F370860

General Info

Members Datasets Scaffolds Average Seq Length
262 138 524 223

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100468011|Ga0070669_1004680112
Length 242
Sequence MRIEALADADSVARAGAAFTAEQARAAVAARGRFIMAVSGGHTPWQMLRALADQPLRWADVHIVQVDERVAPAGHPDRNLTHLRESLLAHCPLPPEQVHAMPVESADLDSASRGYATTLQQIAGAPAVLDLAHLGLGSDGHTASLVPGDPVLDVTDSDVALTGLYQGRRRMTLTYPMLNRARRIVWLVTGREKAEMLARLCAGDRSIPAGRIRQDEAVVLADHDAAGALQLHSFTAPGPSGR

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100468011 3300005353 Bacteria 1041
2 Ga0070676_10088272 3300005328 Bacteria 1894
3 Ga0070670_100000541 3300005331 Bacteria 30025
4 Ga0070677_10204447 3300005333 Bacteria 955
5 Ga0068869_100589822 3300005334 Bacteria 938
6 Ga0070680_100026397 3300005336 Bacteria 4646
7 Ga0070689_100376997 3300005340 Bacteria 1195
8 Ga0070661_100044232 3300005344 Bacteria 3253
9 Ga0070668_100251301 3300005347 Bacteria 1468
10 Ga0070668_100416294 3300005347 Bacteria 1150
11 Ga0070671_100034865 3300005355 Bacteria 4167
12 Ga0070714_100254131 3300005435 Bacteria 1626
13 Ga0070705_100301875 3300005440 Bacteria 1148
14 Ga0070700_100508993 3300005441 Unclassified 928
15 Ga0070694_100015928 3300005444 Bacteria 4729
16 Ga0070708_100011652 3300005445 Bacteria 7155
17 Ga0070708_100029885 3300005445 Bacteria 4704
18 Ga0070708_100075904 3300005445 Bacteria 3034
19 Ga0070708_100095394 3300005445 Bacteria 2715
20 Ga0070708_100714465 3300005445 Bacteria 943
21 Ga0070678_100017521 3300005456 Bacteria 4615
22 Ga0070706_100006291 3300005467 Bacteria 11220
23 Ga0070706_100052532 3300005467 Bacteria 3761
24 Ga0070706_100173180 3300005467 Bacteria 2015
25 Ga0070707_100011484 3300005468 Bacteria 8259
26 Ga0070707_100071136 3300005468 Bacteria 3351
27 Ga0070707_100082297 3300005468 Bacteria 3109
28 Ga0070707_100323884 3300005468 Bacteria 1497
29 Ga0070698_100041406 3300005471 Bacteria 4728
30 Ga0070698_100051292 3300005471 Bacteria 4202
31 Ga0070698_100155807 3300005471 Bacteria 2230
32 Ga0070698_100232494 3300005471 Bacteria 1777
33 Ga0070698_100331209 3300005471 Bacteria 1454
34 Ga0070699_100003790 3300005518 Bacteria 13359
35 Ga0070699_100004715 3300005518 Bacteria 12058
36 Ga0070699_100033172 3300005518 Bacteria 4460
37 Ga0070699_100080509 3300005518 Bacteria 2839
38 Ga0070699_100107353 3300005518 Bacteria 2449
39 Ga0070697_100111974 3300005536 Bacteria 2276
40 Ga0070697_100362158 3300005536 Bacteria 1254
41 Ga0070697_100460102 3300005536 Bacteria 1109
42 Ga0070697_100520358 3300005536 Unclassified 1041
43 Ga0070672_100620804 3300005543 Unclassified 943
44 Ga0070686_100328382 3300005544 Bacteria 1143
45 Ga0070695_100071800 3300005545 Bacteria 2268
46 Ga0070695_100381340 3300005545 Bacteria 1064
47 Ga0070696_100031240 3300005546 Bacteria 3649
48 Ga0070696_100244883 3300005546 Bacteria 1354
49 Ga0070665_100086648 3300005548 Bacteria 3137
50 Ga0070665_100299596 3300005548 Unclassified 1610
51 Ga0068855_100006424 3300005563 Bacteria 14312
52 Ga0068854_100019575 3300005578 Bacteria 4565
53 Ga0068856_100000682 3300005614 Bacteria 36865
54 Ga0068856_100039001 3300005614 Bacteria 4664
55 Ga0068861_100744823 3300005719 Bacteria 915
56 Ga0068862_100314400 3300005844 Bacteria 1444
57 Ga0081455_10109364 3300005937 Bacteria 2200
58 Ga0081538_10002326 3300005981 Bacteria 18757
59 Ga0081538_10006533 3300005981 Bacteria 10244
60 Ga0081538_10013908 3300005981 Bacteria 6341
61 Ga0070717_10000970 3300006028 Bacteria 19160
62 Ga0070717_10637658 3300006028 Bacteria 967
63 Ga0070716_100029450 3300006173 Bacteria 2969
64 Ga0097621_100272425 3300006237 Unclassified 1488
65 Ga0097621_100508638 3300006237 Bacteria 1092
66 Ga0068871_100176866 3300006358 Bacteria 1832
67 Ga0075428_100011965 3300006844 Bacteria 9653
68 Ga0075428_100077820 3300006844 Bacteria 3620
69 Ga0075428_100270636 3300006844 Bacteria 1828
70 Ga0075428_100662783 3300006844 Bacteria 1112
71 Ga0075428_101038013 3300006844 Bacteria 867
72 Ga0075430_100069578 3300006846 Bacteria 2952
73 Ga0075430_100589367 3300006846 Bacteria 917
74 Ga0075431_100143861 3300006847 Bacteria 2457
75 Ga0075433_10000747 3300006852 Bacteria 22314
76 Ga0075433_10001225 3300006852 Bacteria 18731
77 Ga0075433_10023602 3300006852 Bacteria 5179
78 Ga0075433_10048185 3300006852 Bacteria 3705
79 Ga0075433_10240695 3300006852 Bacteria 1606
80 Ga0075433_10311192 3300006852 Bacteria 1394
81 Ga0075433_10401111 3300006852 Bacteria 1210
82 Ga0075433_10457728 3300006852 Bacteria 1124
83 Ga0075433_10631696 3300006852 Bacteria 939
84 Ga0075434_100000560 3300006871 Bacteria 28562
85 Ga0075434_100001047 3300006871 Bacteria 22564
86 Ga0075434_100052295 3300006871 Bacteria 4058
87 Ga0075434_100085799 3300006871 Bacteria 3148
88 Ga0075434_100119754 3300006871 Bacteria 2647
89 Ga0075434_100126637 3300006871 Bacteria 2571
90 Ga0075434_100374833 3300006871 Bacteria 1444
91 Ga0075434_100376492 3300006871 Bacteria 1441
92 Ga0075434_100924499 3300006871 Bacteria 887
93 Ga0075429_100005287 3300006880 Bacteria 11107
94 Ga0075429_100069505 3300006880 Bacteria 3066
95 Ga0075429_100650444 3300006880 Unclassified 923
96 Ga0075436_100001512 3300006914 Bacteria 15855
97 Ga0075435_100006675 3300007076 Bacteria 8182
98 Ga0075435_100013485 3300007076 Bacteria 6081
99 Ga0075435_100056394 3300007076 Bacteria 3176
100 Ga0075435_100162935 3300007076 Bacteria 1879
101 Ga0099794_10000036 3300007265 Bacteria 55505
102 Ga0111539_10066810 3300009094 Bacteria 4247
103 Ga0111539_10086679 3300009094 Bacteria 3679
104 Ga0111539_10608660 3300009094 Unclassified 1272
105 Ga0114129_10000982 3300009147 Bacteria 37269
106 Ga0114129_10002217 3300009147 Bacteria 26788
107 Ga0114129_10149442 3300009147 Bacteria 3197
108 Ga0114129_10306142 3300009147 Unclassified 2116
109 Ga0114129_10313584 3300009147 Bacteria 2087
110 Ga0114129_10315621 3300009147 Bacteria 2079
111 Ga0114129_10555831 3300009147 Bacteria 1492
112 Ga0114129_10871945 3300009147 Bacteria 1143
113 Ga0105241_10025628 3300009174 Bacteria 4384
114 Ga0105249_10603787 3300009553 Bacteria 1152
115 Ga0105239_10950397 3300010375 Bacteria 987
116 Ga0105246_10044302 3300011119 Bacteria 3023
117 Ga0157373_10149075 3300013100 Bacteria 1645
118 Ga0157371_10088321 3300013102 Bacteria 2195
119 Ga0157374_10160126 3300013296 Bacteria 2192
120 Ga0157375_10071565 3300013308 Bacteria 3482
121 Ga0157375_10457257 3300013308 Bacteria 1442
122 Ga0157375_10494112 3300013308 Bacteria 1388
123 Ga0157379_10309080 3300014968 Bacteria 1442
124 Ga0157379_10760073 3300014968 Unclassified 913
125 Ga0157376_10261237 3300014969 Unclassified 1622
126 Ga0213872_10008467 3300021361 Bacteria 4977
127 Ga0213872_10073765 3300021361 Bacteria 1536
128 Ga0207697_10048354 3300025315 Bacteria 1754
129 Ga0207653_10038307 3300025885 Bacteria 1566
130 Ga0207680_10132657 3300025903 Bacteria 1643
131 Ga0207645_10002238 3300025907 Bacteria 15406
132 Ga0207684_10016305 3300025910 Bacteria 6379
133 Ga0207684_10082231 3300025910 Bacteria 2742
134 Ga0207707_10026810 3300025912 Bacteria 5036
135 Ga0207663_10138404 3300025916 Bacteria 1693
136 Ga0207657_10043736 3300025919 Bacteria 3942
137 Ga0207649_10178851 3300025920 Bacteria 1483
138 Ga0207646_10002315 3300025922 Bacteria 22587
139 Ga0207646_10003937 3300025922 Bacteria 16479
140 Ga0207646_10010132 3300025922 Bacteria 9235
141 Ga0207646_10229491 3300025922 Bacteria 1677
142 Ga0207646_10303127 3300025922 Bacteria 1443
143 Ga0207646_10468111 3300025922 Unclassified 1137
144 Ga0207681_10384146 3300025923 Bacteria 1131
145 Ga0207664_10358316 3300025929 Bacteria 1292
146 Ga0207644_10080305 3300025931 Unclassified 2409
147 Ga0207669_10414816 3300025937 Bacteria 1058
148 Ga0207665_10010220 3300025939 Bacteria 6164
149 Ga0207691_10044122 3300025940 Bacteria 4105
150 Ga0207689_10653823 3300025942 Unclassified 886
151 Ga0207679_10007598 3300025945 Bacteria 6884
152 Ga0207667_10098320 3300025949 Bacteria 3020
153 Ga0207667_10327163 3300025949 Bacteria 1565
154 Ga0207668_10119241 3300025972 Bacteria 1995
155 Ga0207658_10184377 3300025986 Bacteria 1730
156 Ga0207702_10000681 3300026078 Bacteria 36846
157 Ga0207683_10003353 3300026121 Bacteria 13957
158 Ga0209588_1000020 3300027671 Bacteria 93596
159 Ga0209588_1003246 3300027671 Bacteria 4494
160 Ga0207428_10004677 3300027907 Bacteria 12972
161 Ga0207428_10100021 3300027907 Bacteria 2241
162 Ga0268266_10079492 3300028379 Bacteria 2855
163 Ga0268266_10140659 3300028379 Bacteria 2166
164 Ga0265338_10000660 3300028800 Bacteria 59683
165 Ga0265338_10000864 3300028800 Bacteria 51319
166 Ga0265324_10006300 3300029957 Bacteria 4976
167 Ga0373924_0109652 3300035410 Bacteria 1192
168 Ga0373935_0018049 3300035692 Bacteria 4289
169 Ga0395905_0154133 3300037471 Bacteria 2161
170 Ga0436365_0543086 3300039437 Bacteria 2552
171 Ga0436365_1891732 3300039437 Bacteria 1605
172 Ga0436360_0898261 3300039438 Bacteria 1131
173 Ga0436360_1098897 3300039438 Bacteria 8107
174 Ga0436361_0082827 3300039447 Bacteria 7399
175 Ga0436361_0160569 3300039447 Bacteria 6702
176 Ga0436361_1103959 3300039447 Bacteria 967
177 Ga0436363_1258709 3300039450 Bacteria 826
178 Ga0451577_0002347 3300042876 Bacteria 22758
179 Ga0453683_0005116 3300044673 Bacteria 9198
180 Ga0453684_0005984 3300044712 Bacteria 23559
181 Ga0453684_0078401 3300044712 Bacteria 4134
182 Ga0453684_0323151 3300044712 Bacteria 1747
183 Ga0453684_0650891 3300044712 Bacteria 1150
184 Ga0451576_0411724 3300045051 Bacteria 1418
185 Ga0495592_0249284 3300046454 Bacteria 1174
186 Ga0495618_0379283 3300046514 Unclassified 868
187 Ga0495628_0118716 3300046516 Bacteria 2030
188 Ga0495652_0336376 3300046529 Bacteria 1086
189 Ga0495645_0312468 3300046543 Bacteria 1023
190 Ga0495633_0102333 3300046558 Unclassified 1330
191 Ga0495634_0066804 3300046642 Bacteria 2380
192 Ga0495635_0320844 3300046663 Bacteria 1037
193 Ga0495670_0365290 3300046691 Bacteria 778
194 Ga0495674_0015451 3300047319 Bacteria 7135
195 Ga0495674_0119800 3300047319 Bacteria 2224
196 Ga0496100_0316800 3300048903 Bacteria 1171
197 Ga0496102_0033926 3300048905 Bacteria 4589
198 Ga0496102_0449278 3300048905 Bacteria 1209
199 Ga0496105_0363137 3300048908 Bacteria 1155
200 Ga0496110_0445525 3300048913 Bacteria 1180
201 Ga0496112_0683604 3300048915 Unclassified 955
202 Ga0496113_0370842 3300048916 Bacteria 1149
203 Ga0496114_0335518 3300048917 Bacteria 1337
204 Ga0501031_0000012 3300049568 Bacteria 137943
205 Ga0501031_0140123 3300049568 Bacteria 1580
206 Ga0501032_0001712 3300049569 Bacteria 17347
207 Ga0501033_0014926 3300049570 Bacteria 5897
208 Ga0501033_0098186 3300049570 Bacteria 2139
209 Ga0501037_0038183 3300049573 Bacteria 3540
210 Ga0501037_0263064 3300049573 Bacteria 1205
211 Ga0501038_0454190 3300049574 Unclassified 985
212 Ga0501043_0224254 3300049579 Bacteria 1453
213 Ga0501046_0128310 3300049580 Bacteria 1925
214 Ga0501047_0567836 3300049581 Bacteria 958
215 Ga0501077_0026627 3300049593 Bacteria 3670
216 Ga0501077_0110294 3300049593 Bacteria 1743
217 Ga0501080_0313165 3300049742 Bacteria 1422
218 Ga0501035_0001290 3300049822 Bacteria 25869
219 Ga0501035_0151624 3300049822 Bacteria 2011
220 Ga0501044_0000024 3300049823 Bacteria 194302
221 Ga0501044_0004128 3300049823 Bacteria 16299
222 nmdc:mga05p37_106233_c1 3300050507 Bacteria 3454
223 nmdc:mga05p37_267679_c1 3300050507 Bacteria 2043
224 nmdc:mga05p37_322534_c1 3300050507 Unclassified 1828
225 nmdc:mga05p37_384018_c1 3300050507 Bacteria 1645
226 nmdc:mga05p37_4367_c1 3300050507 Bacteria 16507
227 nmdc:mga05p37_464587_c1 3300050507 Bacteria 1461
228 nmdc:mga05p37_511843_c1 3300050507 Unclassified 1375
229 nmdc:mga05p37_7890_c1 3300050507 Bacteria 12564
230 nmdc:mga05p37_915034_c1 3300050507 Bacteria 944
231 nmdc:mga09592_4603_c1 3300050508 Bacteria 11170
232 nmdc:mga09592_94726_c1 3300050508 Unclassified 2554
233 nmdc:mga0qj67_339261_c1 3300050509 Bacteria 1216
234 nmdc:mga0qj67_583796_c1 3300050509 Bacteria 895
235 nmdc:mga08y16_23974_c1 3300050511 Bacteria 6445
236 nmdc:mga08y16_662961_c1 3300050511 Unclassified 1046
237 nmdc:mga08y16_710767_c1 3300050511 Bacteria 1004
238 nmdc:mga0n895_10966_c1 3300050512 Bacteria 8054
239 nmdc:mga0n895_1147939_c1 3300050512 Bacteria 753
240 nmdc:mga0n895_124062_c1 3300050512 Bacteria 2605
241 nmdc:mga0n895_146395_c1 3300050512 Bacteria 2392
242 nmdc:mga0n895_1947_c1 3300050512 Bacteria 15854
243 nmdc:mga0n895_299265_c1 3300050512 Bacteria 1631
244 nmdc:mga0n895_496604_c1 3300050512 Bacteria 1230
245 nmdc:mga0n895_8296_c1 3300050512 Bacteria 8986
246 nmdc:mga0rr50_12153_c1 3300050513 Bacteria 5550
247 nmdc:mga0rr50_154171_c1 3300050513 Bacteria 1859
248 nmdc:mga0rr50_3060_c1 3300050513 Bacteria 9572
249 nmdc:mga0rr50_39777_c1 3300050513 Bacteria 3413
250 nmdc:mga0rr50_859_c1 3300050513 Bacteria 16392
251 nmdc:mga08x19_1793_c1 3300050514 Bacteria 13197
252 nmdc:mga08x19_59929_c1 3300050514 Bacteria 2465
253 nmdc:mga0a205_136548_c1 3300050515 Bacteria 2353
254 nmdc:mga0a205_140942_c2 3300050515 Bacteria 943
255 nmdc:mga0a205_1452_c1 3300050515 Bacteria 20199
256 nmdc:mga0a205_161_c1 3300050515 Bacteria 44265
257 nmdc:mga0a205_22289_c1 3300050515 Bacteria 5998
258 nmdc:mga0a205_594_c1 3300050515 Bacteria 28735
259 nmdc:mga0a205_97129_c1 3300050515 Bacteria 2845
260 Ga0495595_0043515 3300053084 Bacteria 2060
261 Ga0501082_0447369 3300060353 Bacteria 1129
262 Ga0530510_0034709 3300061734 Bacteria 3634
263 Ga0070669_100468011
264 Ga0070676_10088272
265 Ga0070670_100000541
266 Ga0070677_10204447
267 Ga0068869_100589822
268 Ga0070680_100026397
269 Ga0070689_100376997
270 Ga0070661_100044232
271 Ga0070668_100251301
272 Ga0070668_100416294
273 Ga0070671_100034865
274 Ga0070714_100254131
275 Ga0070705_100301875
276 Ga0070700_100508993
277 Ga0070694_100015928
278 Ga0070708_100011652
279 Ga0070708_100029885
280 Ga0070708_100075904
281 Ga0070708_100095394
282 Ga0070708_100714465
283 Ga0070678_100017521
284 Ga0070706_100006291
285 Ga0070706_100052532
286 Ga0070706_100173180
287 Ga0070707_100011484
288 Ga0070707_100071136
289 Ga0070707_100082297
290 Ga0070707_100323884
291 Ga0070698_100041406
292 Ga0070698_100051292
293 Ga0070698_100155807
294 Ga0070698_100232494
295 Ga0070698_100331209
296 Ga0070699_100003790
297 Ga0070699_100004715
298 Ga0070699_100033172
299 Ga0070699_100080509
300 Ga0070699_100107353
301 Ga0070697_100111974
302 Ga0070697_100362158
303 Ga0070697_100460102
304 Ga0070697_100520358
305 Ga0070672_100620804
306 Ga0070686_100328382
307 Ga0070695_100071800
308 Ga0070695_100381340
309 Ga0070696_100031240
310 Ga0070696_100244883
311 Ga0070665_100086648
312 Ga0070665_100299596
313 Ga0068855_100006424
314 Ga0068854_100019575
315 Ga0068856_100000682
316 Ga0068856_100039001
317 Ga0068861_100744823
318 Ga0068862_100314400
319 Ga0081455_10109364
320 Ga0081538_10002326
321 Ga0081538_10006533
322 Ga0081538_10013908
323 Ga0070717_10000970
324 Ga0070717_10637658
325 Ga0070716_100029450
326 Ga0097621_100272425
327 Ga0097621_100508638
328 Ga0068871_100176866
329 Ga0075428_100011965
330 Ga0075428_100077820
331 Ga0075428_100270636
332 Ga0075428_100662783
333 Ga0075428_101038013
334 Ga0075430_100069578
335 Ga0075430_100589367
336 Ga0075431_100143861
337 Ga0075433_10000747
338 Ga0075433_10001225
339 Ga0075433_10023602
340 Ga0075433_10048185
341 Ga0075433_10240695
342 Ga0075433_10311192
343 Ga0075433_10401111
344 Ga0075433_10457728
345 Ga0075433_10631696
346 Ga0075434_100000560
347 Ga0075434_100001047
348 Ga0075434_100052295
349 Ga0075434_100085799
350 Ga0075434_100119754
351 Ga0075434_100126637
352 Ga0075434_100374833
353 Ga0075434_100376492
354 Ga0075434_100924499
355 Ga0075429_100005287
356 Ga0075429_100069505
357 Ga0075429_100650444
358 Ga0075436_100001512
359 Ga0075435_100006675
360 Ga0075435_100013485
361 Ga0075435_100056394
362 Ga0075435_100162935
363 Ga0099794_10000036
364 Ga0111539_10066810
365 Ga0111539_10086679
366 Ga0111539_10608660
367 Ga0114129_10000982
368 Ga0114129_10002217
369 Ga0114129_10149442
370 Ga0114129_10306142
371 Ga0114129_10313584
372 Ga0114129_10315621
373 Ga0114129_10555831
374 Ga0114129_10871945
375 Ga0105241_10025628
376 Ga0105249_10603787
377 Ga0105239_10950397
378 Ga0105246_10044302
379 Ga0157373_10149075
380 Ga0157371_10088321
381 Ga0157374_10160126
382 Ga0157375_10071565
383 Ga0157375_10457257
384 Ga0157375_10494112
385 Ga0157379_10309080
386 Ga0157379_10760073
387 Ga0157376_10261237
388 Ga0213872_10008467
389 Ga0213872_10073765
390 Ga0207697_10048354
391 Ga0207653_10038307
392 Ga0207680_10132657
393 Ga0207645_10002238
394 Ga0207684_10016305
395 Ga0207684_10082231
396 Ga0207707_10026810
397 Ga0207663_10138404
398 Ga0207657_10043736
399 Ga0207649_10178851
400 Ga0207646_10002315
401 Ga0207646_10003937
402 Ga0207646_10010132
403 Ga0207646_10229491
404 Ga0207646_10303127
405 Ga0207646_10468111
406 Ga0207681_10384146
407 Ga0207664_10358316
408 Ga0207644_10080305
409 Ga0207669_10414816
410 Ga0207665_10010220
411 Ga0207691_10044122
412 Ga0207689_10653823
413 Ga0207679_10007598
414 Ga0207667_10098320
415 Ga0207667_10327163
416 Ga0207668_10119241
417 Ga0207658_10184377
418 Ga0207702_10000681
419 Ga0207683_10003353
420 Ga0209588_1000020
421 Ga0209588_1003246
422 Ga0207428_10004677
423 Ga0207428_10100021
424 Ga0268266_10079492
425 Ga0268266_10140659
426 Ga0265338_10000660
427 Ga0265338_10000864
428 Ga0265324_10006300
429 Ga0373924_0109652
430 Ga0373935_0018049
431 Ga0395905_0154133
432 Ga0436365_0543086
433 Ga0436365_1891732
434 Ga0436360_0898261
435 Ga0436360_1098897
436 Ga0436361_0082827
437 Ga0436361_0160569
438 Ga0436361_1103959
439 Ga0436363_1258709
440 Ga0451577_0002347
441 Ga0453683_0005116
442 Ga0453684_0005984
443 Ga0453684_0078401
444 Ga0453684_0323151
445 Ga0453684_0650891
446 Ga0451576_0411724
447 Ga0495592_0249284
448 Ga0495618_0379283
449 Ga0495628_0118716
450 Ga0495652_0336376
451 Ga0495645_0312468
452 Ga0495633_0102333
453 Ga0495634_0066804
454 Ga0495635_0320844
455 Ga0495670_0365290
456 Ga0495674_0015451
457 Ga0495674_0119800
458 Ga0496100_0316800
459 Ga0496102_0033926
460 Ga0496102_0449278
461 Ga0496105_0363137
462 Ga0496110_0445525
463 Ga0496112_0683604
464 Ga0496113_0370842
465 Ga0496114_0335518
466 Ga0501031_0000012
467 Ga0501031_0140123
468 Ga0501032_0001712
469 Ga0501033_0014926
470 Ga0501033_0098186
471 Ga0501037_0038183
472 Ga0501037_0263064
473 Ga0501038_0454190
474 Ga0501043_0224254
475 Ga0501046_0128310
476 Ga0501047_0567836
477 Ga0501077_0026627
478 Ga0501077_0110294
479 Ga0501080_0313165
480 Ga0501035_0001290
481 Ga0501035_0151624
482 Ga0501044_0000024
483 Ga0501044_0004128
484 nmdc:mga05p37_106233_c1
485 nmdc:mga05p37_267679_c1
486 nmdc:mga05p37_322534_c1
487 nmdc:mga05p37_384018_c1
488 nmdc:mga05p37_4367_c1
489 nmdc:mga05p37_464587_c1
490 nmdc:mga05p37_511843_c1
491 nmdc:mga05p37_7890_c1
492 nmdc:mga05p37_915034_c1
493 nmdc:mga09592_4603_c1
494 nmdc:mga09592_94726_c1
495 nmdc:mga0qj67_339261_c1
496 nmdc:mga0qj67_583796_c1
497 nmdc:mga08y16_23974_c1
498 nmdc:mga08y16_662961_c1
499 nmdc:mga08y16_710767_c1
500 nmdc:mga0n895_10966_c1
501 nmdc:mga0n895_1147939_c1
502 nmdc:mga0n895_124062_c1
503 nmdc:mga0n895_146395_c1
504 nmdc:mga0n895_1947_c1
505 nmdc:mga0n895_299265_c1
506 nmdc:mga0n895_496604_c1
507 nmdc:mga0n895_8296_c1
508 nmdc:mga0rr50_12153_c1
509 nmdc:mga0rr50_154171_c1
510 nmdc:mga0rr50_3060_c1
511 nmdc:mga0rr50_39777_c1
512 nmdc:mga0rr50_859_c1
513 nmdc:mga08x19_1793_c1
514 nmdc:mga08x19_59929_c1
515 nmdc:mga0a205_136548_c1
516 nmdc:mga0a205_140942_c2
517 nmdc:mga0a205_1452_c1
518 nmdc:mga0a205_161_c1
519 nmdc:mga0a205_22289_c1
520 nmdc:mga0a205_594_c1
521 nmdc:mga0a205_97129_c1
522 Ga0495595_0043515
523 Ga0501082_0447369
524 Ga0530510_0034709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

7

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tm7-assembly1.cif.gz_A crystal structure of 6-phosphogluconolactonase from mycobacterium smegmatis n131d mutant soaked with cuso4 0.8807 2 202
3ico-assembly2.cif.gz_B crystal structure of 6-phosphogluconolactonase from mycobacterium tuberculosis 0.8786 1 202
3tx2-assembly1.cif.gz_A structure of a probable 6-phosphogluconolactonase from mycobacterium abscessus 0.8765 2 204
3oc6-assembly1.cif.gz_A crystal structure of 6-phosphogluconolactonase from mycobacterium smegmatis, apo form 0.8739 1 202
3tx2-assembly1.cif.gz_A structure of a probable 6-phosphogluconolactonase from mycobacterium abscessus 0.8686 2 204
ID Description Score Start End Superfamily
3icoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8786 1 202 3.40.50.1360
3icoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.867 1 202 3.40.50.1360
af_O74455_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8581 1 202 3.40.50.1360
af_O74455_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8467 1 202 3.40.50.1360
af_Q2G0K8_1_251_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8433 1 204 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A524KHF2-F1-model_v4 Glucosamine/galactosamine-6-phosphate isomerase domain-containing protein 0.9696 95 202 GO:0005975
AF-A0A2V6EXA6-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9629 38 203 GO:0005975
GO:0006098
GO:0017057
AF-A0A432UXD3-F1-model_v4 Glucosamine/galactosamine-6-phosphate isomerase domain-containing protein 0.9623 119 204 GO:0005975
AF-A0A7V6DPQ4-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.961 2 202 GO:0005975
GO:0006098
GO:0017057
AF-A0A653AC82-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9607 1 203 GO:0005975
GO:0006098
GO:0017057

Map