F371012

General Info

Members Datasets Scaffolds Average Seq Length
262 178 244 241

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10146031|Ga0099795_101460311
Length 268
Sequence MTFKIDSVPSYVRERISREGTRPMSDLLDLALKAHGGLDRWREVKSVDARVSLTGALYHLKGYPEGVPNVTVRIDTRRPAVTISPYARPDHRGYFTPDRVWIEDRAGHIVDERRDPRASFAGHVRETPWDQLHRLYFTGYAMWNYLTTPFLFTRPGFELTEIEPHQENGETWRCLRVKFPSDVPTHNNFQVGGEQTFFFNEQGLLQRFDYLAVGPAAHYCFDHTNYQGIVFPTLRRVLRRPPSGPLVNGPTAVLIQIADVLLGEGDCG

Samples

Sample ID Description Type Environment
1 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
2 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
3 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
4 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
5 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
6 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
7 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
8 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
9 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
10 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
11 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
12 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
174 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
175 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
176 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
177 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
178 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.13
Metatranscriptomes 0
Isolates 6.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.92
Nodule 5.73
Rhizoplane 3.05
Rhizosphere 74.05
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1004208 3300002773 Bacteria 4615
2 JGI25151J46595_10000790 3300003187 Bacteria 25534
3 rootL2_10073075 3300003322 Bacteria 3304
4 rootL2_10166148 3300003322 Unclassified 4096
5 rootL2_10338680 3300003322 Unclassified 1327
6 Ga0070671_100063694 3300005355 Bacteria 3071
7 Ga0070709_10008546 3300005434 Bacteria 5628
8 Ga0070709_10021441 3300005434 Bacteria 3763
9 Ga0070709_10100105 3300005434 Bacteria 1929
10 Ga0070709_10287698 3300005434 Bacteria 1196
11 Ga0070714_100509656 3300005435 Bacteria 1148
12 Ga0070713_100101753 3300005436 Bacteria 2490
13 Ga0070713_100158722 3300005436 Bacteria 2017
14 Ga0070713_100393852 3300005436 Unclassified 1292
15 Ga0070710_10107153 3300005437 Bacteria 1673
16 Ga0070711_100009711 3300005439 Bacteria 5927
17 Ga0070711_100077256 3300005439 Bacteria 2363
18 Ga0070708_100043539 3300005445 Bacteria 3944
19 Ga0070708_100075183 3300005445 Bacteria 3048
20 Ga0070708_100109733 3300005445 Bacteria 2535
21 Ga0070708_100136648 3300005445 Bacteria 2271
22 Ga0070708_100554030 3300005445 Bacteria 1084
23 Ga0070708_100788204 3300005445 Unclassified 893
24 Ga0070706_100000326 3300005467 Bacteria 57972
25 Ga0070706_100092514 3300005467 Bacteria 2805
26 Ga0070706_100144704 3300005467 Bacteria 2220
27 Ga0070707_100015731 3300005468 Bacteria 7102
28 Ga0070707_100036107 3300005468 Bacteria 4715
29 Ga0070707_100062992 3300005468 Unclassified 3558
30 Ga0070707_100067025 3300005468 Plasmid 3452
31 Ga0070699_100074208 3300005518 Bacteria 2960
32 Ga0070699_100102381 3300005518 Bacteria 2511
33 Ga0070699_100166640 3300005518 Bacteria 1952
34 Ga0070699_100213762 3300005518 Unclassified 1717
35 Ga0070697_100006281 3300005536 Bacteria 9200
36 Ga0070697_100008941 3300005536 Bacteria 7826
37 Ga0070697_100049914 3300005536 Bacteria 3396
38 Ga0070697_100227635 3300005536 Bacteria 1590
39 Ga0070697_100464415 3300005536 Bacteria 1104
40 Ga0068863_100452089 3300005841 Bacteria 1261
41 Ga0081538_10000002 3300005981 Bacteria 242010
42 Ga0081538_10000103 3300005981 Bacteria 83685
43 Ga0075365_10000710 3300006038 Bacteria 13422
44 Ga0075368_10018093 3300006042 Bacteria 2644
45 Ga0075363_100093677 3300006048 Bacteria 1656
46 Ga0075364_10001605 3300006051 Bacteria 12371
47 Ga0075364_10169824 3300006051 Unclassified 1474
48 Ga0070716_100007372 3300006173 Bacteria 5411
49 Ga0070716_100485275 3300006173 Bacteria 908
50 Ga0070712_100055065 3300006175 Bacteria 2783
51 Ga0075367_10000674 3300006178 Bacteria 13110
52 Ga0075367_10020993 3300006178 Bacteria 3644
53 Ga0075367_10089833 3300006178 Bacteria 1868
54 Ga0075370_10074066 3300006353 Bacteria 1951
55 Ga0075430_100025043 3300006846 Bacteria 5077
56 Ga0075433_10053359 3300006852 Bacteria 3524
57 Ga0075434_100049932 3300006871 Bacteria 4155
58 Ga0075436_100028490 3300006914 Bacteria 3842
59 Ga0075436_100538442 3300006914 Bacteria 857
60 Ga0075435_100084653 3300007076 Bacteria 2609
61 Ga0075435_100465903 3300007076 Bacteria 1090
62 Ga0099794_10016514 3300007265 Bacteria 3274
63 Ga0099794_10047452 3300007265 Bacteria 2059
64 Ga0099794_10052391 3300007265 Bacteria 1967
65 Ga0099794_10094837 3300007265 Bacteria 1484
66 Ga0099795_10042019 3300007788 Bacteria 1630
67 Ga0099795_10146031 3300007788 Unclassified 965
68 Ga0111539_10222655 3300009094 Bacteria 2197
69 Ga0111539_10321024 3300009094 Unclassified 1802
70 Ga0114129_10045124 3300009147 Bacteria 6197
71 Ga0114129_10131555 3300009147 Bacteria 3436
72 Ga0114129_10379114 3300009147 Unclassified 1868
73 Ga0114129_10379941 3300009147 Bacteria 1866
74 Ga0105248_10149873 3300009177 Bacteria 2631
75 Ga0099796_10019072 3300010159 Bacteria 2073
76 Ga0099796_10036115 3300010159 Bacteria 1644
77 Ga0157379_10064309 3300014968 Bacteria 3278
78 Ga0209129_1000120 3300025258 Bacteria 137898
79 Ga0209025_1000252 3300025294 Bacteria 126233
80 Ga0207692_10045258 3300025898 Bacteria 2200
81 Ga0207710_10246261 3300025900 Bacteria 893
82 Ga0207699_10008784 3300025906 Bacteria 5002
83 Ga0207699_10292997 3300025906 Bacteria 1134
84 Ga0207645_10178389 3300025907 Bacteria 1393
85 Ga0207684_10000056 3300025910 Bacteria 215717
86 Ga0207684_10100816 3300025910 Bacteria 2468
87 Ga0207684_10146400 3300025910 Bacteria 2032
88 Ga0207693_10032742 3300025915 Bacteria 4102
89 Ga0207693_10068532 3300025915 Bacteria 2777
90 Ga0207693_10175808 3300025915 Bacteria 1685
91 Ga0207693_10213564 3300025915 Bacteria 1516
92 Ga0207663_10008051 3300025916 Bacteria 5492
93 Ga0207663_10061712 3300025916 Bacteria 2379
94 Ga0207663_10389377 3300025916 Unclassified 1063
95 Ga0207646_10012151 3300025922 Bacteria 8284
96 Ga0207646_10071799 3300025922 Bacteria 3092
97 Ga0207646_10085136 3300025922 Bacteria 2828
98 Ga0207646_10106422 3300025922 Unclassified 2516
99 Ga0207646_10269609 3300025922 Unclassified 1539
100 Ga0207646_10350102 3300025922 Unclassified 1335
101 Ga0207700_10650960 3300025928 Bacteria 939
102 Ga0207664_10549838 3300025929 Bacteria 1036
103 Ga0207644_10417089 3300025931 Bacteria 1099
104 Ga0207665_10025040 3300025939 Bacteria 3935
105 Ga0207665_10037013 3300025939 Bacteria 3246
106 Ga0207665_10167183 3300025939 Bacteria 1586
107 Ga0207711_10037498 3300025941 Bacteria 4118
108 Ga0207668_10159283 3300025972 Bacteria 1757
109 Ga0207675_100411938 3300026118 Bacteria 1334
110 Ga0209179_1008968 3300027512 Bacteria 1701
111 Ga0209588_1002943 3300027671 Bacteria 4681
112 Ga0209588_1011393 3300027671 Bacteria 2685
113 Ga0209588_1048158 3300027671 Bacteria 1379
114 Ga0209588_1083121 3300027671 Bacteria 1034
115 Ga0207428_10005368 3300027907 Bacteria 11960
116 Ga0268266_10193796 3300028379 Bacteria 1857
117 Ga0307517_10001196 3300028786 Bacteria 43774
118 Ga0307515_10039742 3300028794 Bacteria 7467
119 Ga0307515_10349805 3300028794 Bacteria 1125
120 Ga0307512_10154446 3300030522 Bacteria 1363
121 Ga0307509_10080077 3300031507 Bacteria 3379
122 Ga0307516_10343634 3300031730 Bacteria 1159
123 Ga0307409_100081587 3300031995 Bacteria 2615
124 Ga0307416_100088010 3300032002 Bacteria 2654
125 Ga0307510_10001412 3300033180 Bacteria 26341
126 Ga0307510_10019087 3300033180 Bacteria 8044
127 Ga0373943_0178604 3300035170 Bacteria 1166
128 Ga0373931_0233977 3300035691 Bacteria 1111
129 Ga0373927_0027413 3300035695 Bacteria 3719
130 Ga0436365_1875316 3300039437 Bacteria 8784
131 Ga0436361_0624891 3300039447 Bacteria 2358
132 Ga0451577_0043977 3300042876 Bacteria 3998
133 Ga0466972_0025315 3300044658 Bacteria 2943
134 Ga0453684_0000566 3300044712 Bacteria 138895
135 Ga0453684_0000659 3300044712 Bacteria 123941
136 Ga0451576_0000917 3300045051 Bacteria 55869
137 Ga0495603_0000823 3300046455 Bacteria 17844
138 Ga0495603_0032411 3300046455 Bacteria 3144
139 Ga0495629_0176971 3300046459 Bacteria 1479
140 Ga0495638_0167797 3300046460 Bacteria 1261
141 Ga0495605_0014565 3300046474 Bacteria 4301
142 Ga0495584_0073015 3300046491 Bacteria 1724
143 Ga0495594_0022161 3300046499 Bacteria 3396
144 Ga0495594_0043387 3300046499 Bacteria 2465
145 Ga0495607_0101470 3300046501 Bacteria 1540
146 Ga0495583_0026437 3300046506 Bacteria 2877
147 Ga0495606_0016820 3300046507 Bacteria 5557
148 Ga0495610_0073551 3300046512 Bacteria 1588
149 Ga0495616_0101348 3300046513 Bacteria 1350
150 Ga0495618_0137760 3300046514 Bacteria 1561
151 Ga0495618_0280288 3300046514 Bacteria 1040
152 Ga0495620_0011161 3300046515 Bacteria 4701
153 Ga0495620_0056979 3300046515 Eukaryota 1642
154 Ga0495628_0057736 3300046516 Bacteria 3053
155 Ga0495632_0029327 3300046519 Bacteria 2866
156 Ga0495632_0039816 3300046519 Unclassified 2370
157 Ga0495644_0173603 3300046523 Bacteria 828
158 Ga0495648_0109232 3300046524 Bacteria 1509
159 Ga0495666_0003955 3300046526 Bacteria 7495
160 Ga0495642_0016222 3300046528 Bacteria 2902
161 Ga0495652_0432221 3300046529 Unclassified 925
162 Ga0495597_0028955 3300046542 Bacteria 2531
163 Ga0495622_0004264 3300046557 Bacteria 6655
164 Ga0495633_0140854 3300046558 Bacteria 1115
165 Ga0495656_0268715 3300046615 Bacteria 866
166 Ga0495668_0015712 3300046616 Bacteria 4412
167 Ga0495668_0025366 3300046616 Bacteria 3368
168 Ga0495668_0041099 3300046616 Bacteria 2578
169 Ga0495668_0041659 3300046616 Bacteria 2557
170 Ga0495634_0058370 3300046642 Bacteria 2572
171 Ga0495634_0090298 3300046642 Bacteria 1990
172 Ga0495611_0131711 3300046648 Bacteria 1166
173 Ga0495625_0005226 3300046660 Bacteria 11949
174 Ga0495625_0150151 3300046660 Bacteria 1567
175 Ga0495625_0165528 3300046660 Bacteria 1478
176 Ga0495625_0299704 3300046660 Bacteria 1029
177 Ga0495659_0060216 3300046664 Bacteria 1400
178 Ga0495657_0122906 3300046675 Bacteria 1633
179 Ga0495669_0138382 3300046684 Bacteria 1148
180 Ga0495671_0112898 3300046692 Bacteria 1327
181 Ga0495589_0038147 3300046794 Bacteria 2406
182 Ga0495660_0018393 3300046810 Bacteria 4018
183 Ga0495660_0022489 3300046810 Bacteria 3599
184 Ga0495581_0244284 3300047315 Bacteria 1050
185 Ga0495676_0089067 3300047321 Unclassified 2313
186 Ga0495676_0171702 3300047321 Bacteria 1525
187 Ga0495683_0064398 3300047323 Bacteria 1810
188 Ga0495683_0082196 3300047323 Bacteria 1570
189 Ga0495685_030353 3300047447 Bacteria 1859
190 Ga0495686_0082497 3300047472 Bacteria 1962
191 Ga0495602_0015974 3300048088 Eukaryota 7558
192 Ga0495614_0209054 3300048089 Bacteria 884
193 Ga0495626_0084893 3300048091 Bacteria 1401
194 Ga0496104_0056603 3300048907 Bacteria 3709
195 Ga0496105_0124298 3300048908 Bacteria 2127
196 Ga0496108_0042204 3300048911 Bacteria 3808
197 Ga0496109_0125875 3300048912 Bacteria 2389
198 Ga0496110_0224219 3300048913 Bacteria 1709
199 Ga0496111_0031480 3300048914 Bacteria 3779
200 Ga0496112_0096951 3300048915 Bacteria 2919
201 Ga0496113_0121402 3300048916 Bacteria 2043
202 Ga0496121_0385489 3300048924 Bacteria 923
203 Ga0496124_0048322 3300048927 Bacteria 3637
204 Ga0496126_0051924 3300048929 Bacteria 3730
205 Ga0496126_0137601 3300048929 Bacteria 2105
206 Ga0495678_041364 3300049459 Bacteria 1845
207 Ga0501034_0093394 3300049571 Bacteria 3005
208 Ga0501040_0207196 3300049576 Bacteria 1393
209 Ga0501041_0052186 3300049577 Unclassified 2493
210 Ga0501042_0099110 3300049578 Unclassified 2095
211 Ga0501047_0115890 3300049581 Bacteria 2561
212 Ga0501070_0281915 3300049586 Bacteria 1356
213 Ga0501071_0040735 3300049587 Bacteria 3325
214 Ga0501074_0356339 3300049590 Bacteria 1038
215 Ga0501075_0036846 3300049591 Bacteria 3651
216 Ga0501076_0019660 3300049592 Bacteria 5164
217 Ga0501077_0130704 3300049593 Bacteria 1592
218 Ga0501079_0055642 3300049741 Bacteria 3053
219 Ga0501044_0037538 3300049823 Bacteria 5063
220 Ga0501044_0053418 3300049823 Bacteria 4157
221 nmdc:mga03n38_16943_c1 3300050490 Bacteria 2844
222 nmdc:mga0yw44_3188_c1 3300050492 Bacteria 7215
223 nmdc:mga06z11_108722_c1 3300050494 Bacteria 1532
224 nmdc:mga06z11_12096_c1 3300050494 Bacteria 1868
225 nmdc:mga06z11_39018_c1 3300050494 Bacteria 2362
226 nmdc:mga04h51_24551_c1 3300050495 Bacteria 1847
227 nmdc:mga07m45_79980_c1 3300050496 Bacteria 1866
228 nmdc:mga05p37_179711_c1 3300050507 Unclassified 2575
229 nmdc:mga05p37_51827_c1 3300050507 Bacteria 5046
230 nmdc:mga0n895_378085_c1 3300050512 Bacteria 1433
231 nmdc:mga0n895_88647_c1 3300050512 Unclassified 3094
232 nmdc:mga0rr50_54800_c1 3300050513 Bacteria 2972
233 nmdc:mga08x19_41668_c1 3300050514 Bacteria 2925
234 nmdc:mga0a205_27262_c1 3300050515 Bacteria 5455
235 Ga0495601_0000481 3300053077 Bacteria 20953
236 Ga0495612_0057316 3300053078 Bacteria 1608
237 Ga0500583_0109174 3300053092 Bacteria 1361
238 Ga0500650_0174922 3300053098 Bacteria 985
239 Ga0500556_0130226 3300053104 Bacteria 986
240 Ga0500592_003150 3300053116 Bacteria 2636
241 Ga0500588_0109654 3300053146 Bacteria 961
242 Ga0500611_088373 3300053727 Bacteria 785
243 Ga0501082_0014463 3300060353 Bacteria 6793
244 Ga0501082_0339214 3300060353 Bacteria 1310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0432221 Ga0495652_0432221_26_628 195
2 3300049593 Ga0501077_0130704 Ga0501077_0130704_950_1582 200
3 3300025898 Ga0207692_10045258 Ga0207692_100452582 203
4 3300005467 Ga0070706_100000326 Ga0070706_10000032646 212
5 3300005536 Ga0070697_100006281 Ga0070697_10000628111 212
6 3300025910 Ga0207684_10000056 Ga0207684_10000056168 212
7 3300007076 Ga0075435_100465903 Ga0075435_1004659032 214
8 3300046455 Ga0495603_0032411 Ga0495603_0032411_1741_2400 218
9 3300046615 Ga0495656_0268715 Ga0495656_0268715_195_854 218
10 3300049571 Ga0501034_0093394 Ga0501034_0093394_2122_2880 223
11 3300046514 Ga0495618_0137760 Ga0495618_0137760_166_855 224
12 3300046516 Ga0495628_0057736 Ga0495628_0057736_2247_2936 224
13 3300046642 Ga0495634_0058370 Ga0495634_0058370_569_1258 224
14 3300049586 Ga0501070_0281915 Ga0501070_0281915_333_1142 224
15 3300049823 Ga0501044_0053418 Ga0501044_0053418_1424_2185 224
16 3300053077 Ga0495601_0000481 Ga0495601_0000481_140_829 224
17 3300053078 Ga0495612_0057316 Ga0495612_0057316_158_847 224
18 3300049581 Ga0501047_0115890 Ga0501047_0115890_770_1555 225
19 3300049823 Ga0501044_0037538 Ga0501044_0037538_3023_3808 225
20 3300046648 Ga0495611_0131711 Ga0495611_0131711_214_939 227
21 3300046660 Ga0495625_0150151 Ga0495625_0150151_537_1262 227
22 3300046810 Ga0495660_0022489 Ga0495660_0022489_428_1153 227
23 3300006038 Ga0075365_10000710 Ga0075365_100007105 233
24 3300006051 Ga0075364_10001605 Ga0075364_1000160513 233
25 3300009147 Ga0114129_10131555 Ga0114129_101315552 233
26 3300042876 Ga0451577_0043977 Ga0451577_0043977_1725_2459 233
27 3300044712 Ga0453684_0000566 Ga0453684_0000566_95772_96548 233
28 3300044712 Ga0453684_0000659 Ga0453684_0000659_47611_48345 233
29 3300045051 Ga0451576_0000917 Ga0451576_0000917_13276_14010 233
30 3300050492 nmdc:mga0yw44_3188_c1 nmdc:mga0yw44_3188_c1_312_1034 233
31 3300050507 nmdc:mga05p37_51827_c1 nmdc:mga05p37_51827_c1_1195_1917 233
32 3300005434 Ga0070709_10287698 Ga0070709_102876981 234
33 3300005445 Ga0070708_100136648 Ga0070708_1001366482 234
34 3300005518 Ga0070699_100166640 Ga0070699_1001666402 234
35 3300006846 Ga0075430_100025043 Ga0075430_1000250432 234
36 3300006852 Ga0075433_10053359 Ga0075433_100533596 234
37 3300007788 Ga0099795_10146031 Ga0099795_101460311 234
38 3300009094 Ga0111539_10222655 Ga0111539_102226553 234
39 3300025900 Ga0207710_10246261 Ga0207710_102462611 234
40 3300025906 Ga0207699_10292997 Ga0207699_102929972 234
41 3300025907 Ga0207645_10178389 Ga0207645_101783892 234
42 3300025915 Ga0207693_10213564 Ga0207693_102135642 234
43 3300025939 Ga0207665_10167183 Ga0207665_101671832 234
44 3300025972 Ga0207668_10159283 Ga0207668_101592832 234
45 3300027671 Ga0209588_1011393 Ga0209588_10113932 234
46 3300027907 Ga0207428_10005368 Ga0207428_100053686 234
47 3300039447 Ga0436361_0624891 Ga0436361_0624891_1057_1824 234
48 iso_pu_bacteria 2515154112 2515625569 234
49 iso_pu_bacteria 2617270741 2617375277 234
50 iso_pu_bacteria 2847939898 2847947047 234
51 iso_pu_bacteria 2874590934 2874597612 234
52 iso_pu_bacteria 2874645413 2874649176 234
53 iso_pu_bacteria 2876771140 2876774915 234
54 iso_pu_bacteria 2876818435 2876822333 234
55 iso_pu_bacteria 2879074833 2879078003 234
56 iso_pu_bacteria 2879127579 2879132446 234
57 iso_pu_bacteria 2879142872 2879145255 234
58 iso_pu_bacteria 2935975950 2935976518 234
59 iso_pu_bacteria 8019619141 8019625280 234
60 iso_pu_bacteria 8019629233 8019636901 234
61 iso_pu_bacteria 8019659431 8019664720 234
62 iso_pu_bacteria 8019668869 8019674307 234
63 iso_pu_bacteria 8019678201 8019681811 234
64 3300046514 Ga0495618_0280288 Ga0495618_0280288_133_843 235
65 3300046515 Ga0495620_0056979 Ga0495620_0056979_244_993 235
66 3300046642 Ga0495634_0090298 Ga0495634_0090298_850_1560 235
67 3300046675 Ga0495657_0122906 Ga0495657_0122906_257_967 235
68 3300048088 Ga0495602_0015974 Ga0495602_0015974_2436_3164 235
69 3300048089 Ga0495614_0209054 Ga0495614_0209054_125_835 235
70 3300005435 Ga0070714_100509656 Ga0070714_1005096562 236
71 3300025929 Ga0207664_10549838 Ga0207664_105498381 236
72 3300046616 Ga0495668_0015712 Ga0495668_0015712_1389_2108 236
73 3300003322 rootL2_10073075 rootL2_100730752 237
74 3300005434 Ga0070709_10100105 Ga0070709_101001052 237
75 3300005436 Ga0070713_100393852 Ga0070713_1003938522 237
76 3300005445 Ga0070708_100554030 Ga0070708_1005540301 237
77 3300006051 Ga0075364_10169824 Ga0075364_101698242 237
78 3300006914 Ga0075436_100028490 Ga0075436_1000284903 237
79 3300007265 Ga0099794_10047452 Ga0099794_100474522 237
80 3300025916 Ga0207663_10389377 Ga0207663_103893771 237
81 3300025922 Ga0207646_10269609 Ga0207646_102696091 237
82 3300025928 Ga0207700_10650960 Ga0207700_106509602 237
83 3300025939 Ga0207665_10037013 Ga0207665_100370133 237
84 3300028786 Ga0307517_10001196 Ga0307517_100011965 237
85 3300028794 Ga0307515_10039742 Ga0307515_100397427 237
86 3300031995 Ga0307409_100081587 Ga0307409_1000815873 237
87 3300032002 Ga0307416_100088010 Ga0307416_1000880102 237
88 3300033180 Ga0307510_10019087 Ga0307510_100190873 237
89 3300046660 Ga0495625_0165528 Ga0495625_0165528_14_730 237
90 3300047321 Ga0495676_0089067 Ga0495676_0089067_620_1351 237
91 3300050512 nmdc:mga0n895_378085_c1 nmdc:mga0n895_378085_c1_490_1260 237
92 3300050514 nmdc:mga08x19_41668_c1 nmdc:mga08x19_41668_c1_1334_2086 237
93 3300002773 JGI25152J39213_1004208 JGI25152J39213_10042084 238
94 3300003187 JGI25151J46595_10000790 JGI25151J46595_1000079018 238
95 3300003322 rootL2_10166148 rootL2_101661482 238
96 3300003322 rootL2_10338680 rootL2_103386801 238
97 3300005355 Ga0070671_100063694 Ga0070671_1000636942 238
98 3300005434 Ga0070709_10008546 Ga0070709_100085463 238
99 3300005434 Ga0070709_10021441 Ga0070709_100214412 238
100 3300005436 Ga0070713_100101753 Ga0070713_1001017533 238
101 3300005436 Ga0070713_100158722 Ga0070713_1001587222 238
102 3300005437 Ga0070710_10107153 Ga0070710_101071532 238
103 3300005439 Ga0070711_100009711 Ga0070711_1000097112 238
104 3300005439 Ga0070711_100077256 Ga0070711_1000772563 238
105 3300005445 Ga0070708_100043539 Ga0070708_1000435393 238
106 3300005445 Ga0070708_100075183 Ga0070708_1000751834 238
107 3300005445 Ga0070708_100109733 Ga0070708_1001097333 238
108 3300005445 Ga0070708_100788204 Ga0070708_1007882041 238
109 3300005467 Ga0070706_100092514 Ga0070706_1000925142 238
110 3300005467 Ga0070706_100144704 Ga0070706_1001447042 238
111 3300005468 Ga0070707_100015731 Ga0070707_1000157319 238
112 3300005468 Ga0070707_100036107 Ga0070707_1000361072 238
113 3300005468 Ga0070707_100062992 Ga0070707_1000629923 238
114 3300005468 Ga0070707_100067025 Ga0070707_1000670252 238
115 3300005518 Ga0070699_100074208 Ga0070699_1000742084 238
116 3300005518 Ga0070699_100102381 Ga0070699_1001023813 238
117 3300005518 Ga0070699_100213762 Ga0070699_1002137623 238
118 3300005536 Ga0070697_100008941 Ga0070697_1000089412 238
119 3300005536 Ga0070697_100049914 Ga0070697_1000499142 238
120 3300005536 Ga0070697_100227635 Ga0070697_1002276352 238
121 3300005536 Ga0070697_100464415 Ga0070697_1004644152 238
122 3300005841 Ga0068863_100452089 Ga0068863_1004520891 238
123 3300005981 Ga0081538_10000002 Ga0081538_1000000268 238
124 3300005981 Ga0081538_10000103 Ga0081538_1000010359 238
125 3300006042 Ga0075368_10018093 Ga0075368_100180934 238
126 3300006048 Ga0075363_100093677 Ga0075363_1000936771 238
127 3300006173 Ga0070716_100007372 Ga0070716_1000073724 238
128 3300006173 Ga0070716_100485275 Ga0070716_1004852751 238
129 3300006175 Ga0070712_100055065 Ga0070712_1000550653 238
130 3300006178 Ga0075367_10000674 Ga0075367_100006744 238
131 3300006178 Ga0075367_10020993 Ga0075367_100209932 238
132 3300006178 Ga0075367_10089833 Ga0075367_100898331 238
133 3300006353 Ga0075370_10074066 Ga0075370_100740662 238
134 3300006871 Ga0075434_100049932 Ga0075434_1000499322 238
135 3300006914 Ga0075436_100538442 Ga0075436_1005384421 238
136 3300007076 Ga0075435_100084653 Ga0075435_1000846532 238
137 3300007265 Ga0099794_10016514 Ga0099794_100165144 238
138 3300007265 Ga0099794_10052391 Ga0099794_100523913 238
139 3300007265 Ga0099794_10094837 Ga0099794_100948372 238
140 3300007788 Ga0099795_10042019 Ga0099795_100420191 238
141 3300009094 Ga0111539_10321024 Ga0111539_103210243 238
142 3300009147 Ga0114129_10045124 Ga0114129_100451242 238
143 3300009147 Ga0114129_10379114 Ga0114129_103791142 238
144 3300009147 Ga0114129_10379941 Ga0114129_103799413 238
145 3300009177 Ga0105248_10149873 Ga0105248_101498733 238
146 3300010159 Ga0099796_10019072 Ga0099796_100190722 238
147 3300010159 Ga0099796_10036115 Ga0099796_100361153 238
148 3300014968 Ga0157379_10064309 Ga0157379_100643093 238
149 3300025258 Ga0209129_1000120 Ga0209129_100012063 238
150 3300025294 Ga0209025_1000252 Ga0209025_100025259 238
151 3300025906 Ga0207699_10008784 Ga0207699_100087844 238
152 3300025910 Ga0207684_10100816 Ga0207684_101008162 238
153 3300025910 Ga0207684_10146400 Ga0207684_101464002 238
154 3300025915 Ga0207693_10032742 Ga0207693_100327423 238
155 3300025915 Ga0207693_10068532 Ga0207693_100685323 238
156 3300025915 Ga0207693_10175808 Ga0207693_101758082 238
157 3300025916 Ga0207663_10008051 Ga0207663_100080513 238
158 3300025916 Ga0207663_10061712 Ga0207663_100617121 238
159 3300025922 Ga0207646_10012151 Ga0207646_100121514 238
160 3300025922 Ga0207646_10071799 Ga0207646_100717993 238
161 3300025922 Ga0207646_10085136 Ga0207646_100851363 238
162 3300025922 Ga0207646_10106422 Ga0207646_101064223 238
163 3300025922 Ga0207646_10350102 Ga0207646_103501022 238
164 3300025931 Ga0207644_10417089 Ga0207644_104170891 238
165 3300025939 Ga0207665_10025040 Ga0207665_100250402 238
166 3300025941 Ga0207711_10037498 Ga0207711_100374983 238
167 3300026118 Ga0207675_100411938 Ga0207675_1004119382 238
168 3300027512 Ga0209179_1008968 Ga0209179_10089681 238
169 3300027671 Ga0209588_1002943 Ga0209588_10029433 238
170 3300027671 Ga0209588_1048158 Ga0209588_10481582 238
171 3300027671 Ga0209588_1083121 Ga0209588_10831211 238
172 3300028379 Ga0268266_10193796 Ga0268266_101937963 238
173 3300028794 Ga0307515_10349805 Ga0307515_103498052 238
174 3300030522 Ga0307512_10154446 Ga0307512_101544462 238
175 3300031507 Ga0307509_10080077 Ga0307509_100800774 238
176 3300031730 Ga0307516_10343634 Ga0307516_103436341 238
177 3300033180 Ga0307510_10001412 Ga0307510_1000141212 238
178 3300035170 Ga0373943_0178604 Ga0373943_0178604_141_866 238
179 3300035691 Ga0373931_0233977 Ga0373931_0233977_334_1053 238
180 3300035695 Ga0373927_0027413 Ga0373927_0027413_2498_3223 238
181 3300039437 Ga0436365_1875316 Ga0436365_1875316_1761_2498 238
182 3300044658 Ga0466972_0025315 Ga0466972_0025315_1623_2345 238
183 3300046455 Ga0495603_0000823 Ga0495603_0000823_9102_9821 238
184 3300046459 Ga0495629_0176971 Ga0495629_0176971_10_729 238
185 3300046460 Ga0495638_0167797 Ga0495638_0167797_486_1205 238
186 3300046474 Ga0495605_0014565 Ga0495605_0014565_2774_3493 238
187 3300046491 Ga0495584_0073015 Ga0495584_0073015_17_736 238
188 3300046499 Ga0495594_0022161 Ga0495594_0022161_1177_1896 238
189 3300046499 Ga0495594_0043387 Ga0495594_0043387_1065_1784 238
190 3300046501 Ga0495607_0101470 Ga0495607_0101470_260_979 238
191 3300046506 Ga0495583_0026437 Ga0495583_0026437_167_886 238
192 3300046507 Ga0495606_0016820 Ga0495606_0016820_208_927 238
193 3300046512 Ga0495610_0073551 Ga0495610_0073551_165_884 238
194 3300046513 Ga0495616_0101348 Ga0495616_0101348_594_1313 238
195 3300046515 Ga0495620_0011161 Ga0495620_0011161_284_1003 238
196 3300046519 Ga0495632_0029327 Ga0495632_0029327_1782_2501 238
197 3300046519 Ga0495632_0039816 Ga0495632_0039816_84_806 238
198 3300046523 Ga0495644_0173603 Ga0495644_0173603_46_765 238
199 3300046524 Ga0495648_0109232 Ga0495648_0109232_510_1229 238
200 3300046526 Ga0495666_0003955 Ga0495666_0003955_6110_6829 238
201 3300046528 Ga0495642_0016222 Ga0495642_0016222_657_1376 238
202 3300046542 Ga0495597_0028955 Ga0495597_0028955_425_1144 238
203 3300046557 Ga0495622_0004264 Ga0495622_0004264_4103_4822 238
204 3300046558 Ga0495633_0140854 Ga0495633_0140854_85_804 238
205 3300046616 Ga0495668_0025366 Ga0495668_0025366_2166_2885 238
206 3300046616 Ga0495668_0041099 Ga0495668_0041099_818_1537 238
207 3300046616 Ga0495668_0041659 Ga0495668_0041659_232_951 238
208 3300046660 Ga0495625_0005226 Ga0495625_0005226_2661_3380 238
209 3300046660 Ga0495625_0299704 Ga0495625_0299704_44_763 238
210 3300046664 Ga0495659_0060216 Ga0495659_0060216_515_1234 238
211 3300046684 Ga0495669_0138382 Ga0495669_0138382_409_1128 238
212 3300046692 Ga0495671_0112898 Ga0495671_0112898_43_762 238
213 3300046794 Ga0495589_0038147 Ga0495589_0038147_1362_2081 238
214 3300046810 Ga0495660_0018393 Ga0495660_0018393_335_1054 238
215 3300047315 Ga0495581_0244284 Ga0495581_0244284_212_931 238
216 3300047321 Ga0495676_0171702 Ga0495676_0171702_775_1494 238
217 3300047323 Ga0495683_0064398 Ga0495683_0064398_475_1194 238
218 3300047323 Ga0495683_0082196 Ga0495683_0082196_664_1383 238
219 3300047447 Ga0495685_030353 Ga0495685_030353_911_1630 238
220 3300047472 Ga0495686_0082497 Ga0495686_0082497_371_1090 238
221 3300048091 Ga0495626_0084893 Ga0495626_0084893_345_1064 238
222 3300048907 Ga0496104_0056603 Ga0496104_0056603_2914_3633 238
223 3300048908 Ga0496105_0124298 Ga0496105_0124298_1085_1804 238
224 3300048911 Ga0496108_0042204 Ga0496108_0042204_1040_1759 238
225 3300048912 Ga0496109_0125875 Ga0496109_0125875_724_1443 238
226 3300048913 Ga0496110_0224219 Ga0496110_0224219_496_1215 238
227 3300048914 Ga0496111_0031480 Ga0496111_0031480_969_1688 238
228 3300048915 Ga0496112_0096951 Ga0496112_0096951_1716_2435 238
229 3300048916 Ga0496113_0121402 Ga0496113_0121402_431_1150 238
230 3300048924 Ga0496121_0385489 Ga0496121_0385489_68_784 238
231 3300048927 Ga0496124_0048322 Ga0496124_0048322_1667_2386 238
232 3300048929 Ga0496126_0051924 Ga0496126_0051924_1678_2442 238
233 3300048929 Ga0496126_0137601 Ga0496126_0137601_965_1684 238
234 3300049459 Ga0495678_041364 Ga0495678_041364_808_1527 238
235 3300049576 Ga0501040_0207196 Ga0501040_0207196_348_1094 238
236 3300049577 Ga0501041_0052186 Ga0501041_0052186_1161_1907 238
237 3300049578 Ga0501042_0099110 Ga0501042_0099110_249_995 238
238 3300049587 Ga0501071_0040735 Ga0501071_0040735_2463_3209 238
239 3300049590 Ga0501074_0356339 Ga0501074_0356339_163_909 238
240 3300049591 Ga0501075_0036846 Ga0501075_0036846_117_863 238
241 3300049592 Ga0501076_0019660 Ga0501076_0019660_798_1544 238
242 3300049741 Ga0501079_0055642 Ga0501079_0055642_249_995 238
243 3300050490 nmdc:mga03n38_16943_c1 nmdc:mga03n38_16943_c1_421_1140 238
244 3300050494 nmdc:mga06z11_108722_c1 nmdc:mga06z11_108722_c1_95_814 238
245 3300050494 nmdc:mga06z11_12096_c1 nmdc:mga06z11_12096_c1_140_859 238
246 3300050494 nmdc:mga06z11_39018_c1 nmdc:mga06z11_39018_c1_776_1495 238
247 3300050495 nmdc:mga04h51_24551_c1 nmdc:mga04h51_24551_c1_31_750 238
248 3300050496 nmdc:mga07m45_79980_c1 nmdc:mga07m45_79980_c1_477_1196 238
249 3300050507 nmdc:mga05p37_179711_c1 nmdc:mga05p37_179711_c1_876_1613 238
250 3300050512 nmdc:mga0n895_88647_c1 nmdc:mga0n895_88647_c1_1353_2093 238
251 3300050513 nmdc:mga0rr50_54800_c1 nmdc:mga0rr50_54800_c1_2109_2849 238
252 3300050515 nmdc:mga0a205_27262_c1 nmdc:mga0a205_27262_c1_4014_4754 238
253 3300053092 Ga0500583_0109174 Ga0500583_0109174_122_847 238
254 3300053098 Ga0500650_0174922 Ga0500650_0174922_236_955 238
255 3300053104 Ga0500556_0130226 Ga0500556_0130226_251_970 238
256 3300053116 Ga0500592_003150 Ga0500592_003150_230_958 238
257 3300053146 Ga0500588_0109654 Ga0500588_0109654_162_881 238
258 3300053727 Ga0500611_088373 Ga0500611_088373_24_743 238
259 3300060353 Ga0501082_0014463 Ga0501082_0014463_5828_6574 238
260 3300060353 Ga0501082_0339214 Ga0501082_0339214_56_787 238
261 iso_pu_bacteria 2857453340 2857454531 238
262 iso_pu_bacteria 8056533031 8056539054 238

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tgi-assembly2.cif.gz_B structure of the snx5 px domain in complex with chlamydial protein ince in space group p212121 0.6991 133 172
6n5y-assembly1.cif.gz_A crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) 0.6844 132 172
6n5x-assembly1.cif.gz_A crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) 0.6603 131 172
6n5z-assembly1.cif.gz_A crystal structure of the snx5 px domain in complex with the sema4c 0.6509 131 172
6e8r-assembly2.cif.gz_B structure of the snx32 px domain in complex with chlamydial protein ince in space group i121 0.6495 134 172
ID Description Score Start End Superfamily
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9453 1 238 3.40.605.10
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9414 1 238 3.40.605.10
3p0cB00 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7471 133 172 3.30.1520.10
af_K7MZ69_153_218_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.717 63 91 2.60.40.1180
af_Q4DW43_4_102_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7085 135 172 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A2W5P5V3-F1-model_v4 SnoaL-like domain-containing protein 0.9866 1 235
AF-A0A2C9B7W7-F1-model_v4 deleted 0.9843 1 238
AF-A0A0D7Q0B0-F1-model_v4 Uncharacterized protein 0.983 1 237
AF-A0A2C9B7W7-F1-model_v4 deleted 0.9802 1 238
AF-T0G934-F1-model_v4 Uncharacterized protein 0.98 1 172

Feature Viewer

pLDDT pTM Quality
95.02 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map