n895_1444_c1 3300050512 Bacteria 17764
254 nmdc:mga0rr50_145380_c1 3300050513 Bacteria 1911
255 nmdc:mga0rr50_3496_c1 3300050513 Bacteria 9050
256 nmdc:mga0a205_174896_c1 3300050515 Bacteria 2042
257 nmdc:mga0a205_2224_c1 3300050515 Bacteria 17074
258 Ga0590071_000785 3300059421 Bacteria 8886
259 Ga0590074_000479 3300059423 Bacteria 5882
260 Ga0590075_000259 3300059424 Bacteria 14841
261 Ga0590077_000168 3300059426 Bacteria 18409
262 Ga0590077_000971 3300059426 Bacteria 7295
263 Ga0207681_10443297
264 JGI24751J29686_10026882
265 JGI25406J46586_10000335
266 Ga0070676_10007011
267 Ga0070683_100040413
268 Ga0070690_100022194
269 Ga0070690_100025084
270 Ga0070690_100038841
271 Ga0070670_100013445
272 Ga0070670_100026638
273 Ga0068869_100002498
274 Ga0068869_100021509
275 Ga0068868_100104106
276 Ga0070689_100011230
277 Ga0070689_100035932
278 Ga0070689_100327412
279 Ga0070692_10008777
280 Ga0070668_100124140
281 Ga0070668_100154171
282 Ga0070668_100368975
283 Ga0070669_100000448
284 Ga0070669_100224825
285 Ga0070675_100001092
286 Ga0070675_100007171
287 Ga0070675_100015000
288 Ga0070675_100152798
289 Ga0070671_100009064
290 Ga0070673_100004167
291 Ga0070688_100052334
292 Ga0070659_100395988
293 Ga0070713_100066657
294 Ga0070701_10002254
295 Ga0070701_10057887
296 Ga0070705_100003620
297 Ga0070705_100059012
298 Ga0070700_100014689
299 Ga0070694_100001458
300 Ga0070694_100009292
301 Ga0070708_100433216
302 Ga0070678_100191253
303 Ga0070662_100117523
304 Ga0070662_100120363
305 Ga0070662_100181548
306 Ga0070681_10035801
307 Ga0068867_100000717
308 Ga0068867_100104851
309 Ga0070707_100195338
310 Ga0070698_100051383
311 Ga0070699_100009257
312 Ga0070699_100017167
313 Ga0070699_100030946
314 Ga0070679_100277099
315 Ga0070684_100021042
316 Ga0070697_100101380
317 Ga0070697_100201694
318 Ga0070672_100006035
319 Ga0070672_100077334
320 Ga0070672_100229219
321 Ga0070672_100249376
322 Ga0070695_100000171
323 Ga0070695_100243265
324 Ga0070696_100000124
325 Ga0070693_100106882
326 Ga0070704_100000145
327 Ga0070704_100081699
328 Ga0070704_100121764
329 Ga0070664_100061786
330 Ga0070664_100125140
331 Ga0068857_100018170
332 Ga0068857_100042939
333 Ga0070702_100008169
334 Ga0068852_100474459
335 Ga0068859_100002171
336 Ga0068859_100008413
337 Ga0068864_100106306
338 Ga0068864_100136749
339 Ga0068866_10003215
340 Ga0068861_100023806
341 Ga0068851_10045330
342 Ga0068870_10065258
343 Ga0068870_10081802
344 Ga0068870_10140869
345 Ga0068863_100161813
346 Ga0068863_100595069
347 Ga0068858_100006973
348 Ga0068858_100115424
349 Ga0068858_100182450
350 Ga0068860_100192757
351 Ga0068862_100013335
352 Ga0068862_100039485
353 Ga0068862_100601091
354 Ga0081539_10000251
355 Ga0081539_10001218
356 Ga0081539_10023830
357 Ga0075428_100006210
358 Ga0075428_100016111
359 Ga0075430_100004999
360 Ga0075430_100165343
361 Ga0075430_100330113
362 Ga0075433_10000117
363 Ga0075433_10101916
364 Ga0075434_100007494
365 Ga0075429_100046796
366 Ga0075429_100207764
367 Ga0068865_100007211
368 Ga0097620_100002171
369 Ga0097620_100008413
370 Ga0075435_100005321
371 Ga0075435_100104274
372 Ga0111539_10000325
373 Ga0111539_10001176
374 Ga0111539_10008450
375 Ga0111539_10041490
376 Ga0111539_10097864
377 Ga0114129_10002137
378 Ga0114129_10015682
379 Ga0114129_10016869
380 Ga0114129_10115128
381 Ga0105243_10063069
382 Ga0105242_10085931
383 Ga0105238_10017339
384 Ga0163162_10392526
385 Ga0157375_10152624
386 Ga0157375_10441824
387 Ga0157375_10614149
388 Ga0157375_10733514
389 Ga0163163_10019551
390 Ga0163163_10760200
391 Ga0157380_10027093
392 Ga0157380_10125732
393 Ga0207656_10094774
394 Ga0207653_10067054
395 Ga0207642_10008305
396 Ga0207645_10005008
397 Ga0207643_10006413
398 Ga0207643_10073512
399 Ga0207707_10184695
400 Ga0207646_10229706
401 Ga0207681_10004122
402 Ga0207694_10063944
403 Ga0207650_10013736
404 Ga0207650_10044468
405 Ga0207659_10000293
406 Ga0207659_10102605
407 Ga0207659_10103502
408 Ga0207659_10255754
409 Ga0207700_10022777
410 Ga0207644_10178766
411 Ga0207706_10014400
412 Ga0207706_10251733
413 Ga0207686_10010314
414 Ga0207709_10042663
415 Ga0207670_10031367
416 Ga0207670_10052730
417 Ga0207669_10010988
418 Ga0207704_10004934
419 Ga0207691_10003596
420 Ga0207691_10020079
421 Ga0207691_10167770
422 Ga0207691_10311487
423 Ga0207691_10315256
424 Ga0207691_10366428
425 Ga0207689_10031853
426 Ga0207679_10096714
427 Ga0207679_10101601
428 Ga0207679_10183888
429 Ga0207679_10465933
430 Ga0207651_10037494
431 Ga0207640_10075530
432 Ga0207677_10493752
433 Ga0207703_10058550
434 Ga0207703_10170688
435 Ga0207678_10045905
436 Ga0207708_10006100
437 Ga0207641_10654802
438 Ga0207648_10000066
439 Ga0207648_10001196
440 Ga0207676_10064110
441 Ga0207676_10250707
442 Ga0207674_10008960
443 Ga0207674_10121915
444 Ga0207675_100006154
445 Ga0207675_100033078
446 Ga0207683_10105477
447 Ga0207698_10467391
448 Ga0207428_10003877
449 Ga0207428_10004178
450 Ga0207428_10053924
451 Ga0268265_10000073
452 Ga0268264_10028265
453 Ga0268264_10407706
454 Ga0307408_100101342
455 Ga0307408_100301080
456 Ga0307405_10033452
457 Ga0307413_10020954
458 Ga0307410_10029014
459 Ga0307410_10065633
460 Ga0307407_10044015
461 Ga0307407_10113500
462 Ga0307412_10088970
463 Ga0307412_10199789
464 Ga0307409_100000785
465 Ga0307416_100013387
466 Ga0307416_100048025
467 Ga0307416_100114594
468 Ga0307414_10087356
469 Ga0307414_10315535
470 Ga0307411_10008606
471 Ga0307411_10323149
472 Ga0307411_10378926
473 Ga0307411_10555617
474 Ga0307415_100024184
475 Ga0307415_100366535
476 Ga0373955_0046799
477 Ga0373937_0138149
478 Ga0450918_020159
479 Ga0451577_0327249
480 Ga0451576_0079838
481 Ga0451576_0396319
482 Ga0495603_0039971
483 Ga0495629_0086798
484 Ga0495594_0152497
485 Ga0495594_0156557
486 Ga0495644_0035991
487 Ga0495598_0010473
488 Ga0495621_0031365
489 Ga0495633_0022942
490 Ga0495659_0016552
491 Ga0495659_0047226
492 Ga0495647_0086592
493 Ga0495676_0074874
494 Ga0501040_0025001
495 Ga0501046_0069454
496 Ga0501071_0131072
497 Ga0501075_0342791
498 Ga0501079_0046177
499 Ga0501080_0191411
500 Ga0501081_0096980
501 Ga0501045_0004176
502 nmdc:mga05p37_12306_c1
503 nmdc:mga05p37_174611_c1
504 nmdc:mga05p37_68337_c1
505 nmdc:mga05p37_96694_c1
506 nmdc:mga09592_41930_c1
507 nmdc:mga09592_57167_c1
508 nmdc:mga09592_638982_c1
509 nmdc:mga06r32_69286_c1
510 nmdc:mga08y16_11370_c1
511 nmdc:mga08y16_188621_c1
512 nmdc:mga08y16_198671_c1
513 nmdc:mga08y16_20431_c1
514 nmdc:mga08y16_6914_c1
515 nmdc:mga0n895_1444_c1
516 nmdc:mga0rr50_145380_c1
517 nmdc:mga0rr50_3496_c1
518 nmdc:mga0a205_174896_c1
519 nmdc:mga0a205_2224_c1
520 Ga0590071_000785
521 Ga0590074_000479
522 Ga0590075_000259
523 Ga0590077_000168
524 Ga0590077_000971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19288

CofH_C

CofH/MqnC C-terminal region

204

301

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xig-assembly1.cif.gz_B x-ray crystal structure of mqne from pedobacter heparinus 0.8217 6 292
6xi9-assembly2.cif.gz_B x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine 0.8135 4 292
6xig-assembly1.cif.gz_A x-ray crystal structure of mqne from pedobacter heparinus 0.8131 6 288
6xi9-assembly1.cif.gz_A x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine 0.8065 6 288
6xig-assembly1.cif.gz_B x-ray crystal structure of mqne from pedobacter heparinus 0.8064 6 292
ID Description Score Start End Superfamily
af_Q58826_3_356_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8203 14 292 3.20.20.70
af_P9WP77_498_849_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8158 6 287 3.20.20.70
af_P9WP77_498_849_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7879 6 287 3.20.20.70
af_Q58826_3_356_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7845 14 292 3.20.20.70
3t7vA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7144 9 288 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1F2SJL8-F1-model_v4 Uncharacterized protein 0.9733 1 292 GO:0044689
GO:0051539
AF-A0A1F2SJL8-F1-model_v4 Uncharacterized protein 0.9701 1 292 GO:0044689
GO:0051539
AF-A0A2V8B0F7-F1-model_v4 CofH/MqnC-like C-terminal domain-containing protein 0.9375 22 292 GO:0044689
GO:0051539
AF-A0A1F2UA64-F1-model_v4 Translation elongation factor SelB winged helix type 3 domain-containing protein 0.9357 18 292 GO:0044689
GO:0051539
AF-A0A1E3YH16-F1-model_v4 Uncharacterized protein 0.924 1 288 GO:0044689
GO:0051539

Map