F370656

General Info

Members Datasets Scaffolds Average Seq Length
261 164 522 224

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0058872|Ga0501046_0058872_1465_2292
Length 275
Sequence MGERLTLTAEDGHRFSAYQARPAGTPRAALVVIQEIFGVNHHIRNVTDGFAADGYLALAPALFDRVEPGYETGYTPDDVDRGRAVRQKLGFDVMVMDVRAAVAELRKSGLPVGVVGYCMGGTMAWLAATRIDGVAAAVGYYGGGIADTASERPRCPVMLHFGETDAAIPAEHWERIRKAQPALPLHVYPGAGHGFSCDERASFHEPSHRLARERTIAFLRQHVGSDEAGLRDTGYVSGEPFRDPFPGAGESVGARLVTEFGVVAGSSVAVMADPA

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.45
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0058872 3300049580 Bacteria 3011
2 rootH2_10090502 3300003320 Bacteria 1412
3 Ga0070683_100021739 3300005329 Bacteria 5728
4 Ga0070683_100201815 3300005329 Bacteria 1888
5 Ga0068869_100425154 3300005334 Bacteria 1097
6 Ga0070680_100193189 3300005336 Bacteria 1715
7 Ga0070680_100521545 3300005336 Bacteria 1017
8 Ga0068868_100074937 3300005338 Bacteria 2704
9 Ga0070687_100503306 3300005343 Bacteria 816
10 Ga0070661_100289211 3300005344 Bacteria 1273
11 Ga0070692_10251915 3300005345 Bacteria 1057
12 Ga0070668_100142605 3300005347 Unclassified 1932
13 Ga0070669_100775221 3300005353 Bacteria 814
14 Ga0070673_100633564 3300005364 Bacteria 977
15 Ga0070667_100885028 3300005367 Bacteria 831
16 Ga0070703_10121596 3300005406 Bacteria 948
17 Ga0070713_100024774 3300005436 Bacteria 4681
18 Ga0070713_100103259 3300005436 Bacteria 2473
19 Ga0070701_10126694 3300005438 Bacteria 1446
20 Ga0070711_100015709 3300005439 Bacteria 4794
21 Ga0070711_100153772 3300005439 Bacteria 1737
22 Ga0070711_100575737 3300005439 Unclassified 937
23 Ga0070694_100393365 3300005444 Bacteria 1083
24 Ga0070708_100124763 3300005445 Bacteria 2379
25 Ga0070681_10037102 3300005458 Bacteria 4892
26 Ga0070681_10115776 3300005458 Bacteria 2618
27 Ga0070706_100147599 3300005467 Bacteria 2196
28 Ga0070698_100169883 3300005471 Bacteria 2122
29 Ga0070679_100750140 3300005530 Bacteria 919
30 Ga0070679_100850185 3300005530 Bacteria 856
31 Ga0070697_100338617 3300005536 Bacteria 1298
32 Ga0070686_100463408 3300005544 Bacteria 976
33 Ga0070696_100053810 3300005546 Bacteria 2803
34 Ga0070696_100072692 3300005546 Bacteria 2422
35 Ga0070693_100397266 3300005547 Bacteria 955
36 Ga0070704_100053137 3300005549 Bacteria 2862
37 Ga0070704_100296031 3300005549 Bacteria 1346
38 Ga0068855_100086895 3300005563 Bacteria 3615
39 Ga0068855_101000358 3300005563 Bacteria 878
40 Ga0068857_100185120 3300005577 Unclassified 1896
41 Ga0068857_100344611 3300005577 Bacteria 1379
42 Ga0068856_100011829 3300005614 Bacteria 8457
43 Ga0070702_100330125 3300005615 Bacteria 1066
44 Ga0068852_100006808 3300005616 Bacteria 8298
45 Ga0068852_100014760 3300005616 Bacteria 6030
46 Ga0068852_100343501 3300005616 Unclassified 1455
47 Ga0068859_100420145 3300005617 Bacteria 1433
48 Ga0068859_100568290 3300005617 Bacteria 1228
49 Ga0068866_10369087 3300005718 Bacteria 917
50 Ga0068861_100289213 3300005719 Bacteria 1414
51 Ga0068851_10001590 3300005834 Bacteria 9966
52 Ga0068858_100222309 3300005842 Bacteria 1789
53 Ga0068862_100956151 3300005844 Bacteria 845
54 Ga0081455_10000529 3300005937 Bacteria 49513
55 Ga0070717_10245496 3300006028 Bacteria 1580
56 Ga0070717_10435166 3300006028 Bacteria 1181
57 Ga0070716_100046701 3300006173 Bacteria 2438
58 Ga0070712_100037635 3300006175 Bacteria 3300
59 Ga0068871_100010900 3300006358 Bacteria 6655
60 Ga0075428_100021300 3300006844 Bacteria 7177
61 Ga0075428_101203395 3300006844 Bacteria 799
62 Ga0075431_100124907 3300006847 Bacteria 2655
63 Ga0075431_100561758 3300006847 Bacteria 1128
64 Ga0075433_10058279 3300006852 Bacteria 3378
65 Ga0075433_10206579 3300006852 Bacteria 1746
66 Ga0075433_10557463 3300006852 Bacteria 1007
67 Ga0075434_100706138 3300006871 Bacteria 1026
68 Ga0075429_100062341 3300006880 Bacteria 3249
69 Ga0075429_100545873 3300006880 Bacteria 1016
70 Ga0075436_100287385 3300006914 Bacteria 1177
71 Ga0097620_100420111 3300006931 Bacteria 1433
72 Ga0097620_100568381 3300006931 Bacteria 1228
73 Ga0075435_100058950 3300007076 Bacteria 3111
74 Ga0105240_10081579 3300009093 Unclassified 3974
75 Ga0105240_10175362 3300009093 Bacteria 2535
76 Ga0111539_10285963 3300009094 Bacteria 1919
77 Ga0105245_10009721 3300009098 Bacteria 8386
78 Ga0105245_10129171 3300009098 Unclassified 2369
79 Ga0105247_10225222 3300009101 Bacteria 1271
80 Ga0114129_10001419 3300009147 Bacteria 32309
81 Ga0114129_10069430 3300009147 Bacteria 4911
82 Ga0105241_10439996 3300009174 Bacteria 1151
83 Ga0105242_11539720 3300009176 Bacteria 697
84 Ga0105248_11535086 3300009177 Bacteria 754
85 Ga0105238_10145646 3300009551 Bacteria 2345
86 Ga0105238_10157666 3300009551 Bacteria 2245
87 Ga0105249_10082382 3300009553 Bacteria 2994
88 Ga0105249_10146992 3300009553 Bacteria 2265
89 Ga0105239_10301500 3300010375 Bacteria 1804
90 Ga0157369_10066107 3300013105 Unclassified 3890
91 Ga0157369_10078529 3300013105 Bacteria 3536
92 Ga0157369_10880282 3300013105 Unclassified 919
93 Ga0157374_10540325 3300013296 Bacteria 1173
94 Ga0157374_10587657 3300013296 Unclassified 1123
95 Ga0157378_10074125 3300013297 Unclassified 3062
96 Ga0157378_10416047 3300013297 Bacteria 1328
97 Ga0157378_10493547 3300013297 Unclassified 1222
98 Ga0163162_10666750 3300013306 Bacteria 1163
99 Ga0157380_10091841 3300014326 Bacteria 2507
100 Ga0157380_10185504 3300014326 Bacteria 1832
101 Ga0157379_10404411 3300014968 Bacteria 1255
102 Ga0207653_10043425 3300025885 Bacteria 1480
103 Ga0207692_10095453 3300025898 Unclassified 1621
104 Ga0207705_10006338 3300025909 Bacteria 8780
105 Ga0207707_10130340 3300025912 Bacteria 2199
106 Ga0207707_10242021 3300025912 Bacteria 1568
107 Ga0207695_10530929 3300025913 Unclassified 1058
108 Ga0207693_10010118 3300025915 Bacteria 7661
109 Ga0207693_10044599 3300025915 Bacteria 3485
110 Ga0207693_10316329 3300025915 Bacteria 1222
111 Ga0207663_10002064 3300025916 Bacteria 9572
112 Ga0207660_10328426 3300025917 Bacteria 1223
113 Ga0207660_10633869 3300025917 Bacteria 871
114 Ga0207662_10084716 3300025918 Bacteria 1940
115 Ga0207657_10191613 3300025919 Bacteria 1649
116 Ga0207652_10401145 3300025921 Bacteria 1237
117 Ga0207681_10573902 3300025923 Bacteria 930
118 Ga0207694_10031356 3300025924 Bacteria 4060
119 Ga0207694_10148263 3300025924 Bacteria 1889
120 Ga0207694_10252786 3300025924 Bacteria 1443
121 Ga0207650_10820202 3300025925 Bacteria 789
122 Ga0207687_10000650 3300025927 Bacteria 23358
123 Ga0207687_10073251 3300025927 Bacteria 2452
124 Ga0207700_10022522 3300025928 Bacteria 4326
125 Ga0207700_10223513 3300025928 Bacteria 1597
126 Ga0207664_10108720 3300025929 Bacteria 2303
127 Ga0207686_10218719 3300025934 Bacteria 1374
128 Ga0207670_10042827 3300025936 Bacteria 2986
129 Ga0207669_10141043 3300025937 Unclassified 1673
130 Ga0207711_10537490 3300025941 Bacteria 1090
131 Ga0207689_10300738 3300025942 Bacteria 1330
132 Ga0207661_10054267 3300025944 Unclassified 3210
133 Ga0207661_10125770 3300025944 Bacteria 2189
134 Ga0207667_10017642 3300025949 Bacteria 8030
135 Ga0207667_10462677 3300025949 Bacteria 1288
136 Ga0207712_10067850 3300025961 Bacteria 2554
137 Ga0207677_10708001 3300026023 Bacteria 894
138 Ga0207703_10139229 3300026035 Bacteria 2104
139 Ga0207678_10401629 3300026067 Bacteria 1187
140 Ga0207702_10142452 3300026078 Unclassified 2171
141 Ga0207674_10592758 3300026116 Unclassified 1071
142 Ga0207675_100008115 3300026118 Bacteria 9892
143 Ga0207698_10037986 3300026142 Bacteria 3553
144 Ga0207698_10040594 3300026142 Bacteria 3460
145 Ga0268265_10087889 3300028380 Bacteria 2474
146 Ga0268264_10709937 3300028381 Bacteria 999
147 Ga0265338_10004816 3300028800 Bacteria 18042
148 Ga0265325_10253262 3300031241 Bacteria 797
149 Ga0265339_10005537 3300031249 Bacteria 8396
150 Ga0265339_10083073 3300031249 Bacteria 1690
151 Ga0265316_10166664 3300031344 Bacteria 1645
152 Ga0265314_10050261 3300031711 Bacteria 2913
153 Ga0265342_10032566 3300031712 Bacteria 3214
154 Ga0373953_0222247 3300035117 Bacteria 818
155 Ga0373946_0257511 3300035171 Bacteria 853
156 Ga0373924_0055476 3300035410 Bacteria 1649
157 Ga0373935_0200793 3300035692 Bacteria 1378
158 Ga0373937_0000117 3300036401 Bacteria 75969
159 Ga0373937_0017790 3300036401 Bacteria 6342
160 Ga0316582_0100061 3300036647 Bacteria 1919
161 Ga0373925_0491457 3300037068 Bacteria 1007
162 Ga0395905_0499861 3300037471 Unclassified 1116
163 Ga0395901_0211509 3300038443 Bacteria 2030
164 Ga0466959_0144369 3300045049 Bacteria 1680
165 Ga0451576_0149450 3300045051 Bacteria 2436
166 Ga0451576_0528082 3300045051 Bacteria 1240
167 Ga0495580_0110263 3300046472 Unclassified 1911
168 Ga0495587_0314977 3300046536 Bacteria 874
169 Ga0495599_0213718 3300046678 Bacteria 1182
170 Ga0495623_0181267 3300046679 Bacteria 1223
171 Ga0496100_0028888 3300048903 Unclassified 3425
172 Ga0496100_0742658 3300048903 Bacteria 767
173 Ga0496102_0108463 3300048905 Bacteria 2586
174 Ga0496104_0015712 3300048907 Bacteria 6866
175 Ga0496105_0001553 3300048908 Bacteria 16254
176 Ga0496105_0124265 3300048908 Bacteria 2127
177 Ga0496113_0047119 3300048916 Bacteria 3203
178 Ga0496115_0104663 3300048918 Bacteria 2323
179 Ga0496115_0754411 3300048918 Bacteria 761
180 Ga0496126_0049488 3300048929 Bacteria 3837
181 Ga0501032_0164753 3300049569 Bacteria 1455
182 Ga0501033_0021692 3300049570 Bacteria 4847
183 Ga0501036_0007889 3300049572 Bacteria 8709
184 Ga0501036_0132158 3300049572 Bacteria 2107
185 Ga0501036_0230128 3300049572 Bacteria 1556
186 Ga0501037_0114528 3300049573 Bacteria 1941
187 Ga0501038_0008090 3300049574 Bacteria 9677
188 Ga0501039_0091038 3300049575 Bacteria 2377
189 Ga0501039_0095992 3300049575 Bacteria 2311
190 Ga0501040_0017981 3300049576 Bacteria 4693
191 Ga0501040_0022272 3300049576 Bacteria 4239
192 Ga0501041_0010277 3300049577 Bacteria 5514
193 Ga0501041_0029649 3300049577 Bacteria 3301
194 Ga0501042_0058326 3300049578 Bacteria 2755
195 Ga0501042_0187548 3300049578 Bacteria 1492
196 Ga0501042_0541613 3300049578 Bacteria 846
197 Ga0501043_0152062 3300049579 Bacteria 1811
198 Ga0501046_0025893 3300049580 Bacteria 4795
199 Ga0501046_0236766 3300049580 Bacteria 1347
200 Ga0501048_0044312 3300049582 Bacteria 3182
201 Ga0501048_0103201 3300049582 Bacteria 2012
202 Ga0501068_0075111 3300049584 Bacteria 2067
203 Ga0501068_0110007 3300049584 Bacteria 1713
204 Ga0501069_0428572 3300049585 Bacteria 784
205 Ga0501071_0201299 3300049587 Bacteria 1496
206 Ga0501071_0256490 3300049587 Bacteria 1320
207 Ga0501072_0004442 3300049588 Bacteria 10656
208 Ga0501072_0263949 3300049588 Bacteria 1370
209 Ga0501072_0323570 3300049588 Bacteria 1225
210 Ga0501074_0216793 3300049590 Bacteria 1363
211 Ga0501074_0348215 3300049590 Bacteria 1051
212 Ga0501075_0000022 3300049591 Bacteria 64965
213 Ga0501075_0007132 3300049591 Bacteria 7732
214 Ga0501075_0094193 3300049591 Bacteria 2273
215 Ga0501075_0317948 3300049591 Bacteria 1186
216 Ga0501075_0347729 3300049591 Bacteria 1130
217 Ga0501075_0371040 3300049591 Bacteria 1091
218 Ga0501075_0480559 3300049591 Bacteria 948
219 Ga0501075_0768127 3300049591 Bacteria 733
220 Ga0501076_0000064 3300049592 Bacteria 53698
221 Ga0501076_0010170 3300049592 Bacteria 6970
222 Ga0501076_0099883 3300049592 Bacteria 2338
223 Ga0501076_0104776 3300049592 Bacteria 2282
224 Ga0501077_0001367 3300049593 Bacteria 14678
225 Ga0501077_0055912 3300049593 Bacteria 2505
226 Ga0501077_0067143 3300049593 Bacteria 2274
227 Ga0501077_0208136 3300049593 Bacteria 1243
228 Ga0501079_0054472 3300049741 Bacteria 3085
229 Ga0501079_0145547 3300049741 Bacteria 1846
230 Ga0501080_0013948 3300049742 Bacteria 7396
231 Ga0501080_0141058 3300049742 Bacteria 2228
232 Ga0501080_0354825 3300049742 Bacteria 1324
233 Ga0501080_0418544 3300049742 Bacteria 1204
234 Ga0501081_0000250 3300049743 Bacteria 27697
235 Ga0501081_0002029 3300049743 Bacteria 12619
236 Ga0501081_0307172 3300049743 Bacteria 1164
237 Ga0501083_0089040 3300049744 Bacteria 2040
238 Ga0501035_0215596 3300049822 Bacteria 1641
239 Ga0501045_0079983 3300049824 Bacteria 2410
240 Ga0501045_0107689 3300049824 Bacteria 2065
241 nmdc:mga05p37_116350_c1 3300050507 Bacteria 3286
242 nmdc:mga05p37_294_c1 3300050507 Bacteria 52291
243 nmdc:mga09592_265921_c1 3300050508 Bacteria 1487
244 nmdc:mga06r32_106259_c1 3300050510 Bacteria 2758
245 nmdc:mga06r32_148134_c1 3300050510 Bacteria 2325
246 nmdc:mga06r32_155146_c1 3300050510 Bacteria 2270
247 nmdc:mga08x19_261537_c1 3300050514 Bacteria 1196
248 nmdc:mga0a205_106648_c1 3300050515 Bacteria 2699
249 nmdc:mga0a205_501044_c1 3300050515 Bacteria 1071
250 Ga0501084_0027683 3300054114 Bacteria 4736
251 Ga0501084_0037204 3300054114 Bacteria 4066
252 Ga0501084_0054234 3300054114 Bacteria 3353
253 Ga0501084_0341110 3300054114 Bacteria 1266
254 Ga0501082_0036045 3300060353 Bacteria 4262
255 Ga0501082_0087711 3300060353 Bacteria 2685
256 Ga0501082_0099739 3300060353 Bacteria 2511
257 Ga0501082_0206565 3300060353 Bacteria 1709
258 Ga0501082_0592872 3300060353 Bacteria 970
259 Ga0530510_0000064 3300061734 Bacteria 52546
260 Ga0530510_0000295 3300061734 Bacteria 31690
261 Ga0530510_0025719 3300061734 Bacteria 4210
262 Ga0501046_0058872
263 rootH2_10090502
264 Ga0070683_100021739
265 Ga0070683_100201815
266 Ga0068869_100425154
267 Ga0070680_100193189
268 Ga0070680_100521545
269 Ga0068868_100074937
270 Ga0070687_100503306
271 Ga0070661_100289211
272 Ga0070692_10251915
273 Ga0070668_100142605
274 Ga0070669_100775221
275 Ga0070673_100633564
276 Ga0070667_100885028
277 Ga0070703_10121596
278 Ga0070713_100024774
279 Ga0070713_100103259
280 Ga0070701_10126694
281 Ga0070711_100015709
282 Ga0070711_100153772
283 Ga0070711_100575737
284 Ga0070694_100393365
285 Ga0070708_100124763
286 Ga0070681_10037102
287 Ga0070681_10115776
288 Ga0070706_100147599
289 Ga0070698_100169883
290 Ga0070679_100750140
291 Ga0070679_100850185
292 Ga0070697_100338617
293 Ga0070686_100463408
294 Ga0070696_100053810
295 Ga0070696_100072692
296 Ga0070693_100397266
297 Ga0070704_100053137
298 Ga0070704_100296031
299 Ga0068855_100086895
300 Ga0068855_101000358
301 Ga0068857_100185120
302 Ga0068857_100344611
303 Ga0068856_100011829
304 Ga0070702_100330125
305 Ga0068852_100006808
306 Ga0068852_100014760
307 Ga0068852_100343501
308 Ga0068859_100420145
309 Ga0068859_100568290
310 Ga0068866_10369087
311 Ga0068861_100289213
312 Ga0068851_10001590
313 Ga0068858_100222309
314 Ga0068862_100956151
315 Ga0081455_10000529
316 Ga0070717_10245496
317 Ga0070717_10435166
318 Ga0070716_100046701
319 Ga0070712_100037635
320 Ga0068871_100010900
321 Ga0075428_100021300
322 Ga0075428_101203395
323 Ga0075431_100124907
324 Ga0075431_100561758
325 Ga0075433_10058279
326 Ga0075433_10206579
327 Ga0075433_10557463
328 Ga0075434_100706138
329 Ga0075429_100062341
330 Ga0075429_100545873
331 Ga0075436_100287385
332 Ga0097620_100420111
333 Ga0097620_100568381
334 Ga0075435_100058950
335 Ga0105240_10081579
336 Ga0105240_10175362
337 Ga0111539_10285963
338 Ga0105245_10009721
339 Ga0105245_10129171
340 Ga0105247_10225222
341 Ga0114129_10001419
342 Ga0114129_10069430
343 Ga0105241_10439996
344 Ga0105242_11539720
345 Ga0105248_11535086
346 Ga0105238_10145646
347 Ga0105238_10157666
348 Ga0105249_10082382
349 Ga0105249_10146992
350 Ga0105239_10301500
351 Ga0157369_10066107
352 Ga0157369_10078529
353 Ga0157369_10880282
354 Ga0157374_10540325
355 Ga0157374_10587657
356 Ga0157378_10074125
357 Ga0157378_10416047
358 Ga0157378_10493547
359 Ga0163162_10666750
360 Ga0157380_10091841
361 Ga0157380_10185504
362 Ga0157379_10404411
363 Ga0207653_10043425
364 Ga0207692_10095453
365 Ga0207705_10006338
366 Ga0207707_10130340
367 Ga0207707_10242021
368 Ga0207695_10530929
369 Ga0207693_10010118
370 Ga0207693_10044599
371 Ga0207693_10316329
372 Ga0207663_10002064
373 Ga0207660_10328426
374 Ga0207660_10633869
375 Ga0207662_10084716
376 Ga0207657_10191613
377 Ga0207652_10401145
378 Ga0207681_10573902
379 Ga0207694_10031356
380 Ga0207694_10148263
381 Ga0207694_10252786
382 Ga0207650_10820202
383 Ga0207687_10000650
384 Ga0207687_10073251
385 Ga0207700_10022522
386 Ga0207700_10223513
387 Ga0207664_10108720
388 Ga0207686_10218719
389 Ga0207670_10042827
390 Ga0207669_10141043
391 Ga0207711_10537490
392 Ga0207689_10300738
393 Ga0207661_10054267
394 Ga0207661_10125770
395 Ga0207667_10017642
396 Ga0207667_10462677
397 Ga0207712_10067850
398 Ga0207677_10708001
399 Ga0207703_10139229
400 Ga0207678_10401629
401 Ga0207702_10142452
402 Ga0207674_10592758
403 Ga0207675_100008115
404 Ga0207698_10037986
405 Ga0207698_10040594
406 Ga0268265_10087889
407 Ga0268264_10709937
408 Ga0265338_10004816
409 Ga0265325_10253262
410 Ga0265339_10005537
411 Ga0265339_10083073
412 Ga0265316_10166664
413 Ga0265314_10050261
414 Ga0265342_10032566
415 Ga0373953_0222247
416 Ga0373946_0257511
417 Ga0373924_0055476
418 Ga0373935_0200793
419 Ga0373937_0000117
420 Ga0373937_0017790
421 Ga0316582_0100061
422 Ga0373925_0491457
423 Ga0395905_0499861
424 Ga0395901_0211509
425 Ga0466959_0144369
426 Ga0451576_0149450
427 Ga0451576_0528082
428 Ga0495580_0110263
429 Ga0495587_0314977
430 Ga0495599_0213718
431 Ga0495623_0181267
432 Ga0496100_0028888
433 Ga0496100_0742658
434 Ga0496102_0108463
435 Ga0496104_0015712
436 Ga0496105_0001553
437 Ga0496105_0124265
438 Ga0496113_0047119
439 Ga0496115_0104663
440 Ga0496115_0754411
441 Ga0496126_0049488
442 Ga0501032_0164753
443 Ga0501033_0021692
444 Ga0501036_0007889
445 Ga0501036_0132158
446 Ga0501036_0230128
447 Ga0501037_0114528
448 Ga0501038_0008090
449 Ga0501039_0091038
450 Ga0501039_0095992
451 Ga0501040_0017981
452 Ga0501040_0022272
453 Ga0501041_0010277
454 Ga0501041_0029649
455 Ga0501042_0058326
456 Ga0501042_0187548
457 Ga0501042_0541613
458 Ga0501043_0152062
459 Ga0501046_0025893
460 Ga0501046_0236766
461 Ga0501048_0044312
462 Ga0501048_0103201
463 Ga0501068_0075111
464 Ga0501068_0110007
465 Ga0501069_0428572
466 Ga0501071_0201299
467 Ga0501071_0256490
468 Ga0501072_0004442
469 Ga0501072_0263949
470 Ga0501072_0323570
471 Ga0501074_0216793
472 Ga0501074_0348215
473 Ga0501075_0000022
474 Ga0501075_0007132
475 Ga0501075_0094193
476 Ga0501075_0317948
477 Ga0501075_0347729
478 Ga0501075_0371040
479 Ga0501075_0480559
480 Ga0501075_0768127
481 Ga0501076_0000064
482 Ga0501076_0010170
483 Ga0501076_0099883
484 Ga0501076_0104776
485 Ga0501077_0001367
486 Ga0501077_0055912
487 Ga0501077_0067143
488 Ga0501077_0208136
489 Ga0501079_0054472
490 Ga0501079_0145547
491 Ga0501080_0013948
492 Ga0501080_0141058
493 Ga0501080_0354825
494 Ga0501080_0418544
495 Ga0501081_0000250
496 Ga0501081_0002029
497 Ga0501081_0307172
498 Ga0501083_0089040
499 Ga0501035_0215596
500 Ga0501045_0079983
501 Ga0501045_0107689
502 nmdc:mga05p37_116350_c1
503 nmdc:mga05p37_294_c1
504 nmdc:mga09592_265921_c1
505 nmdc:mga06r32_106259_c1
506 nmdc:mga06r32_148134_c1
507 nmdc:mga06r32_155146_c1
508 nmdc:mga08x19_261537_c1
509 nmdc:mga0a205_106648_c1
510 nmdc:mga0a205_501044_c1
511 Ga0501084_0027683
512 Ga0501084_0037204
513 Ga0501084_0054234
514 Ga0501084_0341110
515 Ga0501082_0036045
516 Ga0501082_0087711
517 Ga0501082_0099739
518 Ga0501082_0206565
519 Ga0501082_0592872
520 Ga0530510_0000064
521 Ga0530510_0000295
522 Ga0530510_0025719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

15

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.9563 5 223
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.953 5 223
1zix-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a 0.9509 5 223
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.9508 5 223
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.9504 5 223
ID Description Score Start End Superfamily
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.95 5 223 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9295 5 223 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8883 2 222 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8772 2 222 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8676 3 221 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7G8BPX4-F1-model_v4 Dienelactone hydrolase family protein 0.9963 1 222 GO:0016787
AF-A0A7G8BPX4-F1-model_v4 Dienelactone hydrolase family protein 0.9874 1 222 GO:0016787
AF-I3ZCL5-F1-model_v4 Dienelactone hydrolase-like enzyme 0.9862 1 223 GO:0016787
AF-A0A7W8JAG7-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9851 1 223 GO:0008806
AF-A0A1H4GYH6-F1-model_v4 Carboxymethylenebutenolidase 0.9836 1 223 GO:0016787

Map