F370912

General Info

Members Datasets Scaffolds Average Seq Length
262 167 524 195

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100217376|Ga0068867_1002173762
Length 211
Sequence MAHPPPDNSVARLGGMGEPVNGAKIALRDQLLTSRRRRSLLDVGAAARAIADHLLATPEVRRAATVAAYVSMGQEPGTGPFIDQLRAAGRHVILPVLLPDNDLDWARYAGAEALAPARLGLLEPTGPQLGVDAIATADVVVVPALAVDRTGLRLGRGGGSYDRALARVPVGTPVCALLFDGEVLDRVPSAPHDRRVNTVVTPAGVRTLGPV

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2643221576 Nocardioides sp. Root614 Isolate Unclassified
164 2643221590 Nocardioides sp. Root682 Isolate Unclassified
165 2643221615 Nocardioides sp. Root224 Isolate Unclassified
166 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
167 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.83
Nodule 0
Rhizoplane 12.98
Rhizosphere 72.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100217376 3300005459 Bacteria 1538
2 rootH1_10201422 3300003323 Bacteria 1152
3 Ga0070683_100033150 3300005329 Bacteria 4707
4 Ga0070683_100436966 3300005329 Bacteria 1249
5 Ga0070683_100656152 3300005329 Bacteria 1004
6 Ga0070682_100013870 3300005337 Bacteria 4646
7 Ga0070682_100194887 3300005337 Bacteria 1425
8 Ga0068868_100067290 3300005338 Bacteria 2851
9 Ga0070689_100093275 3300005340 Bacteria 2376
10 Ga0070691_10376116 3300005341 Bacteria 795
11 Ga0070692_10008693 3300005345 Bacteria 4540
12 Ga0070674_100014287 3300005356 Bacteria 4934
13 Ga0070674_100516344 3300005356 Bacteria 997
14 Ga0070701_10004145 3300005438 Bacteria 5827
15 Ga0068867_100006705 3300005459 Bacteria 8139
16 Ga0070684_100241124 3300005535 Bacteria 1652
17 Ga0070684_100684533 3300005535 Bacteria 956
18 Ga0068853_100350017 3300005539 Bacteria 1374
19 Ga0070664_100061652 3300005564 Bacteria 3197
20 Ga0068854_100605216 3300005578 Bacteria 936
21 Ga0070702_100006646 3300005615 Bacteria 5489
22 Ga0068852_100107875 3300005616 Bacteria 2527
23 Ga0068852_100171154 3300005616 Bacteria 2036
24 Ga0068866_10126308 3300005718 Bacteria 1448
25 Ga0068861_100005486 3300005719 Bacteria 8596
26 Ga0068861_100096828 3300005719 Bacteria 2339
27 Ga0068861_100485397 3300005719 Bacteria 1114
28 Ga0068870_10040042 3300005840 Bacteria 2428
29 Ga0081455_10172027 3300005937 Bacteria 1649
30 Ga0081539_10071147 3300005985 Bacteria 1864
31 Ga0075365_10003959 3300006038 Bacteria 7758
32 Ga0075365_10012903 3300006038 Bacteria 4980
33 Ga0075365_10524690 3300006038 Bacteria 837
34 Ga0075368_10006411 3300006042 Bacteria 4108
35 Ga0075363_100193675 3300006048 Bacteria 1160
36 Ga0075363_100272132 3300006048 Bacteria 978
37 Ga0075363_100287338 3300006048 Bacteria 953
38 Ga0075363_100355124 3300006048 Bacteria 856
39 Ga0075364_10250862 3300006051 Bacteria 1203
40 Ga0075362_10029267 3300006177 Bacteria 2372
41 Ga0075370_10000996 3300006353 Bacteria 11704
42 Ga0075370_10066853 3300006353 Bacteria 2051
43 Ga0068871_100502709 3300006358 Bacteria 1093
44 Ga0075428_100081252 3300006844 Bacteria 3537
45 Ga0068865_100633006 3300006881 Bacteria 907
46 Ga0111539_10158364 3300009094 Bacteria 2649
47 Ga0111539_10497790 3300009094 Bacteria 1419
48 Ga0105245_10011660 3300009098 Bacteria 7649
49 Ga0105245_10718716 3300009098 Bacteria 1033
50 Ga0105243_10160938 3300009148 Bacteria 1935
51 Ga0105243_10371651 3300009148 Bacteria 1319
52 Ga0105243_10386400 3300009148 Bacteria 1296
53 Ga0105241_10364613 3300009174 Bacteria 1258
54 Ga0105248_10932558 3300009177 Bacteria 981
55 Ga0105238_10303306 3300009551 Bacteria 1581
56 Ga0105238_10898672 3300009551 Bacteria 904
57 Ga0105249_10245627 3300009553 Bacteria 1772
58 Ga0105246_10245298 3300011119 Bacteria 1418
59 Ga0157371_10523773 3300013102 Bacteria 877
60 Ga0157371_10933005 3300013102 Bacteria 659
61 Ga0157369_10394582 3300013105 Bacteria 1436
62 Ga0157374_10922240 3300013296 Bacteria 891
63 Ga0157374_11874135 3300013296 Bacteria 625
64 Ga0157372_10091491 3300013307 Bacteria 3460
65 Ga0157372_10129879 3300013307 Bacteria 2898
66 Ga0157375_10502467 3300013308 Bacteria 1377
67 Ga0157375_10585720 3300013308 Bacteria 1276
68 Ga0163163_10059697 3300014325 Bacteria 3774
69 Ga0163163_10356263 3300014325 Bacteria 1519
70 Ga0182008_10154854 3300014497 Bacteria 1151
71 Ga0157377_10065207 3300014745 Bacteria 2091
72 Ga0163161_10039428 3300017792 Bacteria 3391
73 Ga0207642_10098026 3300025899 Bacteria 1465
74 Ga0207688_10018532 3300025901 Bacteria 3787
75 Ga0207643_10003626 3300025908 Bacteria 8319
76 Ga0207662_10257556 3300025918 Bacteria 1147
77 Ga0207657_10435628 3300025919 Bacteria 1029
78 Ga0207694_10866151 3300025924 Bacteria 764
79 Ga0207687_10023732 3300025927 Bacteria 4091
80 Ga0207706_10682914 3300025933 Bacteria 878
81 Ga0207709_10042080 3300025935 Bacteria 2746
82 Ga0207709_10413064 3300025935 Bacteria 1035
83 Ga0207670_10146755 3300025936 Bacteria 1745
84 Ga0207669_10111522 3300025937 Bacteria 1834
85 Ga0207691_10028910 3300025940 Bacteria 5187
86 Ga0207661_10110351 3300025944 Bacteria 2325
87 Ga0207661_10164386 3300025944 Bacteria 1927
88 Ga0207668_10302795 3300025972 Bacteria 1320
89 Ga0207640_11051245 3300025981 Bacteria 718
90 Ga0207658_10153795 3300025986 Bacteria 1877
91 Ga0207708_10000436 3300026075 Bacteria 32496
92 Ga0207708_10006114 3300026075 Bacteria 8926
93 Ga0207708_10238451 3300026075 Bacteria 1462
94 Ga0207648_10360842 3300026089 Bacteria 1311
95 Ga0207676_10334639 3300026095 Bacteria 1395
96 Ga0207675_100007118 3300026118 Bacteria 10573
97 Ga0207675_100011102 3300026118 Bacteria 8439
98 Ga0207683_10555847 3300026121 Bacteria 1061
99 Ga0207698_10053469 3300026142 Bacteria 3100
100 Ga0207698_10572091 3300026142 Bacteria 1110
101 Ga0209813_10004156 3300027866 Bacteria 3439
102 Ga0307405_10009423 3300031731 Bacteria 5006
103 Ga0307405_10235402 3300031731 Bacteria 1353
104 Ga0307413_10176396 3300031824 Bacteria 1519
105 Ga0307410_10005130 3300031852 Bacteria 6885
106 Ga0307410_10118288 3300031852 Bacteria 1928
107 Ga0307410_10225975 3300031852 Bacteria 1443
108 Ga0307407_10112215 3300031903 Bacteria 1713
109 Ga0307412_10202437 3300031911 Bacteria 1509
110 Ga0307409_100018487 3300031995 Bacteria 4688
111 Ga0307409_100065685 3300031995 Bacteria 2856
112 Ga0307409_100095655 3300031995 Bacteria 2448
113 Ga0307409_100479503 3300031995 Bacteria 1207
114 Ga0307416_100019808 3300032002 Bacteria 4781
115 Ga0307416_100061907 3300032002 Bacteria 3057
116 Ga0307416_100661260 3300032002 Bacteria 1130
117 Ga0307416_101720487 3300032002 Bacteria 732
118 Ga0307414_10691212 3300032004 Bacteria 923
119 Ga0307415_100001428 3300032126 Bacteria 11416
120 Ga0307415_100023069 3300032126 Bacteria 3855
121 Ga0307415_100039676 3300032126 Bacteria 3114
122 Ga0307415_100417362 3300032126 Bacteria 1150
123 Ga0395900_0062538 3300037418 Bacteria 3827
124 Ga0395900_0324782 3300037418 Bacteria 1518
125 Ga0395900_0331875 3300037418 Bacteria 1499
126 Ga0395900_0540720 3300037418 Bacteria 1111
127 Ga0395898_0144649 3300037466 Bacteria 2276
128 Ga0439461_0026225 3300041410 Bacteria 1188
129 Ga0439431_0012210 3300041997 Bacteria 1971
130 Ga0439445_0038029 3300042004 Bacteria 1271
131 Ga0439457_023029 3300042014 Bacteria 1379
132 Ga0439446_0040606 3300042156 Bacteria 1370
133 Ga0439434_0053778 3300042435 Bacteria 1251
134 Ga0466969_0047568 3300044656 Bacteria 2123
135 Ga0466972_0188360 3300044658 Bacteria 967
136 Ga0466965_0210272 3300044683 Bacteria 1034
137 Ga0466966_0094717 3300044684 Bacteria 1850
138 Ga0466961_0033511 3300044693 Bacteria 3299
139 Ga0466963_0184396 3300044694 Bacteria 1457
140 Ga0466964_0160757 3300044706 Bacteria 1050
141 Ga0466971_0051670 3300044719 Bacteria 1850
142 Ga0466970_0123187 3300044765 Bacteria 1421
143 Ga0466970_0251731 3300044765 Bacteria 990
144 Ga0466970_0311838 3300044765 Bacteria 888
145 Ga0466960_0005340 3300044901 Bacteria 5083
146 Ga0466960_0043846 3300044901 Bacteria 2130
147 Ga0466959_0102656 3300045049 Bacteria 2046
148 Ga0466958_0032754 3300045836 Bacteria 3093
149 Ga0466967_0030259 3300045976 Bacteria 4542
150 Ga0466967_0035941 3300045976 Bacteria 4223
151 Ga0466967_0070249 3300045976 Bacteria 3132
152 Ga0466967_0137905 3300045976 Bacteria 2270
153 Ga0466967_0272134 3300045976 Bacteria 1623
154 Ga0495590_0132262 3300046457 Bacteria 898
155 Ga0495641_0089354 3300046461 Bacteria 1377
156 Ga0495620_0099459 3300046515 Bacteria 1160
157 Ga0495667_0210413 3300046559 Bacteria 1243
158 Ga0495657_0563176 3300046675 Bacteria 661
159 Ga0495600_0642838 3300046809 Bacteria 642
160 Ga0496100_0404796 3300048903 Bacteria 1040
161 Ga0496101_0214154 3300048904 Bacteria 1493
162 Ga0496101_0492908 3300048904 Bacteria 968
163 Ga0496102_0314093 3300048905 Bacteria 1476
164 Ga0496102_0860990 3300048905 Bacteria 828
165 Ga0496103_0280557 3300048906 Bacteria 1071
166 Ga0496104_0169091 3300048907 Bacteria 2096
167 Ga0496105_0036759 3300048908 Bacteria 4035
168 Ga0496106_0045510 3300048909 Bacteria 3296
169 Ga0496106_0162812 3300048909 Bacteria 1765
170 Ga0496107_0056693 3300048910 Bacteria 2831
171 Ga0496107_0090248 3300048910 Bacteria 2238
172 Ga0496108_0020313 3300048911 Bacteria 5459
173 Ga0496108_0074841 3300048911 Bacteria 2860
174 Ga0496108_0172114 3300048911 Bacteria 1874
175 Ga0496109_0010470 3300048912 Bacteria 7924
176 Ga0496109_0040746 3300048912 Bacteria 4207
177 Ga0496109_0042483 3300048912 Bacteria 4118
178 Ga0496109_0150061 3300048912 Bacteria 2182
179 Ga0496109_0290663 3300048912 Bacteria 1541
180 Ga0496110_0124913 3300048913 Bacteria 2321
181 Ga0496110_1195477 3300048913 Bacteria 669
182 Ga0496111_0641775 3300048914 Bacteria 775
183 Ga0496113_0090336 3300048916 Bacteria 2359
184 Ga0496113_0652768 3300048916 Bacteria 841
185 Ga0496114_0010058 3300048917 Bacteria 7521
186 Ga0496114_0075541 3300048917 Bacteria 2838
187 Ga0496114_0118867 3300048917 Bacteria 2271
188 Ga0496114_0387611 3300048917 Bacteria 1237
189 Ga0496114_0474043 3300048917 Bacteria 1107
190 Ga0496114_0501229 3300048917 Bacteria 1074
191 Ga0496115_0024531 3300048918 Bacteria 4689
192 Ga0496115_0055118 3300048918 Bacteria 3193
193 Ga0496115_0071321 3300048918 Bacteria 2817
194 Ga0496124_0179838 3300048927 Bacteria 1629
195 Ga0501031_0128870 3300049568 Bacteria 1652
196 Ga0501032_0007594 3300049569 Bacteria 7913
197 Ga0501034_0006864 3300049571 Bacteria 12176
198 Ga0501036_0015193 3300049572 Bacteria 6429
199 Ga0501037_0004316 3300049573 Bacteria 10312
200 Ga0501038_0019445 3300049574 Bacteria 6121
201 Ga0501039_0001126 3300049575 Bacteria 19670
202 Ga0501039_0026260 3300049575 Bacteria 4476
203 Ga0501039_0213506 3300049575 Bacteria 1517
204 Ga0501040_0402331 3300049576 Bacteria 983
205 Ga0501042_0009337 3300049578 Bacteria 6533
206 Ga0501043_0008473 3300049579 Bacteria 8093
207 Ga0501043_0805803 3300049579 Bacteria 679
208 Ga0501046_0037754 3300049580 Bacteria 3880
209 Ga0501048_0001793 3300049582 Bacteria 16318
210 Ga0501048_0103341 3300049582 Bacteria 2011
211 Ga0501048_0755156 3300049582 Bacteria 699
212 Ga0501067_0016006 3300049583 Bacteria 4148
213 Ga0501067_0035204 3300049583 Bacteria 2780
214 Ga0501068_0007372 3300049584 Bacteria 6090
215 Ga0501068_0019742 3300049584 Bacteria 3918
216 Ga0501068_0042046 3300049584 Bacteria 2748
217 Ga0501069_0027634 3300049585 Bacteria 3109
218 Ga0501070_0052721 3300049586 Bacteria 3376
219 Ga0501070_0084752 3300049586 Bacteria 2623
220 Ga0501070_0249950 3300049586 Bacteria 1450
221 Ga0501071_0592986 3300049587 Bacteria 852
222 Ga0501072_0004451 3300049588 Bacteria 10643
223 Ga0501072_0208077 3300049588 Bacteria 1559
224 Ga0501072_0273878 3300049588 Bacteria 1343
225 Ga0501073_0006524 3300049589 Bacteria 8680
226 Ga0501074_0003804 3300049590 Bacteria 10731
227 Ga0501076_0102123 3300049592 Bacteria 2312
228 Ga0501077_0030577 3300049593 Bacteria 3426
229 Ga0501261_040788 3300049690 Bacteria 732
230 Ga0501079_0017553 3300049741 Bacteria 5465
231 Ga0501079_0866903 3300049741 Bacteria 711
232 Ga0501083_0001725 3300049744 Bacteria 14895
233 Ga0501045_0218299 3300049824 Bacteria 1420
234 nmdc:mga03683_187785_c1 3300050489 Bacteria 945
235 nmdc:mga03n38_142404_c1 3300050490 Bacteria 1199
236 nmdc:mga00v17_108139_c1 3300050491 Bacteria 1762
237 nmdc:mga00v17_127181_c1 3300050491 Bacteria 1627
238 nmdc:mga00v17_30468_c1 3300050491 Bacteria 3175
239 nmdc:mga0yw44_1213_c1 3300050492 Bacteria 10098
240 nmdc:mga0yw44_137181_c1 3300050492 Bacteria 1588
241 nmdc:mga0yw44_164778_c1 3300050492 Bacteria 1453
242 nmdc:mga0yw44_311395_c1 3300050492 Bacteria 1056
243 nmdc:mga0yw44_385452_c1 3300050492 Bacteria 946
244 nmdc:mga0yw44_497583_c1 3300050492 Bacteria 827
245 nmdc:mga06z11_644908_c1 3300050494 Bacteria 645
246 nmdc:mga04h51_28692_c1 3300050495 Bacteria 1738
247 nmdc:mga07m45_118913_c1 3300050496 Bacteria 1526
248 nmdc:mga07m45_284763_c1 3300050496 Bacteria 961
249 nmdc:mga07m45_60151_c1 3300050496 Bacteria 2150
250 nmdc:mga08y16_269620_c1 3300050511 Bacteria 1757
251 nmdc:mga08y16_587268_c1 3300050511 Bacteria 1124
252 Ga0500556_0000390 3300053104 Bacteria 32128
253 Ga0500593_000321 3300053117 Bacteria 19315
254 Ga0501084_1103287 3300054114 Bacteria 666
255 Ga0501082_0015134 3300060353 Bacteria 6647
256 Ga0466962_0056041 3300061719 Bacteria 1883
257 Ga0530510_0933802 3300061734 Bacteria 663
258 2643892067 2643221576 Bacteria 5214352
259 2643961119 2643221590 Bacteria 5214697
260 2644094082 2643221615 Bacteria 5487866
261 2644323925 2643221657 Bacteria 5490246
262 2857486327 2857481737 Bacteria 4761446
263 Ga0068867_100217376
264 rootH1_10201422
265 Ga0070683_100033150
266 Ga0070683_100436966
267 Ga0070683_100656152
268 Ga0070682_100013870
269 Ga0070682_100194887
270 Ga0068868_100067290
271 Ga0070689_100093275
272 Ga0070691_10376116
273 Ga0070692_10008693
274 Ga0070674_100014287
275 Ga0070674_100516344
276 Ga0070701_10004145
277 Ga0068867_100006705
278 Ga0070684_100241124
279 Ga0070684_100684533
280 Ga0068853_100350017
281 Ga0070664_100061652
282 Ga0068854_100605216
283 Ga0070702_100006646
284 Ga0068852_100107875
285 Ga0068852_100171154
286 Ga0068866_10126308
287 Ga0068861_100005486
288 Ga0068861_100096828
289 Ga0068861_100485397
290 Ga0068870_10040042
291 Ga0081455_10172027
292 Ga0081539_10071147
293 Ga0075365_10003959
294 Ga0075365_10012903
295 Ga0075365_10524690
296 Ga0075368_10006411
297 Ga0075363_100193675
298 Ga0075363_100272132
299 Ga0075363_100287338
300 Ga0075363_100355124
301 Ga0075364_10250862
302 Ga0075362_10029267
303 Ga0075370_10000996
304 Ga0075370_10066853
305 Ga0068871_100502709
306 Ga0075428_100081252
307 Ga0068865_100633006
308 Ga0111539_10158364
309 Ga0111539_10497790
310 Ga0105245_10011660
311 Ga0105245_10718716
312 Ga0105243_10160938
313 Ga0105243_10371651
314 Ga0105243_10386400
315 Ga0105241_10364613
316 Ga0105248_10932558
317 Ga0105238_10303306
318 Ga0105238_10898672
319 Ga0105249_10245627
320 Ga0105246_10245298
321 Ga0157371_10523773
322 Ga0157371_10933005
323 Ga0157369_10394582
324 Ga0157374_10922240
325 Ga0157374_11874135
326 Ga0157372_10091491
327 Ga0157372_10129879
328 Ga0157375_10502467
329 Ga0157375_10585720
330 Ga0163163_10059697
331 Ga0163163_10356263
332 Ga0182008_10154854
333 Ga0157377_10065207
334 Ga0163161_10039428
335 Ga0207642_10098026
336 Ga0207688_10018532
337 Ga0207643_10003626
338 Ga0207662_10257556
339 Ga0207657_10435628
340 Ga0207694_10866151
341 Ga0207687_10023732
342 Ga0207706_10682914
343 Ga0207709_10042080
344 Ga0207709_10413064
345 Ga0207670_10146755
346 Ga0207669_10111522
347 Ga0207691_10028910
348 Ga0207661_10110351
349 Ga0207661_10164386
350 Ga0207668_10302795
351 Ga0207640_11051245
352 Ga0207658_10153795
353 Ga0207708_10000436
354 Ga0207708_10006114
355 Ga0207708_10238451
356 Ga0207648_10360842
357 Ga0207676_10334639
358 Ga0207675_100007118
359 Ga0207675_100011102
360 Ga0207683_10555847
361 Ga0207698_10053469
362 Ga0207698_10572091
363 Ga0209813_10004156
364 Ga0307405_10009423
365 Ga0307405_10235402
366 Ga0307413_10176396
367 Ga0307410_10005130
368 Ga0307410_10118288
369 Ga0307410_10225975
370 Ga0307407_10112215
371 Ga0307412_10202437
372 Ga0307409_100018487
373 Ga0307409_100065685
374 Ga0307409_100095655
375 Ga0307409_100479503
376 Ga0307416_100019808
377 Ga0307416_100061907
378 Ga0307416_100661260
379 Ga0307416_101720487
380 Ga0307414_10691212
381 Ga0307415_100001428
382 Ga0307415_100023069
383 Ga0307415_100039676
384 Ga0307415_100417362
385 Ga0395900_0062538
386 Ga0395900_0324782
387 Ga0395900_0331875
388 Ga0395900_0540720
389 Ga0395898_0144649
390 Ga0439461_0026225
391 Ga0439431_0012210
392 Ga0439445_0038029
393 Ga0439457_023029
394 Ga0439446_0040606
395 Ga0439434_0053778
396 Ga0466969_0047568
397 Ga0466972_0188360
398 Ga0466965_0210272
399 Ga0466966_0094717
400 Ga0466961_0033511
401 Ga0466963_0184396
402 Ga0466964_0160757
403 Ga0466971_0051670
404 Ga0466970_0123187
405 Ga0466970_0251731
406 Ga0466970_0311838
407 Ga0466960_0005340
408 Ga0466960_0043846
409 Ga0466959_0102656
410 Ga0466958_0032754
411 Ga0466967_0030259
412 Ga0466967_0035941
413 Ga0466967_0070249
414 Ga0466967_0137905
415 Ga0466967_0272134
416 Ga0495590_0132262
417 Ga0495641_0089354
418 Ga0495620_0099459
419 Ga0495667_0210413
420 Ga0495657_0563176
421 Ga0495600_0642838
422 Ga0496100_0404796
423 Ga0496101_0214154
424 Ga0496101_0492908
425 Ga0496102_0314093
426 Ga0496102_0860990
427 Ga0496103_0280557
428 Ga0496104_0169091
429 Ga0496105_0036759
430 Ga0496106_0045510
431 Ga0496106_0162812
432 Ga0496107_0056693
433 Ga0496107_0090248
434 Ga0496108_0020313
435 Ga0496108_0074841
436 Ga0496108_0172114
437 Ga0496109_0010470
438 Ga0496109_0040746
439 Ga0496109_0042483
440 Ga0496109_0150061
441 Ga0496109_0290663
442 Ga0496110_0124913
443 Ga0496110_1195477
444 Ga0496111_0641775
445 Ga0496113_0090336
446 Ga0496113_0652768
447 Ga0496114_0010058
448 Ga0496114_0075541
449 Ga0496114_0118867
450 Ga0496114_0387611
451 Ga0496114_0474043
452 Ga0496114_0501229
453 Ga0496115_0024531
454 Ga0496115_0055118
455 Ga0496115_0071321
456 Ga0496124_0179838
457 Ga0501031_0128870
458 Ga0501032_0007594
459 Ga0501034_0006864
460 Ga0501036_0015193
461 Ga0501037_0004316
462 Ga0501038_0019445
463 Ga0501039_0001126
464 Ga0501039_0026260
465 Ga0501039_0213506
466 Ga0501040_0402331
467 Ga0501042_0009337
468 Ga0501043_0008473
469 Ga0501043_0805803
470 Ga0501046_0037754
471 Ga0501048_0001793
472 Ga0501048_0103341
473 Ga0501048_0755156
474 Ga0501067_0016006
475 Ga0501067_0035204
476 Ga0501068_0007372
477 Ga0501068_0019742
478 Ga0501068_0042046
479 Ga0501069_0027634
480 Ga0501070_0052721
481 Ga0501070_0084752
482 Ga0501070_0249950
483 Ga0501071_0592986
484 Ga0501072_0004451
485 Ga0501072_0208077
486 Ga0501072_0273878
487 Ga0501073_0006524
488 Ga0501074_0003804
489 Ga0501076_0102123
490 Ga0501077_0030577
491 Ga0501261_040788
492 Ga0501079_0017553
493 Ga0501079_0866903
494 Ga0501083_0001725
495 Ga0501045_0218299
496 nmdc:mga03683_187785_c1
497 nmdc:mga03n38_142404_c1
498 nmdc:mga00v17_108139_c1
499 nmdc:mga00v17_127181_c1
500 nmdc:mga00v17_30468_c1
501 nmdc:mga0yw44_1213_c1
502 nmdc:mga0yw44_137181_c1
503 nmdc:mga0yw44_164778_c1
504 nmdc:mga0yw44_311395_c1
505 nmdc:mga0yw44_385452_c1
506 nmdc:mga0yw44_497583_c1
507 nmdc:mga06z11_644908_c1
508 nmdc:mga04h51_28692_c1
509 nmdc:mga07m45_118913_c1
510 nmdc:mga07m45_284763_c1
511 nmdc:mga07m45_60151_c1
512 nmdc:mga08y16_269620_c1
513 nmdc:mga08y16_587268_c1
514 Ga0500556_0000390
515 Ga0500593_000321
516 Ga0501084_1103287
517 Ga0501082_0015134
518 Ga0466962_0056041
519 Ga0530510_0933802
520 2643892067
521 2643961119
522 2644094082
523 2644323925
524 2857486327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

24

202

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.9038 16 202
3hy6-assembly1.cif.gz_A structure of human mthfs with adp 0.8992 16 194
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.8858 16 202
3hy3-assembly1.cif.gz_A structure of human mthfs with 10-formyltetrahydrofolate 0.885 16 194
1sou-assembly1.cif.gz_A nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 0.8777 20 204
ID Description Score Start End Superfamily
2jcbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9038 16 202 3.40.50.10420
af_A0A0G2L0J2_1_199_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9009 18 197 3.40.50.10420
af_Q9P7W2_1_201_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8958 19 201 3.40.50.10420
af_P0AC28_1_181_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.891 27 200 3.40.50.10420
af_Q2FY23_1_179_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8884 20 194 3.40.50.10420
ID Description Score Start End GO Terms
AF-A0A0A1DIA0-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9791 12 204 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A4R5EEU5-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.978 20 204 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A399G327-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9678 20 204 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A838KPZ9-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9641 17 203 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A4R4XEY0-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9641 20 203 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872

Map