F370941

General Info

Members Datasets Scaffolds Average Seq Length
262 144 502 134

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100021293|Ga0070665_1000212933
Length 140
Sequence MWRAVGLFFCIVASFALTIQALAAPSLVGTWFGYGQPDSKDSMYLDHFLANGQLHSQFRDCIKGKVLDDSTEDGTWSVKGDILTVKIERHDGIAAPRIDTYRLTSVTAQRFKDVYIPLNFPFDEMRVEDNFKMPGCQLTS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 1.15
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 25.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100021293 3300005548 Bacteria 6520
2 rootL2_10099236 3300003322 Bacteria 2563
3 Ga0065707_10607032 3300005295 Unclassified 686
4 Ga0070658_10313311 3300005327 Unclassified 1339
5 Ga0070658_11504357 3300005327 Bacteria 584
6 Ga0070676_10059488 3300005328 Bacteria 2266
7 Ga0070676_10170508 3300005328 Unclassified 1407
8 Ga0070670_101309668 3300005331 Unclassified 663
9 Ga0070677_10119489 3300005333 Bacteria 1188
10 Ga0070677_10907211 3300005333 Bacteria 509
11 Ga0068869_100550136 3300005334 Unclassified 969
12 Ga0068869_100568448 3300005334 Archaea 954
13 Ga0068868_100012816 3300005338 Bacteria 6133
14 Ga0068868_100290378 3300005338 Bacteria 1386
15 Ga0068868_101749291 3300005338 Unclassified 587
16 Ga0070660_100396552 3300005339 Bacteria 1140
17 Ga0070689_100341981 3300005340 Bacteria 1253
18 Ga0070675_100041997 3300005354 Bacteria 3736
19 Ga0070675_101097061 3300005354 Bacteria 732
20 Ga0070674_100172520 3300005356 Bacteria 1650
21 Ga0070674_100264869 3300005356 Bacteria 1356
22 Ga0070674_101462857 3300005356 Unclassified 613
23 Ga0070673_100021616 3300005364 Bacteria 4669
24 Ga0070673_100814191 3300005364 Bacteria 863
25 Ga0070659_100818003 3300005366 Bacteria 811
26 Ga0070667_100211154 3300005367 Bacteria 1725
27 Ga0070667_100587848 3300005367 Bacteria 1025
28 Ga0070713_100036213 3300005436 Bacteria 3981
29 Ga0070711_100354352 3300005439 Archaea 1180
30 Ga0070711_100703505 3300005439 Unclassified 851
31 Ga0070700_100255929 3300005441 Bacteria 1258
32 Ga0070678_100076598 3300005456 Bacteria 2520
33 Ga0070678_100730558 3300005456 Bacteria 894
34 Ga0070662_100529885 3300005457 Bacteria 985
35 Ga0070662_100948341 3300005457 Unclassified 735
36 Ga0070681_10140838 3300005458 Bacteria 2341
37 Ga0068867_100026914 3300005459 Bacteria 4132
38 Ga0068867_100187450 3300005459 Bacteria 1649
39 Ga0068867_100564203 3300005459 Bacteria 988
40 Ga0070679_100078954 3300005530 Bacteria 3280
41 Ga0070684_100092815 3300005535 Bacteria 2686
42 Ga0068853_102213307 3300005539 Unclassified 533
43 Ga0070672_100364004 3300005543 Unclassified 1235
44 Ga0070672_100916113 3300005543 Unclassified 775
45 Ga0070695_100120490 3300005545 Bacteria 1794
46 Ga0070665_100019901 3300005548 Bacteria 6740
47 Ga0070665_100025067 3300005548 Bacteria 6011
48 Ga0070665_100316776 3300005548 Bacteria 1564
49 Ga0070665_100432192 3300005548 Bacteria 1326
50 Ga0070665_102610832 3300005548 Unclassified 506
51 Ga0068855_100021222 3300005563 Bacteria 7786
52 Ga0068855_100156112 3300005563 Bacteria 2592
53 Ga0070664_101578474 3300005564 Unclassified 621
54 Ga0068857_100621115 3300005577 Bacteria 1023
55 Ga0068856_100239484 3300005614 Bacteria 1830
56 Ga0068856_100710244 3300005614 Bacteria 1025
57 Ga0068852_101367354 3300005616 Bacteria 730
58 Ga0068864_101174303 3300005618 Unclassified 766
59 Ga0068861_101061620 3300005719 Bacteria 776
60 Ga0068870_10011598 3300005840 Bacteria 4093
61 Ga0068863_100457191 3300005841 Unclassified 1253
62 Ga0068863_101258421 3300005841 Unclassified 746
63 Ga0068858_100054142 3300005842 Bacteria 3710
64 Ga0068858_101566328 3300005842 Bacteria 650
65 Ga0068858_101682417 3300005842 Unclassified 626
66 Ga0068858_101935699 3300005842 Unclassified 583
67 Ga0068860_100259006 3300005843 Bacteria 1695
68 Ga0097621_100000074 3300006237 Bacteria 51891
69 Ga0097621_100142923 3300006237 Bacteria 2046
70 Ga0097621_100196808 3300006237 Bacteria 1748
71 Ga0097621_100312695 3300006237 Bacteria 1390
72 Ga0097621_100333782 3300006237 Bacteria 1345
73 Ga0097621_100963964 3300006237 Bacteria 797
74 Ga0097621_101072085 3300006237 Bacteria 755
75 Ga0068871_100008382 3300006358 Bacteria 7433
76 Ga0068871_100070544 3300006358 Bacteria 2872
77 Ga0068871_100142077 3300006358 Unclassified 2042
78 Ga0068871_100551283 3300006358 Unclassified 1044
79 Ga0068871_100604221 3300006358 Unclassified 998
80 Ga0068865_100699852 3300006881 Bacteria 866
81 Ga0068865_100806560 3300006881 Unclassified 810
82 Ga0105240_10119277 3300009093 Bacteria 3178
83 Ga0105240_10152731 3300009093 Bacteria 2748
84 Ga0105240_10319642 3300009093 Unclassified 1770
85 Ga0105240_10517048 3300009093 Bacteria 1325
86 Ga0105245_10530462 3300009098 Archaea 1197
87 Ga0105247_10147436 3300009101 Bacteria 1548
88 Ga0105243_10026981 3300009148 Bacteria 4398
89 Ga0105243_11076604 3300009148 Bacteria 811
90 Ga0105241_10143623 3300009174 Bacteria 1946
91 Ga0105241_10395615 3300009174 Bacteria 1211
92 Ga0105241_10712657 3300009174 Unclassified 917
93 Ga0105241_11113702 3300009174 Bacteria 744
94 Ga0105242_10139509 3300009176 Bacteria 2102
95 Ga0105242_10140567 3300009176 Bacteria 2094
96 Ga0105242_10285147 3300009176 Bacteria 1502
97 Ga0105242_11233899 3300009176 Bacteria 768
98 Ga0105248_10073810 3300009177 Bacteria 3834
99 Ga0105237_10061224 3300009545 Bacteria 3764
100 Ga0105237_10358795 3300009545 Bacteria 1462
101 Ga0105237_10510650 3300009545 Bacteria 1208
102 Ga0105237_11085661 3300009545 Bacteria 807
103 Ga0105237_11104368 3300009545 Unclassified 800
104 Ga0105238_10055328 3300009551 Bacteria 3983
105 Ga0105238_11337446 3300009551 Unclassified 743
106 Ga0105249_10125440 3300009553 Bacteria 2444
107 Ga0105249_10263618 3300009553 Unclassified 1713
108 Ga0105249_10403577 3300009553 Unclassified 1397
109 Ga0099796_10285370 3300010159 Bacteria 695
110 Ga0105239_10210211 3300010375 Bacteria 2181
111 Ga0105239_10279316 3300010375 Bacteria 1880
112 Ga0105239_10281667 3300010375 Bacteria 1872
113 Ga0105239_10285312 3300010375 Bacteria 1859
114 Ga0105239_10369628 3300010375 Unclassified 1620
115 Ga0105246_10035761 3300011119 Bacteria 3322
116 Ga0105246_10092454 3300011119 Unclassified 2183
117 Ga0105246_10212987 3300011119 Bacteria 1509
118 Ga0105246_10791940 3300011119 Unclassified 840
119 Ga0157370_10035726 3300013104 Bacteria 4827
120 Ga0157370_10092658 3300013104 Bacteria 2836
121 Ga0157369_10117920 3300013105 Bacteria 2817
122 Ga0157374_10353785 3300013296 Bacteria 1460
123 Ga0157378_10009027 3300013297 Bacteria 8679
124 Ga0157378_10034596 3300013297 Bacteria 4468
125 Ga0157378_10184839 3300013297 Bacteria 1962
126 Ga0157378_10262893 3300013297 Bacteria 1656
127 Ga0163162_10103007 3300013306 Bacteria 2948
128 Ga0163162_12671106 3300013306 Unclassified 575
129 Ga0157372_10266703 3300013307 Bacteria 1989
130 Ga0157375_10417194 3300013308 Bacteria 1508
131 Ga0157375_11079987 3300013308 Bacteria 939
132 Ga0157375_11200950 3300013308 Bacteria 890
133 Ga0163163_10000555 3300014325 Bacteria 32756
134 Ga0163163_10405792 3300014325 Bacteria 1421
135 Ga0163163_11052764 3300014325 Unclassified 877
136 Ga0163163_11998837 3300014325 Bacteria 639
137 Ga0157377_10060972 3300014745 Bacteria 2154
138 Ga0157379_10000302 3300014968 Bacteria 39090
139 Ga0157379_10055567 3300014968 Bacteria 3537
140 Ga0157379_10095028 3300014968 Bacteria 2674
141 Ga0157379_12161441 3300014968 Unclassified 552
142 Ga0157376_11168333 3300014969 Bacteria 797
143 Ga0157376_11212256 3300014969 Bacteria 783
144 Ga0157376_11668685 3300014969 Unclassified 672
145 Ga0209758_1050726 3300025297 Bacteria 1452
146 Ga0209758_1076730 3300025297 Bacteria 1027
147 Ga0207642_11112733 3300025899 Bacteria 511
148 Ga0207710_10422459 3300025900 Unclassified 686
149 Ga0207688_10248538 3300025901 Bacteria 1077
150 Ga0207645_10012609 3300025907 Bacteria 5731
151 Ga0207645_10863531 3300025907 Unclassified 615
152 Ga0207654_10074115 3300025911 Bacteria 2031
153 Ga0207654_10620063 3300025911 Unclassified 773
154 Ga0207654_10863326 3300025911 Unclassified 655
155 Ga0207707_10153735 3300025912 Bacteria 2012
156 Ga0207695_10117322 3300025913 Bacteria 2635
157 Ga0207695_10134309 3300025913 Bacteria 2429
158 Ga0207671_10122406 3300025914 Bacteria 1989
159 Ga0207671_10356667 3300025914 Bacteria 1160
160 Ga0207671_10396409 3300025914 Bacteria 1097
161 Ga0207671_11442285 3300025914 Unclassified 533
162 Ga0207657_10042390 3300025919 Bacteria 4016
163 Ga0207649_10606317 3300025920 Unclassified 842
164 Ga0207650_10527104 3300025925 Unclassified 989
165 Ga0207650_11281689 3300025925 Bacteria 624
166 Ga0207659_10065552 3300025926 Bacteria 2632
167 Ga0207687_10417771 3300025927 Archaea 1106
168 Ga0207700_10079377 3300025928 Bacteria 2556
169 Ga0207690_10424089 3300025932 Bacteria 1065
170 Ga0207706_10644282 3300025933 Bacteria 908
171 Ga0207686_10028851 3300025934 Bacteria 3266
172 Ga0207686_10115294 3300025934 Bacteria 1819
173 Ga0207709_10042743 3300025935 Bacteria 2728
174 Ga0207670_10301367 3300025936 Bacteria 1255
175 Ga0207669_10305233 3300025937 Bacteria 1211
176 Ga0207691_10122277 3300025940 Bacteria 2306
177 Ga0207711_10027672 3300025941 Bacteria 4764
178 Ga0207689_10165977 3300025942 Unclassified 1819
179 Ga0207679_10670838 3300025945 Bacteria 939
180 Ga0207667_10180244 3300025949 Bacteria 2169
181 Ga0207712_10542799 3300025961 Unclassified 999
182 Ga0207712_10781681 3300025961 Bacteria 838
183 Ga0207712_11138270 3300025961 Unclassified 695
184 Ga0207712_11742540 3300025961 Unclassified 558
185 Ga0207658_10452606 3300025986 Bacteria 1137
186 Ga0207677_10003907 3300026023 Bacteria 7938
187 Ga0207677_10244396 3300026023 Bacteria 1454
188 Ga0207677_10296491 3300026023 Bacteria 1334
189 Ga0207703_10481360 3300026035 Bacteria 1163
190 Ga0207703_10676747 3300026035 Bacteria 980
191 Ga0207703_11290470 3300026035 Unclassified 702
192 Ga0207703_11581329 3300026035 Bacteria 631
193 Ga0207639_11969901 3300026041 Unclassified 545
194 Ga0207708_10232741 3300026075 Bacteria 1480
195 Ga0207702_10176524 3300026078 Bacteria 1964
196 Ga0207702_11149045 3300026078 Unclassified 770
197 Ga0207641_10027811 3300026088 Bacteria 4671
198 Ga0207641_10140327 3300026088 Bacteria 2180
199 Ga0207648_10003271 3300026089 Bacteria 17035
200 Ga0207648_10211121 3300026089 Bacteria 1723
201 Ga0207676_10924373 3300026095 Unclassified 857
202 Ga0207676_11081585 3300026095 Unclassified 792
203 Ga0207674_10159292 3300026116 Bacteria 2212
204 Ga0207674_10599860 3300026116 Unclassified 1064
205 Ga0207683_10509896 3300026121 Bacteria 1111
206 Ga0207698_11554656 3300026142 Bacteria 677
207 Ga0207698_12322085 3300026142 Unclassified 548
208 Ga0268266_10014570 3300028379 Bacteria 6756
209 Ga0268266_10024251 3300028379 Bacteria 5162
210 Ga0268266_10075272 3300028379 Bacteria 2932
211 Ga0268266_10451513 3300028379 Bacteria 1222
212 Ga0268264_10625327 3300028381 Bacteria 1063
213 Ga0307517_10067324 3300028786 Bacteria 3280
214 Ga0265338_10001374 3300028800 Bacteria 39593
215 Ga0265320_10144637 3300031240 Unclassified 1075
216 Ga0265331_10008054 3300031250 Bacteria 6023
217 Ga0265316_10226974 3300031344 Unclassified 1376
218 Ga0307513_10371574 3300031456 Bacteria 1172
219 Ga0265313_10030550 3300031595 Bacteria 2772
220 Ga0265314_10004478 3300031711 Bacteria 12957
221 Ga0307516_10170448 3300031730 Bacteria 1918
222 Ga0373938_0089661 3300034957 Unclassified 759
223 Ga0373928_0115916 3300035084 Unclassified 713
224 Ga0373932_0154003 3300035112 Unclassified 791
225 Ga0373931_0469645 3300035691 Unclassified 807
226 Ga0373931_1032417 3300035691 Unclassified 557
227 Ga0451802_0996277 3300041460 Bacteria 1794
228 Ga0451804_0142522 3300041463 Bacteria 1113
229 Ga0451839_1110169 3300041496 Unclassified 626
230 Ga0451839_1256103 3300041496 Unclassified 659
231 Ga0466957_0150396 3300044842 Bacteria 1505
232 Ga0466967_1225193 3300045976 Bacteria 748
233 Ga0495617_184416 3300046452 Bacteria 656
234 Ga0495592_0240339 3300046454 Bacteria 1202
235 Ga0495629_1059853 3300046459 Unclassified 525
236 Ga0495606_0120834 3300046507 Bacteria 1568
237 Ga0495587_0199083 3300046536 Bacteria 1133
238 Ga0495609_0073255 3300046538 Bacteria 1503
239 Ga0495622_0003754 3300046557 Bacteria 7107
240 Ga0495613_0205553 3300046689 Bacteria 1387
241 Ga0495624_0758291 3300046690 Bacteria 575
242 Ga0495670_0224707 3300046691 Unclassified 998
243 Ga0495649_0100138 3300046694 Bacteria 1541
244 Ga0495636_0150464 3300047318 Bacteria 1044
245 Ga0495672_0404626 3300047320 Bacteria 623
246 Ga0496115_1116433 3300048918 Bacteria 597
247 Ga0501034_0270362 3300049571 Bacteria 1641
248 Ga0500595_002649 3300053119 Bacteria 8710
249 Ga0500559_0218450 3300053136 Bacteria 899
250 Ga0500573_0000009 3300053140 Bacteria 230823
251 Ga0500577_0310021 3300053142 Unclassified 689
252 Ga0070665_100021293
253 rootL2_10099236
254 Ga0065707_10607032
255 Ga0070658_10313311
256 Ga0070658_11504357
257 Ga0070676_10059488
258 Ga0070676_10170508
259 Ga0070670_101309668
260 Ga0070677_10119489
261 Ga0070677_10907211
262 Ga0068869_100550136
263 Ga0068869_100568448
264 Ga0068868_100012816
265 Ga0068868_100290378
266 Ga0068868_101749291
267 Ga0070660_100396552
268 Ga0070689_100341981
269 Ga0070675_100041997
270 Ga0070675_101097061
271 Ga0070674_100172520
272 Ga0070674_100264869
273 Ga0070674_101462857
274 Ga0070673_100021616
275 Ga0070673_100814191
276 Ga0070659_100818003
277 Ga0070667_100211154
278 Ga0070667_100587848
279 Ga0070713_100036213
280 Ga0070711_100354352
281 Ga0070711_100703505
282 Ga0070700_100255929
283 Ga0070678_100076598
284 Ga0070678_100730558
285 Ga0070662_100529885
286 Ga0070662_100948341
287 Ga0070681_10140838
288 Ga0068867_100026914
289 Ga0068867_100187450
290 Ga0068867_100564203
291 Ga0070679_100078954
292 Ga0070684_100092815
293 Ga0068853_102213307
294 Ga0070672_100364004
295 Ga0070672_100916113
296 Ga0070695_100120490
297 Ga0070665_100019901
298 Ga0070665_100025067
299 Ga0070665_100316776
300 Ga0070665_100432192
301 Ga0070665_102610832
302 Ga0068855_100021222
303 Ga0068855_100156112
304 Ga0070664_101578474
305 Ga0068857_100621115
306 Ga0068856_100239484
307 Ga0068856_100710244
308 Ga0068852_101367354
309 Ga0068864_101174303
310 Ga0068861_101061620
311 Ga0068870_10011598
312 Ga0068863_100457191
313 Ga0068863_101258421
314 Ga0068858_100054142
315 Ga0068858_101566328
316 Ga0068858_101682417
317 Ga0068858_101935699
318 Ga0068860_100259006
319 Ga0097621_100000074
320 Ga0097621_100142923
321 Ga0097621_100196808
322 Ga0097621_100312695
323 Ga0097621_100333782
324 Ga0097621_100963964
325 Ga0097621_101072085
326 Ga0068871_100008382
327 Ga0068871_100070544
328 Ga0068871_100142077
329 Ga0068871_100551283
330 Ga0068871_100604221
331 Ga0068865_100699852
332 Ga0068865_100806560
333 Ga0105240_10119277
334 Ga0105240_10152731
335 Ga0105240_10319642
336 Ga0105240_10517048
337 Ga0105245_10530462
338 Ga0105247_10147436
339 Ga0105243_10026981
340 Ga0105243_11076604
341 Ga0105241_10143623
342 Ga0105241_10395615
343 Ga0105241_10712657
344 Ga0105241_11113702
345 Ga0105242_10139509
346 Ga0105242_10140567
347 Ga0105242_10285147
348 Ga0105242_11233899
349 Ga0105248_10073810
350 Ga0105237_10061224
351 Ga0105237_10358795
352 Ga0105237_10510650
353 Ga0105237_11085661
354 Ga0105237_11104368
355 Ga0105238_10055328
356 Ga0105238_11337446
357 Ga0105249_10125440
358 Ga0105249_10263618
359 Ga0105249_10403577
360 Ga0099796_10285370
361 Ga0105239_10210211
362 Ga0105239_10279316
363 Ga0105239_10281667
364 Ga0105239_10285312
365 Ga0105239_10369628
366 Ga0105246_10035761
367 Ga0105246_10092454
368 Ga0105246_10212987
369 Ga0105246_10791940
370 Ga0157370_10035726
371 Ga0157370_10092658
372 Ga0157369_10117920
373 Ga0157374_10353785
374 Ga0157378_10009027
375 Ga0157378_10034596
376 Ga0157378_10184839
377 Ga0157378_10262893
378 Ga0163162_10103007
379 Ga0163162_12671106
380 Ga0157372_10266703
381 Ga0157375_10417194
382 Ga0157375_11079987
383 Ga0157375_11200950
384 Ga0163163_10000555
385 Ga0163163_10405792
386 Ga0163163_11052764
387 Ga0163163_11998837
388 Ga0157377_10060972
389 Ga0157379_10000302
390 Ga0157379_10055567
391 Ga0157379_10095028
392 Ga0157379_12161441
393 Ga0157376_11168333
394 Ga0157376_11212256
395 Ga0157376_11668685
396 Ga0209758_1050726
397 Ga0209758_1076730
398 Ga0207642_11112733
399 Ga0207710_10422459
400 Ga0207688_10248538
401 Ga0207645_10012609
402 Ga0207645_10863531
403 Ga0207654_10074115
404 Ga0207654_10620063
405 Ga0207654_10863326
406 Ga0207707_10153735
407 Ga0207695_10117322
408 Ga0207695_10134309
409 Ga0207671_10122406
410 Ga0207671_10356667
411 Ga0207671_10396409
412 Ga0207671_11442285
413 Ga0207657_10042390
414 Ga0207649_10606317
415 Ga0207650_10527104
416 Ga0207650_11281689
417 Ga0207659_10065552
418 Ga0207687_10417771
419 Ga0207700_10079377
420 Ga0207690_10424089
421 Ga0207706_10644282
422 Ga0207686_10028851
423 Ga0207686_10115294
424 Ga0207709_10042743
425 Ga0207670_10301367
426 Ga0207669_10305233
427 Ga0207691_10122277
428 Ga0207711_10027672
429 Ga0207689_10165977
430 Ga0207679_10670838
431 Ga0207667_10180244
432 Ga0207712_10542799
433 Ga0207712_10781681
434 Ga0207712_11138270
435 Ga0207712_11742540
436 Ga0207658_10452606
437 Ga0207677_10003907
438 Ga0207677_10244396
439 Ga0207677_10296491
440 Ga0207703_10481360
441 Ga0207703_10676747
442 Ga0207703_11290470
443 Ga0207703_11581329
444 Ga0207639_11969901
445 Ga0207708_10232741
446 Ga0207702_10176524
447 Ga0207702_11149045
448 Ga0207641_10027811
449 Ga0207641_10140327
450 Ga0207648_10003271
451 Ga0207648_10211121
452 Ga0207676_10924373
453 Ga0207676_11081585
454 Ga0207674_10159292
455 Ga0207674_10599860
456 Ga0207683_10509896
457 Ga0207698_11554656
458 Ga0207698_12322085
459 Ga0268266_10014570
460 Ga0268266_10024251
461 Ga0268266_10075272
462 Ga0268266_10451513
463 Ga0268264_10625327
464 Ga0307517_10067324
465 Ga0265338_10001374
466 Ga0265320_10144637
467 Ga0265331_10008054
468 Ga0265316_10226974
469 Ga0307513_10371574
470 Ga0265313_10030550
471 Ga0265314_10004478
472 Ga0307516_10170448
473 Ga0373938_0089661
474 Ga0373928_0115916
475 Ga0373932_0154003
476 Ga0373931_0469645
477 Ga0373931_1032417
478 Ga0451802_0996277
479 Ga0451804_0142522
480 Ga0451839_1110169
481 Ga0451839_1256103
482 Ga0466957_0150396
483 Ga0466967_1225193
484 Ga0495617_184416
485 Ga0495592_0240339
486 Ga0495629_1059853
487 Ga0495606_0120834
488 Ga0495587_0199083
489 Ga0495609_0073255
490 Ga0495622_0003754
491 Ga0495613_0205553
492 Ga0495624_0758291
493 Ga0495670_0224707
494 Ga0495649_0100138
495 Ga0495636_0150464
496 Ga0495672_0404626
497 Ga0496115_1116433
498 Ga0501034_0270362
499 Ga0500595_002649
500 Ga0500559_0218450
501 Ga0500573_0000009
502 Ga0500577_0310021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ebk-assembly3.cif.gz_B-2 crystal structure of major allergens, bla g 4 from cockroaches 0.6781 20 133
5cyb-assembly1.cif.gz_A-2 structure of a lipocalin lipoprotein affecting virulence in streptococcus pneumoniae 0.6585 28 125
2z4i-assembly1.cif.gz_A crystal structure of the cpx pathway activator nlpe from escherichia coli 0.6522 29 133
3ebk-assembly3.cif.gz_A crystal structure of major allergens, bla g 4 from cockroaches 0.6503 20 138
8f0y-assembly1.cif.gz_A lipocalin-like milk protein-1 0.6463 27 131
ID Description Score Start End Superfamily
af_Q7XS47_48_217_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7645 25 124 2.40.128.20
af_Q9M2P7_76_287_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7464 25 124 2.40.128.20
af_Q8LAP6_254_409_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7192 27 126 2.40.128.20
4htgA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.6844 35 74 3.30.160.40
af_Q0D6K6_245_398_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6832 24 126 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A1Q3J496-F1-model_v4 Uncharacterized protein 0.9543 14 139
AF-A0A1Q3J496-F1-model_v4 Uncharacterized protein 0.9391 14 139
AF-A0A2G2QG69-F1-model_v4 DUF5640 domain-containing protein 0.9377 25 129 GO:0016020
AF-A0A6G8DCM0-F1-model_v4 Lipocalin-like domain-containing protein 0.9264 25 126
AF-A0A3E0TQR9-F1-model_v4 Lipocalin-like domain-containing protein 0.905 22 132

Map