F370633

General Info

Members Datasets Scaffolds Average Seq Length
261 185 201 291

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0068456|Ga0496124_0068456_277_1230
Length 317
Sequence MRTLYAPVFFLGFVGSAVWLLDEGASLGWLPVLLLLAIGVSMLCERLWPYRERWNVSQGDGTRDVIHAGVNEALNAAGIAAIPLIALVLPDTGLWPSDWPLALQLLLALPVADLGITLVHYASHRLPLLWRLHAVHHSVTRMYGFNGLMKHPLHQMLEALGGTSPLLLCGLPLDVAALLAFSISIQLLLQHSNVDMRIGWLRHVFAWAPVHRLHHLKYGTTGDVNFALFFSVWDRLLGTALHLPHYHLADDDLGIGDFPDYPVGYGAQLRQPFRRDQPEHPPAVLPDALSRALVQQPKAQVAQGTVGTDAELLAHAA

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231022 Pseudomonas sp. GM79 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
6 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
7 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
8 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
9 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
10 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
11 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
12 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
13 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
14 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
15 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
16 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
17 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
18 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
19 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
20 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
21 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
22 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
23 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
24 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
25 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
26 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
27 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
28 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
29 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
30 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
31 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
32 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
33 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
34 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
35 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
36 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
37 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
38 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
39 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
40 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
43 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
44 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
45 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
46 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
47 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
50 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
110 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
113 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
114 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
115 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
116 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
117 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
118 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
119 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
120 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
174 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
175 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
176 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
177 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
178 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
179 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
180 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
181 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
182 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
183 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
184 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
185 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.01
Metatranscriptomes 0
Isolates 22.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 1.53
Rhizoplane 8.43
Rhizosphere 63.98
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000073 3300002737 Bacteria 121835
2 JGI25163J39215_1000241 3300002771 Bacteria 20064
3 JGI25164J39214_1000052 3300002772 Bacteria 121835
4 JGI25165J46597_1000137 3300003214 Bacteria 121835
5 Ga0055526_1000006 3300003771 Bacteria 330857
6 Ga0055537_1000003 3300003773 Bacteria 220933
7 Ga0055524_1000009 3300003775 Bacteria 295254
8 Ga0055536_1000048 3300003781 Bacteria 115094
9 Ga0055534_1000004 3300003784 Bacteria 295251
10 Ga0055528_1000003 3300003790 Bacteria 330875
11 Ga0055530_10000105 3300003791 Bacteria 71978
12 Ga0055540_1000652 3300003792 Bacteria 24341
13 Ga0070661_100160372 3300005344 Bacteria 1703
14 Ga0068853_100007251 3300005539 Bacteria 8882
15 Ga0075364_10079283 3300006051 Bacteria 2170
16 Ga0075432_10020419 3300006058 Bacteria 2265
17 Ga0075362_10152876 3300006177 Bacteria 1108
18 Ga0075370_10182722 3300006353 Bacteria 1235
19 Ga0075428_100003455 3300006844 Bacteria 17286
20 Ga0075430_100002570 3300006846 Bacteria 15132
21 Ga0075431_100002602 3300006847 Bacteria 17450
22 Ga0075429_100000318 3300006880 Bacteria 34563
23 Ga0105251_10000433 3300009011 Bacteria 40634
24 Ga0105251_10004482 3300009011 Bacteria 9479
25 Ga0105251_10035058 3300009011 Bacteria 2478
26 Ga0105251_10041243 3300009011 Bacteria 2247
27 Ga0105251_10074483 3300009011 Bacteria 1577
28 Ga0105251_10080985 3300009011 Bacteria 1501
29 Ga0105251_10162144 3300009011 Bacteria 1008
30 Ga0105244_10000016 3300009036 Bacteria 255363
31 Ga0105244_10001221 3300009036 Bacteria 21066
32 Ga0105250_10017217 3300009092 Bacteria 2938
33 Ga0105250_10036208 3300009092 Bacteria 1981
34 Ga0105250_10050873 3300009092 Bacteria 1663
35 Ga0114129_10000100 3300009147 Bacteria 84154
36 Ga0105243_10000341 3300009148 Bacteria 50977
37 Ga0157373_10020804 3300013100 Bacteria 4763
38 Ga0157373_10025223 3300013100 Bacteria 4302
39 Ga0157373_10055693 3300013100 Bacteria 2809
40 Ga0157371_10003523 3300013102 Bacteria 14128
41 Ga0157371_10025371 3300013102 Bacteria 4320
42 Ga0157371_10040647 3300013102 Bacteria 3321
43 Ga0157370_10041337 3300013104 Bacteria 4449
44 Ga0157369_10010316 3300013105 Bacteria 10656
45 Ga0163162_10486258 3300013306 Bacteria 1366
46 Ga0157375_10000392 3300013308 Bacteria 39867
47 Ga0182008_10000181 3300014497 Bacteria 49572
48 Ga0182008_10008263 3300014497 Bacteria 5690
49 Ga0182008_10044500 3300014497 Bacteria 2208
50 Ga0182007_10005019 3300015262 Bacteria 5879
51 Ga0183360_10001 3300015689 Bacteria 3943671
52 Ga0163161_10150551 3300017792 Bacteria 1768
53 Ga0163161_10271902 3300017792 Bacteria 1326
54 Ga0209760_100068 3300025207 Bacteria 85849
55 Ga0207427_100007 3300025231 Bacteria 746220
56 Ga0209437_100006 3300025233 Bacteria 1042724
57 Ga0209233_1000086 3300025261 Bacteria 331687
58 Ga0209233_1011143 3300025261 Bacteria 2658
59 Ga0209565_1000001 3300025263 Bacteria 2950419
60 Ga0209673_1000001 3300025273 Bacteria 3176258
61 Ga0209675_1000001 3300025291 Bacteria 2950293
62 Ga0209676_1000006 3300025292 Bacteria 1039588
63 Ga0209564_1000001 3300025295 Bacteria 3176258
64 Ga0209050_1000070 3300025298 Bacteria 296366
65 Ga0209256_1000002 3300025299 Bacteria 1906740
66 Ga0209051_1000093 3300025303 Bacteria 169092
67 Ga0207696_1000018 3300025711 Bacteria 478605
68 Ga0207696_1000123 3300025711 Bacteria 141297
69 Ga0207696_1020690 3300025711 Bacteria 2117
70 Ga0207655_1000027 3300025728 Bacteria 444552
71 Ga0207655_1001378 3300025728 Bacteria 22725
72 Ga0207713_1000097 3300025735 Bacteria 144844
73 Ga0207713_1008498 3300025735 Bacteria 5906
74 Ga0207713_1031127 3300025735 Bacteria 2364
75 Ga0207713_1034638 3300025735 Bacteria 2190
76 Ga0207713_1038000 3300025735 Bacteria 2047
77 Ga0207649_10323349 3300025920 Bacteria 1134
78 Ga0207650_10000194 3300025925 Bacteria 70396
79 Ga0207679_10378420 3300025945 Bacteria 1240
80 Ga0439436_0000460 3300041404 Bacteria 10449
81 Ga0439438_007139 3300041405 Bacteria 3851
82 Ga0439438_020545 3300041405 Bacteria 1852
83 Ga0439447_002956 3300041407 Bacteria 6090
84 Ga0439447_004413 3300041407 Bacteria 4845
85 Ga0439466_0000287 3300041411 Bacteria 19657
86 Ga0439466_0016131 3300041411 Bacteria 2704
87 Ga0439466_0028595 3300041411 Bacteria 1923
88 Ga0439437_000212 3300042000 Bacteria 5157
89 Ga0439432_000694 3300042006 Bacteria 12583
90 Ga0439451_004661 3300042009 Bacteria 2790
91 Ga0439452_003557 3300042010 Bacteria 5430
92 Ga0439452_013888 3300042010 Bacteria 2250
93 Ga0439455_0015550 3300042012 Bacteria 1750
94 Ga0439456_001726 3300042013 Bacteria 4408
95 Ga0450911_000026 3300042115 Bacteria 82955
96 Ga0450911_004581 3300042115 Bacteria 2248
97 Ga0450911_006397 3300042115 Bacteria 1758
98 Ga0450919_005790 3300042121 Bacteria 1476
99 Ga0450890_000095 3300042127 Bacteria 14643
100 Ga0450903_000858 3300042138 Bacteria 5890
101 Ga0450903_006160 3300042138 Bacteria 2001
102 Ga0450904_000063 3300042139 Bacteria 23972
103 Ga0450905_026757 3300042142 Bacteria 873
104 Ga0450906_006171 3300042145 Bacteria 2427
105 Ga0450907_017278 3300042146 Bacteria 1203
106 Ga0439446_0020892 3300042156 Bacteria 1847
107 Ga0450909_005584 3300042185 Bacteria 1809
108 Ga0450918_011176 3300042531 Bacteria 1565
109 Ga0450893_0000210 3300042532 Bacteria 7760
110 Ga0439440_0000835 3300042993 Bacteria 5356
111 Ga0495617_025141 3300046452 Bacteria 2008
112 Ga0495627_003285 3300046453 Bacteria 7234
113 Ga0495627_029073 3300046453 Bacteria 1761
114 Ga0495590_0004595 3300046457 Bacteria 5550
115 Ga0495590_0015496 3300046457 Bacteria 2765
116 Ga0495591_000297 3300046458 Bacteria 45383
117 Ga0495591_000657 3300046458 Bacteria 25568
118 Ga0495591_000995 3300046458 Bacteria 19252
119 Ga0495638_0033822 3300046460 Bacteria 3266
120 Ga0495638_0055171 3300046460 Bacteria 2468
121 Ga0495638_0055274 3300046460 Bacteria 2465
122 Ga0495638_0279860 3300046460 Bacteria 907
123 Ga0495650_0013346 3300046471 Bacteria 4349
124 Ga0495585_0001351 3300046492 Bacteria 19438
125 Ga0495596_0018019 3300046500 Bacteria 2915
126 Ga0495607_0009809 3300046501 Bacteria 6464
127 Ga0495607_0080947 3300046501 Bacteria 1784
128 Ga0495607_0129688 3300046501 Bacteria 1313
129 Ga0495606_0000501 3300046507 Bacteria 63726
130 Ga0495606_0001659 3300046507 Bacteria 28923
131 Ga0495610_0001166 3300046512 Bacteria 23910
132 Ga0495610_0006902 3300046512 Bacteria 7690
133 Ga0495610_0040353 3300046512 Bacteria 2353
134 Ga0495620_0005933 3300046515 Bacteria 6771
135 Ga0495620_0045992 3300046515 Bacteria 1887
136 Ga0495632_0001217 3300046519 Bacteria 21823
137 Ga0495648_0000587 3300046524 Bacteria 38941
138 Ga0495648_0001327 3300046524 Bacteria 24541
139 Ga0495648_0052768 3300046524 Bacteria 2467
140 Ga0495654_0000393 3300046530 Bacteria 37516
141 Ga0495654_0003072 3300046530 Bacteria 10391
142 Ga0495633_0104597 3300046558 Bacteria 1313
143 Ga0495668_0001921 3300046616 Bacteria 18473
144 Ga0495668_0002022 3300046616 Bacteria 17707
145 Ga0495634_0104885 3300046642 Bacteria 1823
146 Ga0495625_0059258 3300046660 Bacteria 2717
147 Ga0495661_0000469 3300046665 Bacteria 42710
148 Ga0495661_0000639 3300046665 Bacteria 35508
149 Ga0495671_0023766 3300046692 Bacteria 3200
150 Ga0495649_0002831 3300046694 Bacteria 12039
151 Ga0495649_0015564 3300046694 Bacteria 4327
152 Ga0495672_0001711 3300047320 Bacteria 21255
153 Ga0495679_000425 3300047446 Bacteria 31237
154 Ga0495679_004318 3300047446 Bacteria 6590
155 Ga0495679_008167 3300047446 Bacteria 4282
156 Ga0495681_0001457 3300047470 Bacteria 17704
157 Ga0495681_0001904 3300047470 Bacteria 15321
158 Ga0495681_0014472 3300047470 Bacteria 4519
159 Ga0495681_0016426 3300047470 Bacteria 4150
160 Ga0495681_0048210 3300047470 Bacteria 2021
161 Ga0495626_0012756 3300048091 Bacteria 4392
162 Ga0496110_0198317 3300048913 Bacteria 1823
163 Ga0496113_0651690 3300048916 Bacteria 842
164 Ga0496116_0000560 3300048919 Bacteria 49704
165 Ga0496117_0000100 3300048920 Bacteria 194307
166 Ga0496117_0000792 3300048920 Bacteria 49586
167 Ga0496117_0043562 3300048920 Bacteria 3261
168 Ga0496117_0044985 3300048920 Bacteria 3193
169 Ga0496118_0014516 3300048921 Bacteria 7367
170 Ga0496118_0055551 3300048921 Bacteria 2986
171 Ga0496118_0086447 3300048921 Bacteria 2178
172 Ga0496119_0000189 3300048922 Bacteria 87262
173 Ga0496119_0024720 3300048922 Bacteria 4217
174 Ga0496120_0003791 3300048923 Bacteria 13329
175 Ga0496120_0009234 3300048923 Bacteria 7023
176 Ga0496121_0000036 3300048924 Bacteria 362643
177 Ga0496121_0001037 3300048924 Bacteria 49625
178 Ga0496121_0069736 3300048924 Bacteria 2835
179 Ga0496122_0003856 3300048925 Bacteria 19248
180 Ga0496122_0052135 3300048925 Bacteria 3101
181 Ga0496122_0067521 3300048925 Bacteria 2575
182 Ga0496122_0085112 3300048925 Bacteria 2183
183 Ga0496123_0012053 3300048926 Bacteria 7412
184 Ga0496123_0048802 3300048926 Bacteria 2844
185 Ga0496124_0001263 3300048927 Bacteria 38490
186 Ga0496124_0014482 3300048927 Bacteria 7625
187 Ga0496124_0068456 3300048927 Bacteria 2950
188 Ga0496124_0091624 3300048927 Bacteria 2476
189 Ga0496125_0001051 3300048928 Bacteria 42648
190 Ga0496125_0188830 3300048928 Bacteria 1363
191 Ga0496126_0116563 3300048929 Bacteria 2321
192 Ga0495678_053482 3300049459 Bacteria 1550
193 Ga0495682_0002600 3300049460 Bacteria 8472
194 Ga0495682_0005732 3300049460 Bacteria 5121
195 Ga0495682_0007858 3300049460 Bacteria 4218
196 nmdc:mga03683_45320_c2 3300050489 Bacteria 1164
197 nmdc:mga05p37_8369_c1 3300050507 Bacteria 12231
198 nmdc:mga09592_136997_c1 3300050508 Bacteria 2109
199 nmdc:mga06r32_8603_c1 3300050510 Bacteria 9202
200 Ga0500634_0002615 3300053161 Bacteria 7661
201 Ga0590074_007022 3300059423 Bacteria 1871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041407 Ga0439447_002956 Ga0439447_002956_4700_5776 254
2 3300046616 Ga0495668_0002022 Ga0495668_0002022_6151_7227 254
3 3300003771 Ga0055526_1000006 Ga0055526_1000006191 257
4 3300003773 Ga0055537_1000003 Ga0055537_100000335 257
5 3300003775 Ga0055524_1000009 Ga0055524_100000935 257
6 3300003784 Ga0055534_1000004 Ga0055534_100000435 257
7 3300003790 Ga0055528_1000003 Ga0055528_100000368 257
8 3300025263 Ga0209565_1000001 Ga0209565_10000012355 257
9 3300025273 Ga0209673_1000001 Ga0209673_10000012355 257
10 3300025291 Ga0209675_1000001 Ga0209675_1000001175 257
11 3300025295 Ga0209564_1000001 Ga0209564_1000001337 257
12 3300025299 Ga0209256_1000002 Ga0209256_10000021213 257
13 3300048924 Ga0496121_0000036 Ga0496121_0000036_52467_53372 258
14 3300046460 Ga0495638_0279860 Ga0495638_0279860_101_880 259
15 3300015689 Ga0183360_10001 Ga0183360_100011428 260
16 3300042115 Ga0450911_006397 Ga0450911_006397_11_793 260
17 3300042138 Ga0450903_000858 Ga0450903_000858_87_869 260
18 3300042146 Ga0450907_017278 Ga0450907_017278_405_1187 260
19 3300042531 Ga0450918_011176 Ga0450918_011176_717_1499 260
20 3300009147 Ga0114129_10000100 Ga0114129_1000010070 262
21 3300050507 nmdc:mga05p37_8369_c1 nmdc:mga05p37_8369_c1_8773_9618 262
22 3300050508 nmdc:mga09592_136997_c1 nmdc:mga09592_136997_c1_139_984 262
23 3300050510 nmdc:mga06r32_8603_c1 nmdc:mga06r32_8603_c1_1317_2162 262
24 3300046460 Ga0495638_0055274 Ga0495638_0055274_1099_1989 264
25 3300049460 Ga0495682_0007858 Ga0495682_0007858_1488_2378 264
26 3300042142 Ga0450905_026757 Ga0450905_026757_42_845 266
27 3300048916 Ga0496113_0651690 Ga0496113_0651690_26_832 268
28 3300025261 Ga0209233_1011143 Ga0209233_10111432 269
29 3300006353 Ga0075370_10182722 Ga0075370_101827222 270
30 3300006847 Ga0075431_100002602 Ga0075431_1000026023 271
31 3300006844 Ga0075428_100003455 Ga0075428_1000034558 274
32 3300006846 Ga0075430_100002570 Ga0075430_1000025702 274
33 3300006880 Ga0075429_100000318 Ga0075429_10000031838 274
34 3300042000 Ga0439437_000212 Ga0439437_000212_2687_3589 276
35 3300042012 Ga0439455_0015550 Ga0439455_0015550_95_997 276
36 3300042532 Ga0450893_0000210 Ga0450893_0000210_5539_6441 276
37 3300046515 Ga0495620_0045992 Ga0495620_0045992_535_1398 276
38 3300042115 Ga0450911_000026 Ga0450911_000026_11743_12645 277
39 3300059423 Ga0590074_007022 Ga0590074_007022_796_1638 277
40 3300006177 Ga0075362_10152876 Ga0075362_101528762 279
41 3300050489 nmdc:mga03683_45320_c2 nmdc:mga03683_45320_c2_187_1086 279
42 3300006058 Ga0075432_10020419 Ga0075432_100204192 280
43 3300042138 Ga0450903_006160 Ga0450903_006160_705_1607 280
44 3300046558 Ga0495633_0104597 Ga0495633_0104597_82_981 280
45 3300047320 Ga0495672_0001711 Ga0495672_0001711_16889_17788 280
46 3300047446 Ga0495679_000425 Ga0495679_000425_19628_20491 282
47 3300047470 Ga0495681_0016426 Ga0495681_0016426_2431_3297 282
48 iso_pu_bacteria 2643221571 2643871861 283
49 iso_pu_bacteria 2834028612 2834031501 283
50 iso_pu_bacteria 2931390751 2931395353 283
51 iso_pu_bacteria 2946006987 2946008072 283
52 iso_pu_bacteria 2947233263 2947233331 283
53 iso_pu_bacteria 8055817908 8055822821 283
54 iso_pu_bacteria 8056131705 8056136245 283
55 iso_pu_bacteria 8056148874 8056153745 283
56 3300048921 Ga0496118_0014516 Ga0496118_0014516_1482_2360 285
57 3300005344 Ga0070661_100160372 Ga0070661_1001603722 287
58 3300005539 Ga0068853_100007251 Ga0068853_1000072516 287
59 3300009036 Ga0105244_10001221 Ga0105244_100012213 287
60 3300013100 Ga0157373_10020804 Ga0157373_100208044 287
61 3300013100 Ga0157373_10025223 Ga0157373_100252233 287
62 3300013102 Ga0157371_10025371 Ga0157371_100253713 287
63 3300013104 Ga0157370_10041337 Ga0157370_100413373 287
64 3300013105 Ga0157369_10010316 Ga0157369_100103163 287
65 3300013308 Ga0157375_10000392 Ga0157375_1000039221 287
66 3300014497 Ga0182008_10008263 Ga0182008_100082633 287
67 3300014497 Ga0182008_10044500 Ga0182008_100445003 287
68 3300015262 Ga0182007_10005019 Ga0182007_100050194 287
69 3300017792 Ga0163161_10150551 Ga0163161_101505513 287
70 3300025728 Ga0207655_1001378 Ga0207655_100137825 287
71 3300025920 Ga0207649_10323349 Ga0207649_103233491 287
72 3300025925 Ga0207650_10000194 Ga0207650_1000019433 287
73 3300025945 Ga0207679_10378420 Ga0207679_103784201 287
74 3300042115 Ga0450911_004581 Ga0450911_004581_820_1683 287
75 3300046453 Ga0495627_029073 Ga0495627_029073_658_1521 287
76 3300046501 Ga0495607_0080947 Ga0495607_0080947_92_955 287
77 3300046512 Ga0495610_0006902 Ga0495610_0006902_1774_2637 287
78 3300046512 Ga0495610_0040353 Ga0495610_0040353_749_1612 287
79 3300046524 Ga0495648_0052768 Ga0495648_0052768_811_1674 287
80 3300046530 Ga0495654_0003072 Ga0495654_0003072_8075_8938 287
81 3300046665 Ga0495661_0000639 Ga0495661_0000639_17862_18725 287
82 3300048920 Ga0496117_0044985 Ga0496117_0044985_1315_2178 287
83 3300048921 Ga0496118_0055551 Ga0496118_0055551_1127_1990 287
84 3300048925 Ga0496122_0052135 Ga0496122_0052135_1237_2100 287
85 3300048925 Ga0496122_0085112 Ga0496122_0085112_746_1609 287
86 3300053161 Ga0500634_0002615 Ga0500634_0002615_4225_5088 287
87 iso_pu_bacteria 2511231010 2511287875 288
88 iso_pu_bacteria 2511231023 2511370773 288
89 iso_pu_bacteria 8056137416 8056139544 288
90 iso_pu_bacteria 8056172158 8056172970 288
91 iso_pu_bacteria 8056120720 8056123730 290
92 3300046515 Ga0495620_0005933 Ga0495620_0005933_2027_2944 291
93 iso_pu_bacteria 2511231006 2511265221 291
94 iso_pu_bacteria 2511231022 2511363072 291
95 iso_pu_bacteria 2512047018 2512329473 291
96 iso_pu_bacteria 2554235132 2554817065 291
97 iso_pu_bacteria 2582580891 2583794044 291
98 iso_pu_bacteria 2597489887 2597859645 291
99 iso_pu_bacteria 2599185185 2599482475 291
100 iso_pu_bacteria 2599185257 2599803804 291
101 iso_pu_bacteria 2600254931 2600364548 291
102 iso_pu_bacteria 2606217733 2608379607 291
103 iso_pu_bacteria 2671180172 2671770626 291
104 iso_pu_bacteria 2740892503 2743739174 291
105 iso_pu_bacteria 2806310737 2807408711 291
106 iso_pu_bacteria 2806310745 2807457041 291
107 iso_pu_bacteria 2923153595 2923158256 291
108 iso_pu_bacteria 2984286254 2984287915 291
109 iso_pu_bacteria 3007395558 3007397551 291
110 iso_pu_bacteria 8015687852 8015692353 291
111 iso_pu_bacteria 8055770955 8055775563 291
112 iso_pu_bacteria 8055878733 8055882787 291
113 iso_pu_bacteria 8056115690 8056118918 291
114 3300009011 Ga0105251_10004482 Ga0105251_100044825 292
115 3300009011 Ga0105251_10035058 Ga0105251_100350581 292
116 3300009011 Ga0105251_10041243 Ga0105251_100412432 292
117 3300009011 Ga0105251_10074483 Ga0105251_100744832 292
118 3300009011 Ga0105251_10080985 Ga0105251_100809853 292
119 3300009011 Ga0105251_10162144 Ga0105251_101621441 292
120 3300009036 Ga0105244_10000016 Ga0105244_10000016182 292
121 3300009092 Ga0105250_10036208 Ga0105250_100362082 292
122 3300009092 Ga0105250_10050873 Ga0105250_100508731 292
123 3300013306 Ga0163162_10486258 Ga0163162_104862582 292
124 3300017792 Ga0163161_10271902 Ga0163161_102719022 292
125 3300025711 Ga0207696_1020690 Ga0207696_10206902 292
126 3300025728 Ga0207655_1000027 Ga0207655_100002786 292
127 3300025735 Ga0207713_1008498 Ga0207713_10084983 292
128 3300025735 Ga0207713_1034638 Ga0207713_10346381 292
129 3300025735 Ga0207713_1038000 Ga0207713_10380003 292
130 3300046452 Ga0495617_025141 Ga0495617_025141_279_1169 292
131 3300046457 Ga0495590_0004595 Ga0495590_0004595_2758_3636 292
132 3300046457 Ga0495590_0015496 Ga0495590_0015496_919_1809 292
133 3300046458 Ga0495591_000297 Ga0495591_000297_14882_15772 292
134 3300046458 Ga0495591_000995 Ga0495591_000995_1916_2806 292
135 3300046460 Ga0495638_0033822 Ga0495638_0033822_1615_2505 292
136 3300046460 Ga0495638_0055171 Ga0495638_0055171_785_1675 292
137 3300046471 Ga0495650_0013346 Ga0495650_0013346_1569_2447 292
138 3300046492 Ga0495585_0001351 Ga0495585_0001351_2028_2918 292
139 3300046500 Ga0495596_0018019 Ga0495596_0018019_1315_2193 292
140 3300046507 Ga0495606_0001659 Ga0495606_0001659_16573_17463 292
141 3300046512 Ga0495610_0001166 Ga0495610_0001166_17993_18883 292
142 3300046524 Ga0495648_0001327 Ga0495648_0001327_12757_13635 292
143 3300046530 Ga0495654_0000393 Ga0495654_0000393_16900_17778 292
144 3300046616 Ga0495668_0001921 Ga0495668_0001921_15587_16477 292
145 3300046642 Ga0495634_0104885 Ga0495634_0104885_206_1096 292
146 3300046660 Ga0495625_0059258 Ga0495625_0059258_1425_2315 292
147 3300046694 Ga0495649_0015564 Ga0495649_0015564_1919_2809 292
148 3300047446 Ga0495679_004318 Ga0495679_004318_1908_2798 292
149 3300047470 Ga0495681_0001457 Ga0495681_0001457_3139_4017 292
150 3300047470 Ga0495681_0048210 Ga0495681_0048210_523_1413 292
151 3300048091 Ga0495626_0012756 Ga0495626_0012756_1507_2397 292
152 3300048913 Ga0496110_0198317 Ga0496110_0198317_182_1072 292
153 3300048920 Ga0496117_0000100 Ga0496117_0000100_44779_45657 292
154 3300048920 Ga0496117_0043562 Ga0496117_0043562_855_1745 292
155 3300048922 Ga0496119_0024720 Ga0496119_0024720_2198_3076 292
156 3300048923 Ga0496120_0003791 Ga0496120_0003791_2992_3870 292
157 3300048924 Ga0496121_0069736 Ga0496121_0069736_921_1802 292
158 3300048925 Ga0496122_0067521 Ga0496122_0067521_886_1764 292
159 3300048926 Ga0496123_0048802 Ga0496123_0048802_997_1875 292
160 3300048927 Ga0496124_0001263 Ga0496124_0001263_17195_18073 292
161 3300048927 Ga0496124_0091624 Ga0496124_0091624_827_1717 292
162 3300048928 Ga0496125_0001051 Ga0496125_0001051_20791_21669 292
163 3300048928 Ga0496125_0188830 Ga0496125_0188830_184_1074 292
164 3300048929 Ga0496126_0116563 Ga0496126_0116563_353_1261 292
165 3300049459 Ga0495678_053482 Ga0495678_053482_572_1462 292
166 3300049460 Ga0495682_0005732 Ga0495682_0005732_1804_2682 292
167 3300046453 Ga0495627_003285 Ga0495627_003285_3466_4395 294
168 3300046458 Ga0495591_000657 Ga0495591_000657_3526_4455 294
169 3300046501 Ga0495607_0009809 Ga0495607_0009809_5311_6240 294
170 3300046501 Ga0495607_0129688 Ga0495607_0129688_160_1089 294
171 3300046507 Ga0495606_0000501 Ga0495606_0000501_61328_62245 294
172 3300046519 Ga0495632_0001217 Ga0495632_0001217_17564_18493 294
173 3300046665 Ga0495661_0000469 Ga0495661_0000469_20677_21606 294
174 3300046694 Ga0495649_0002831 Ga0495649_0002831_1476_2393 294
175 3300047470 Ga0495681_0014472 Ga0495681_0014472_2236_3165 294
176 3300048927 Ga0496124_0014482 Ga0496124_0014482_1274_2164 294
177 iso_pu_bacteria 2885080285 2885084717 294
178 3300003781 Ga0055536_1000048 Ga0055536_100004820 295
179 3300003791 Ga0055530_10000105 Ga0055530_1000010520 295
180 3300003792 Ga0055540_1000652 Ga0055540_10006529 295
181 3300006051 Ga0075364_10079283 Ga0075364_100792832 295
182 3300025292 Ga0209676_1000006 Ga0209676_1000006388 295
183 3300025298 Ga0209050_1000070 Ga0209050_1000070131 295
184 3300025303 Ga0209051_1000093 Ga0209051_100009338 295
185 3300025711 Ga0207696_1000018 Ga0207696_1000018156 295
186 3300025735 Ga0207713_1031127 Ga0207713_10311272 295
187 3300041405 Ga0439438_020545 Ga0439438_020545_205_1104 295
188 3300041411 Ga0439466_0000287 Ga0439466_0000287_2877_3764 295
189 3300041411 Ga0439466_0028595 Ga0439466_0028595_820_1719 295
190 3300042006 Ga0439432_000694 Ga0439432_000694_205_1104 295
191 3300042009 Ga0439451_004661 Ga0439451_004661_1687_2586 295
192 3300042010 Ga0439452_013888 Ga0439452_013888_1275_2174 295
193 3300042013 Ga0439456_001726 Ga0439456_001726_820_1719 295
194 3300042121 Ga0450919_005790 Ga0450919_005790_394_1293 295
195 3300042127 Ga0450890_000095 Ga0450890_000095_2235_3134 295
196 3300042145 Ga0450906_006171 Ga0450906_006171_1324_2223 295
197 3300042156 Ga0439446_0020892 Ga0439446_0020892_11_898 295
198 3300042185 Ga0450909_005584 Ga0450909_005584_98_997 295
199 3300042993 Ga0439440_0000835 Ga0439440_0000835_2372_3271 295
200 3300046524 Ga0495648_0000587 Ga0495648_0000587_11089_11976 295
201 3300046692 Ga0495671_0023766 Ga0495671_0023766_855_1742 295
202 3300047470 Ga0495681_0001904 Ga0495681_0001904_4269_5156 295
203 iso_pu_bacteria 2941489479 2941490232 295
204 3300048922 Ga0496119_0000189 Ga0496119_0000189_81675_82568 296
205 3300048923 Ga0496120_0009234 Ga0496120_0009234_1895_2788 296
206 3300041404 Ga0439436_0000460 Ga0439436_0000460_1240_2136 297
207 3300041405 Ga0439438_007139 Ga0439438_007139_970_1866 297
208 3300041407 Ga0439447_004413 Ga0439447_004413_2973_3869 297
209 3300041411 Ga0439466_0016131 Ga0439466_0016131_837_1733 297
210 3300042010 Ga0439452_003557 Ga0439452_003557_3880_4776 297
211 iso_pu_bacteria 2945961074 2945965447 297
212 3300009011 Ga0105251_10000433 Ga0105251_100004331 298
213 3300025711 Ga0207696_1000123 Ga0207696_100012398 298
214 3300025735 Ga0207713_1000097 Ga0207713_100009740 298
215 3300048927 Ga0496124_0068456 Ga0496124_0068456_277_1230 298
216 3300042139 Ga0450904_000063 Ga0450904_000063_11565_12467 299
217 iso_pu_bacteria 2554235341 2555671557 299
218 iso_pu_bacteria 2599185160 2599354285 299
219 iso_pu_bacteria 2599185161 2599360001 299
220 iso_pu_bacteria 2599185162 2599366323 299
221 iso_pu_bacteria 2599185163 2599373113 299
222 iso_pu_bacteria 2599185164 2599379393 299
223 iso_pu_bacteria 2599185165 2599385629 299
224 iso_pu_bacteria 2599185166 2599391972 299
225 iso_pu_bacteria 2599185168 2599403738 299
226 iso_pu_bacteria 2599185181 2599461119 299
227 iso_pu_bacteria 2599185182 2599469661 299
228 iso_pu_bacteria 2599185186 2599490139 299
229 iso_pu_bacteria 2599185356 2600213734 299
230 iso_pu_bacteria 2600255313 2601773902 299
231 iso_pu_bacteria 2667528171 2671096866 299
232 iso_pu_bacteria 2818991464 2819701959 299
233 iso_pu_bacteria 2844665904 2844672084 299
234 iso_pu_bacteria 2917070673 2917075427 299
235 iso_pu_bacteria 2935353572 2935356413 299
236 iso_pu_bacteria 3007872151 3007873028 299
237 iso_pu_bacteria 637000220 637321878 299
238 iso_pu_bacteria 8019769354 8019774971 299
239 iso_pu_bacteria 8057798959 8057804422 299
240 3300009092 Ga0105250_10017217 Ga0105250_100172174 300
241 3300014497 Ga0182008_10000181 Ga0182008_1000018118 300
242 3300048924 Ga0496121_0001037 Ga0496121_0001037_15028_15930 300
243 3300047446 Ga0495679_008167 Ga0495679_008167_2294_3223 301
244 3300002737 JGI25162J39368_1000073 JGI25162J39368_100007318 303
245 3300002771 JGI25163J39215_1000241 JGI25163J39215_10002415 303
246 3300002772 JGI25164J39214_1000052 JGI25164J39214_100005218 303
247 3300003214 JGI25165J46597_1000137 JGI25165J46597_100013718 303
248 3300009148 Ga0105243_10000341 Ga0105243_1000034113 303
249 3300013100 Ga0157373_10055693 Ga0157373_100556931 303
250 3300013102 Ga0157371_10003523 Ga0157371_1000352315 303
251 3300013102 Ga0157371_10040647 Ga0157371_100406472 303
252 3300025207 Ga0209760_100068 Ga0209760_10006857 303
253 3300025231 Ga0207427_100007 Ga0207427_100007141 303
254 3300025233 Ga0209437_100006 Ga0209437_100006407 303
255 3300025261 Ga0209233_1000086 Ga0209233_1000086141 303
256 3300048919 Ga0496116_0000560 Ga0496116_0000560_33718_34629 303
257 3300048920 Ga0496117_0000792 Ga0496117_0000792_15059_15970 303
258 3300048921 Ga0496118_0086447 Ga0496118_0086447_505_1416 303
259 3300048925 Ga0496122_0003856 Ga0496122_0003856_3328_4239 303
260 3300048926 Ga0496123_0012053 Ga0496123_0012053_3689_4600 303
261 3300049460 Ga0495682_0002600 Ga0495682_0002600_6449_7399 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

105

239

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.2654 65 207
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.2312 65 207
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.2022 1 197
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.1847 10 243
7vlu-assembly1.cif.gz_A structure of sur2a in complex with mg-atp/adp and p1075 0.174 8 199
ID Description Score Start End Superfamily
af_Q9VJW8_268_464_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3048 5 190 1.20.1250.20
af_O49660_262_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2837 44 190 1.20.1250.20
af_A0A0R0GH56_2_168_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.2678 90 190 1.10.1520.10
af_Q9VJW8_268_464_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2527 5 190 1.20.1250.20
af_O49660_262_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2248 44 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I0UD55-F1-model_v4 deleted 0.9881 110 293
AF-A0A2E9PKM9-F1-model_v4 Fatty acid hydroxylase 0.988 98 280 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A2M9F7J6-F1-model_v4 deleted 0.9852 2 280
AF-A0A259LTA3-F1-model_v4 Fatty acid hydroxylase 0.9849 2 281 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A3F2UX81-F1-model_v4 Sterol desaturase family protein 0.9849 49 282 GO:0005506
GO:0008610
GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.9 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map