F370561

General Info

Members Datasets Scaffolds Average Seq Length
261 169 522 263

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0109883|Ga0495603_0109883_218_1006
Length 255
Sequence MTQSDKAHAFKALHEGEPFVIPNPWDAGSARVLEALGFEALATTSSGFAFTLGRLDGGTTLDEVVEHTAALDAATGLPVAVDLENGYGAQPADAANAVVRAAAAGAVGGSIEDWDAERGLYEQAHAAERIHAVGFPFLLAGRAENHIRGNPDLDDTIARLQAYERAGADVLYAPGLRTVEEIRAACESVTKPVNVLALPGLTIAEIFAAGAQRVSVGGALTWVAMKAFADAAVVLRDTGDLSALAARLPLGDWLD

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 6.9
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0109883 3300046455 Bacteria 1609
2 Ga0070682_100029852 3300005337 Bacteria 3286
3 Ga0070682_100354688 3300005337 Bacteria 1095
4 Ga0070668_100147595 3300005347 Bacteria 1899
5 Ga0070674_100004862 3300005356 Bacteria 7702
6 Ga0070667_100019978 3300005367 Bacteria 5560
7 Ga0070703_10007048 3300005406 Bacteria 3152
8 Ga0070709_10288190 3300005434 Bacteria 1195
9 Ga0070714_100020304 3300005435 Bacteria 5423
10 Ga0070713_100045889 3300005436 Bacteria 3583
11 Ga0070713_100064287 3300005436 Bacteria 3079
12 Ga0070710_10056584 3300005437 Bacteria 2219
13 Ga0070705_100025782 3300005440 Bacteria 3191
14 Ga0070700_100089078 3300005441 Bacteria 2010
15 Ga0070694_100005605 3300005444 Bacteria 7610
16 Ga0070708_100759148 3300005445 Bacteria 912
17 Ga0070678_100243840 3300005456 Bacteria 1504
18 Ga0070681_10072267 3300005458 Bacteria 3413
19 Ga0068867_100146338 3300005459 Bacteria 1852
20 Ga0070685_10163235 3300005466 Bacteria 1422
21 Ga0070706_100006904 3300005467 Bacteria 10716
22 Ga0070706_100052290 3300005467 Bacteria 3770
23 Ga0070707_100005837 3300005468 Bacteria 11479
24 Ga0070707_100185942 3300005468 Bacteria 2026
25 Ga0070707_100301663 3300005468 Bacteria 1556
26 Ga0070684_100009565 3300005535 Bacteria 7637
27 Ga0070684_100083567 3300005535 Bacteria 2829
28 Ga0070697_100121629 3300005536 Bacteria 2184
29 Ga0070696_100067211 3300005546 Bacteria 2515
30 Ga0070665_100017302 3300005548 Bacteria 7235
31 Ga0070704_100017275 3300005549 Bacteria 4584
32 Ga0070704_100384563 3300005549 Bacteria 1193
33 Ga0070702_100006654 3300005615 Bacteria 5487
34 Ga0070702_100175004 3300005615 Bacteria 1399
35 Ga0070702_100428625 3300005615 Bacteria 954
36 Ga0068866_10127821 3300005718 Bacteria 1441
37 Ga0068870_10051203 3300005840 Bacteria 2185
38 Ga0068870_10207530 3300005840 Bacteria 1191
39 Ga0081538_10002868 3300005981 Bacteria 16477
40 Ga0081538_10019294 3300005981 Bacteria 5077
41 Ga0081540_1009279 3300005983 Bacteria 6785
42 Ga0081539_10007013 3300005985 Bacteria 10452
43 Ga0081539_10049163 3300005985 Bacteria 2395
44 Ga0070717_10054322 3300006028 Bacteria 3303
45 Ga0070715_10015830 3300006163 Bacteria 2820
46 Ga0097621_100192946 3300006237 Bacteria 1765
47 Ga0075428_100068465 3300006844 Bacteria 3883
48 Ga0075428_100230223 3300006844 Bacteria 2000
49 Ga0075428_100463934 3300006844 Bacteria 1356
50 Ga0075428_100602155 3300006844 Bacteria 1174
51 Ga0075430_100374647 3300006846 Bacteria 1175
52 Ga0075431_100018525 3300006847 Bacteria 7092
53 Ga0075431_100094672 3300006847 Bacteria 3083
54 Ga0075431_100587670 3300006847 Bacteria 1098
55 Ga0075434_100314444 3300006871 Bacteria 1587
56 Ga0075429_100454802 3300006880 Bacteria 1122
57 Ga0068865_100094214 3300006881 Bacteria 2179
58 Ga0068865_100335740 3300006881 Bacteria 1220
59 Ga0075436_100014416 3300006914 Bacteria 5412
60 Ga0111539_10009759 3300009094 Bacteria 12114
61 Ga0111539_10747513 3300009094 Unclassified 1138
62 Ga0111539_10866935 3300009094 Bacteria 1050
63 Ga0105245_10480809 3300009098 Bacteria 1255
64 Ga0105245_10486512 3300009098 Bacteria 1248
65 Ga0105247_10036939 3300009101 Bacteria 2979
66 Ga0114129_10167546 3300009147 Bacteria 2997
67 Ga0114129_10221208 3300009147 Unclassified 2554
68 Ga0114129_10390561 3300009147 Bacteria 1836
69 Ga0114129_10649596 3300009147 Bacteria 1362
70 Ga0105243_10195609 3300009148 Bacteria 1770
71 Ga0105243_10293609 3300009148 Bacteria 1470
72 Ga0105239_10226013 3300010375 Bacteria 2100
73 Ga0157320_1000866 3300012481 Unclassified 1369
74 Ga0157369_10018745 3300013105 Bacteria 7758
75 Ga0163162_10084283 3300013306 Bacteria 3254
76 Ga0163163_10140241 3300014325 Bacteria 2460
77 Ga0157377_10121918 3300014745 Bacteria 1581
78 Ga0207653_10000735 3300025885 Bacteria 11220
79 Ga0207688_10056001 3300025901 Bacteria 2214
80 Ga0207688_10075700 3300025901 Bacteria 1916
81 Ga0207680_10000179 3300025903 Bacteria 30919
82 Ga0207685_10041121 3300025905 Bacteria 1728
83 Ga0207699_10239403 3300025906 Bacteria 1246
84 Ga0207643_10013464 3300025908 Bacteria 4431
85 Ga0207684_10091500 3300025910 Bacteria 2593
86 Ga0207684_10128434 3300025910 Bacteria 2176
87 Ga0207707_10057980 3300025912 Bacteria 3370
88 Ga0207693_10007250 3300025915 Bacteria 9125
89 Ga0207693_10013459 3300025915 Bacteria 6596
90 Ga0207663_10018103 3300025916 Bacteria 3940
91 Ga0207662_10156339 3300025918 Bacteria 1454
92 Ga0207646_10062421 3300025922 Bacteria 3326
93 Ga0207700_10074676 3300025928 Bacteria 2624
94 Ga0207664_10129304 3300025929 Bacteria 2124
95 Ga0207690_10114893 3300025932 Bacteria 1945
96 Ga0207690_10152775 3300025932 Bacteria 1713
97 Ga0207709_10198439 3300025935 Bacteria 1431
98 Ga0207669_10129724 3300025937 Bacteria 1730
99 Ga0207665_10073309 3300025939 Bacteria 2341
100 Ga0207665_10190785 3300025939 Bacteria 1488
101 Ga0207689_10546781 3300025942 Bacteria 972
102 Ga0207679_10170101 3300025945 Bacteria 1793
103 Ga0207667_10152469 3300025949 Bacteria 2378
104 Ga0207668_10527088 3300025972 Bacteria 1020
105 Ga0207640_10218624 3300025981 Bacteria 1457
106 Ga0207658_10001445 3300025986 Bacteria 18520
107 Ga0207677_10201474 3300026023 Bacteria 1582
108 Ga0207708_10075262 3300026075 Bacteria 2588
109 Ga0207708_10096695 3300026075 Bacteria 2282
110 Ga0207702_10232832 3300026078 Bacteria 1722
111 Ga0207674_10876245 3300026116 Bacteria 865
112 Ga0207683_10005357 3300026121 Bacteria 10995
113 Ga0207683_10054216 3300026121 Bacteria 3516
114 Ga0207428_10073321 3300027907 Bacteria 2686
115 Ga0268266_10001487 3300028379 Bacteria 27807
116 Ga0307413_10062071 3300031824 Bacteria 2310
117 Ga0307413_10405712 3300031824 Bacteria 1069
118 Ga0307410_10091221 3300031852 Bacteria 2163
119 Ga0307410_10094571 3300031852 Bacteria 2129
120 Ga0307406_10032439 3300031901 Bacteria 3189
121 Ga0307407_10336397 3300031903 Bacteria 1064
122 Ga0307409_100268208 3300031995 Bacteria 1570
123 Ga0307409_100305062 3300031995 Bacteria 1483
124 Ga0307416_100008654 3300032002 Bacteria 6588
125 Ga0307411_10182546 3300032005 Bacteria 1594
126 Ga0307411_10632583 3300032005 Bacteria 924
127 Ga0307415_100010928 3300032126 Bacteria 5166
128 Ga0373930_0019688 3300034816 Unclassified 1308
129 Ga0373959_0001947 3300034820 Bacteria 3291
130 Ga0373929_0015508 3300035085 Unclassified 1482
131 Ga0373940_0020356 3300035088 Bacteria 1685
132 Ga0373949_0070185 3300035090 Bacteria 916
133 Ga0373952_0054852 3300035092 Bacteria 960
134 Ga0373939_0004230 3300035114 Bacteria 3389
135 Ga0373941_0006665 3300035115 Bacteria 2791
136 Ga0373960_0000888 3300035121 Bacteria 6348
137 Ga0373942_0013651 3300035207 Unclassified 1956
138 Ga0373961_0008578 3300035241 Bacteria 2487
139 Ga0373931_0012311 3300035691 Bacteria 4142
140 Ga0395899_0041978 3300037312 Bacteria 3416
141 Ga0395899_0046624 3300037312 Bacteria 3228
142 Ga0395899_0057026 3300037312 Bacteria 2885
143 Ga0395899_0069708 3300037312 Bacteria 2574
144 Ga0395900_0004398 3300037418 Bacteria 14943
145 Ga0395900_0022026 3300037418 Bacteria 6517
146 Ga0395900_0051112 3300037418 Bacteria 4258
147 Ga0395900_0095919 3300037418 Bacteria 3047
148 Ga0395900_0096987 3300037418 Bacteria 3029
149 Ga0395900_0163896 3300037418 Bacteria 2266
150 Ga0395900_0463764 3300037418 Bacteria 1221
151 Ga0395898_0002031 3300037466 Bacteria 25359
152 Ga0395898_0010640 3300037466 Bacteria 9609
153 Ga0395898_0056084 3300037466 Bacteria 3842
154 Ga0395898_0073310 3300037466 Bacteria 3307
155 Ga0395898_0170752 3300037466 Bacteria 2079
156 Ga0395898_0400731 3300037466 Bacteria 1308
157 Ga0395905_0026606 3300037471 Bacteria 5454
158 Ga0395905_0236629 3300037471 Bacteria 1707
159 Ga0395905_0383045 3300037471 Bacteria 1300
160 Ga0395901_0001363 3300038443 Bacteria 25559
161 Ga0395901_0006433 3300038443 Bacteria 11902
162 Ga0395901_0007341 3300038443 Bacteria 11124
163 Ga0395901_0029777 3300038443 Bacteria 5622
164 Ga0395901_0037324 3300038443 Bacteria 5025
165 Ga0395901_0088602 3300038443 Bacteria 3237
166 Ga0395901_0101596 3300038443 Bacteria 3017
167 Ga0395901_0109125 3300038443 Bacteria 2905
168 Ga0395901_0161855 3300038443 Bacteria 2350
169 Ga0395901_0167189 3300038443 Bacteria 2308
170 Ga0395901_0280598 3300038443 Bacteria 1731
171 Ga0451853_1308267 3300041512 Bacteria 4146
172 Ga0466966_0384745 3300044684 Bacteria 843
173 Ga0495603_0003631 3300046455 Bacteria 9177
174 Ga0495638_0019941 3300046460 Bacteria 4433
175 Ga0495628_0097100 3300046516 Bacteria 2276
176 Ga0495630_0029224 3300046517 Bacteria 4097
177 Ga0495587_0172571 3300046536 Bacteria 1228
178 Ga0495656_0193178 3300046615 Bacteria 1006
179 Ga0495588_0171996 3300046674 Unclassified 1145
180 Ga0495658_0037833 3300046683 Bacteria 2669
181 Ga0495613_0075921 3300046689 Bacteria 2446
182 Ga0495613_0170460 3300046689 Bacteria 1545
183 Ga0495674_0336923 3300047319 Bacteria 1226
184 Ga0495684_0082569 3300047471 Bacteria 2438
185 Ga0496102_0040691 3300048905 Bacteria 4206
186 Ga0496104_0040371 3300048907 Bacteria 4373
187 Ga0496105_0011378 3300048908 Bacteria 7029
188 Ga0496106_0039294 3300048909 Bacteria 3543
189 Ga0496106_0063628 3300048909 Bacteria 2804
190 Ga0496106_0237525 3300048909 Bacteria 1456
191 Ga0496107_0081096 3300048910 Bacteria 2366
192 Ga0496107_0399399 3300048910 Bacteria 1022
193 Ga0496108_0047270 3300048911 Bacteria 3597
194 Ga0496109_0034435 3300048912 Bacteria 4560
195 Ga0496109_0143303 3300048912 Bacteria 2235
196 Ga0496109_0277420 3300048912 Bacteria 1579
197 Ga0496109_0349444 3300048912 Bacteria 1397
198 Ga0496110_0325527 3300048913 Bacteria 1400
199 Ga0496112_0013121 3300048915 Bacteria 7646
200 Ga0496112_0073431 3300048915 Bacteria 3381
201 Ga0496114_0007464 3300048917 Bacteria 8645
202 Ga0496115_0006407 3300048918 Bacteria 8623
203 Ga0496124_0240304 3300048927 Bacteria 1347
204 Ga0496126_0038743 3300048929 Bacteria 4431
205 Ga0501031_0010111 3300049568 Bacteria 6148
206 Ga0501031_0036323 3300049568 Bacteria 3213
207 Ga0501036_0017343 3300049572 Bacteria 6018
208 Ga0501036_0156253 3300049572 Bacteria 1923
209 Ga0501037_0031509 3300049573 Bacteria 3914
210 Ga0501038_0017008 3300049574 Bacteria 6580
211 Ga0501039_0033948 3300049575 Bacteria 3936
212 Ga0501039_0087736 3300049575 Bacteria 2423
213 Ga0501040_0095012 3300049576 Bacteria 2074
214 Ga0501041_0047262 3300049577 Bacteria 2619
215 Ga0501042_0173921 3300049578 Bacteria 1553
216 Ga0501043_0231952 3300049579 Bacteria 1425
217 Ga0501046_0021645 3300049580 Bacteria 5304
218 Ga0501046_0066920 3300049580 Bacteria 2798
219 Ga0501048_0085860 3300049582 Bacteria 2219
220 Ga0501048_0134652 3300049582 Bacteria 1746
221 Ga0501068_0015918 3300049584 Bacteria 4330
222 Ga0501069_0012945 3300049585 Bacteria 4442
223 Ga0501070_0027085 3300049586 Bacteria 4808
224 Ga0501070_0233482 3300049586 Bacteria 1507
225 Ga0501071_0033669 3300049587 Bacteria 3640
226 Ga0501074_0049595 3300049590 Bacteria 3031
227 Ga0501075_0036121 3300049591 Bacteria 3687
228 Ga0501076_0107626 3300049592 Bacteria 2251
229 Ga0501077_0015109 3300049593 Bacteria 4855
230 Ga0501077_0122767 3300049593 Bacteria 1646
231 Ga0501080_0056403 3300049742 Bacteria 3658
232 Ga0501081_0071199 3300049743 Bacteria 2423
233 Ga0501081_0101790 3300049743 Bacteria 2031
234 Ga0501081_0215230 3300049743 Bacteria 1396
235 Ga0501083_0018511 3300049744 Bacteria 4853
236 Ga0501035_0045553 3300049822 Bacteria 3946
237 Ga0501044_0037066 3300049823 Bacteria 5098
238 Ga0501045_0026954 3300049824 Bacteria 4136
239 Ga0501045_0049827 3300049824 Bacteria 3054
240 Ga0501045_0072486 3300049824 Bacteria 2536
241 nmdc:mga03n38_248018_c1 3300050490 Bacteria 939
242 nmdc:mga05p37_225595_c1 3300050507 Bacteria 2259
243 nmdc:mga05p37_286266_c1 3300050507 Unclassified 1963
244 nmdc:mga05p37_43380_c1 3300050507 Bacteria 5533
245 nmdc:mga05p37_852235_c1 3300050507 Bacteria 989
246 nmdc:mga09592_257955_c1 3300050508 Unclassified 1511
247 nmdc:mga06r32_124037_c1 3300050510 Bacteria 2549
248 nmdc:mga06r32_570108_c1 3300050510 Bacteria 1105
249 nmdc:mga06r32_84451_c1 3300050510 Bacteria 3094
250 nmdc:mga08y16_276945_c1 3300050511 Bacteria 1731
251 nmdc:mga08y16_39368_c1 3300050511 Bacteria 4961
252 nmdc:mga0n895_89586_c1 3300050512 Bacteria 3078
253 nmdc:mga08x19_14789_c1 3300050514 Bacteria 4739
254 nmdc:mga08x19_90841_c1 3300050514 Bacteria 2015
255 nmdc:mga0a205_243028_c1 3300050515 Bacteria 1681
256 nmdc:mga0a205_89308_c1 3300050515 Bacteria 2979
257 Ga0501084_0035153 3300054114 Bacteria 4188
258 Ga0501084_0200666 3300054114 Unclassified 1683
259 Ga0501082_0081796 3300060353 Bacteria 2787
260 Ga0501082_0143202 3300060353 Bacteria 2074
261 Ga0530510_0120759 3300061734 Bacteria 1923
262 Ga0495603_0109883
263 Ga0070682_100029852
264 Ga0070682_100354688
265 Ga0070668_100147595
266 Ga0070674_100004862
267 Ga0070667_100019978
268 Ga0070703_10007048
269 Ga0070709_10288190
270 Ga0070714_100020304
271 Ga0070713_100045889
272 Ga0070713_100064287
273 Ga0070710_10056584
274 Ga0070705_100025782
275 Ga0070700_100089078
276 Ga0070694_100005605
277 Ga0070708_100759148
278 Ga0070678_100243840
279 Ga0070681_10072267
280 Ga0068867_100146338
281 Ga0070685_10163235
282 Ga0070706_100006904
283 Ga0070706_100052290
284 Ga0070707_100005837
285 Ga0070707_100185942
286 Ga0070707_100301663
287 Ga0070684_100009565
288 Ga0070684_100083567
289 Ga0070697_100121629
290 Ga0070696_100067211
291 Ga0070665_100017302
292 Ga0070704_100017275
293 Ga0070704_100384563
294 Ga0070702_100006654
295 Ga0070702_100175004
296 Ga0070702_100428625
297 Ga0068866_10127821
298 Ga0068870_10051203
299 Ga0068870_10207530
300 Ga0081538_10002868
301 Ga0081538_10019294
302 Ga0081540_1009279
303 Ga0081539_10007013
304 Ga0081539_10049163
305 Ga0070717_10054322
306 Ga0070715_10015830
307 Ga0097621_100192946
308 Ga0075428_100068465
309 Ga0075428_100230223
310 Ga0075428_100463934
311 Ga0075428_100602155
312 Ga0075430_100374647
313 Ga0075431_100018525
314 Ga0075431_100094672
315 Ga0075431_100587670
316 Ga0075434_100314444
317 Ga0075429_100454802
318 Ga0068865_100094214
319 Ga0068865_100335740
320 Ga0075436_100014416
321 Ga0111539_10009759
322 Ga0111539_10747513
323 Ga0111539_10866935
324 Ga0105245_10480809
325 Ga0105245_10486512
326 Ga0105247_10036939
327 Ga0114129_10167546
328 Ga0114129_10221208
329 Ga0114129_10390561
330 Ga0114129_10649596
331 Ga0105243_10195609
332 Ga0105243_10293609
333 Ga0105239_10226013
334 Ga0157320_1000866
335 Ga0157369_10018745
336 Ga0163162_10084283
337 Ga0163163_10140241
338 Ga0157377_10121918
339 Ga0207653_10000735
340 Ga0207688_10056001
341 Ga0207688_10075700
342 Ga0207680_10000179
343 Ga0207685_10041121
344 Ga0207699_10239403
345 Ga0207643_10013464
346 Ga0207684_10091500
347 Ga0207684_10128434
348 Ga0207707_10057980
349 Ga0207693_10007250
350 Ga0207693_10013459
351 Ga0207663_10018103
352 Ga0207662_10156339
353 Ga0207646_10062421
354 Ga0207700_10074676
355 Ga0207664_10129304
356 Ga0207690_10114893
357 Ga0207690_10152775
358 Ga0207709_10198439
359 Ga0207669_10129724
360 Ga0207665_10073309
361 Ga0207665_10190785
362 Ga0207689_10546781
363 Ga0207679_10170101
364 Ga0207667_10152469
365 Ga0207668_10527088
366 Ga0207640_10218624
367 Ga0207658_10001445
368 Ga0207677_10201474
369 Ga0207708_10075262
370 Ga0207708_10096695
371 Ga0207702_10232832
372 Ga0207674_10876245
373 Ga0207683_10005357
374 Ga0207683_10054216
375 Ga0207428_10073321
376 Ga0268266_10001487
377 Ga0307413_10062071
378 Ga0307413_10405712
379 Ga0307410_10091221
380 Ga0307410_10094571
381 Ga0307406_10032439
382 Ga0307407_10336397
383 Ga0307409_100268208
384 Ga0307409_100305062
385 Ga0307416_100008654
386 Ga0307411_10182546
387 Ga0307411_10632583
388 Ga0307415_100010928
389 Ga0373930_0019688
390 Ga0373959_0001947
391 Ga0373929_0015508
392 Ga0373940_0020356
393 Ga0373949_0070185
394 Ga0373952_0054852
395 Ga0373939_0004230
396 Ga0373941_0006665
397 Ga0373960_0000888
398 Ga0373942_0013651
399 Ga0373961_0008578
400 Ga0373931_0012311
401 Ga0395899_0041978
402 Ga0395899_0046624
403 Ga0395899_0057026
404 Ga0395899_0069708
405 Ga0395900_0004398
406 Ga0395900_0022026
407 Ga0395900_0051112
408 Ga0395900_0095919
409 Ga0395900_0096987
410 Ga0395900_0163896
411 Ga0395900_0463764
412 Ga0395898_0002031
413 Ga0395898_0010640
414 Ga0395898_0056084
415 Ga0395898_0073310
416 Ga0395898_0170752
417 Ga0395898_0400731
418 Ga0395905_0026606
419 Ga0395905_0236629
420 Ga0395905_0383045
421 Ga0395901_0001363
422 Ga0395901_0006433
423 Ga0395901_0007341
424 Ga0395901_0029777
425 Ga0395901_0037324
426 Ga0395901_0088602
427 Ga0395901_0101596
428 Ga0395901_0109125
429 Ga0395901_0161855
430 Ga0395901_0167189
431 Ga0395901_0280598
432 Ga0451853_1308267
433 Ga0466966_0384745
434 Ga0495603_0003631
435 Ga0495638_0019941
436 Ga0495628_0097100
437 Ga0495630_0029224
438 Ga0495587_0172571
439 Ga0495656_0193178
440 Ga0495588_0171996
441 Ga0495658_0037833
442 Ga0495613_0075921
443 Ga0495613_0170460
444 Ga0495674_0336923
445 Ga0495684_0082569
446 Ga0496102_0040691
447 Ga0496104_0040371
448 Ga0496105_0011378
449 Ga0496106_0039294
450 Ga0496106_0063628
451 Ga0496106_0237525
452 Ga0496107_0081096
453 Ga0496107_0399399
454 Ga0496108_0047270
455 Ga0496109_0034435
456 Ga0496109_0143303
457 Ga0496109_0277420
458 Ga0496109_0349444
459 Ga0496110_0325527
460 Ga0496112_0013121
461 Ga0496112_0073431
462 Ga0496114_0007464
463 Ga0496115_0006407
464 Ga0496124_0240304
465 Ga0496126_0038743
466 Ga0501031_0010111
467 Ga0501031_0036323
468 Ga0501036_0017343
469 Ga0501036_0156253
470 Ga0501037_0031509
471 Ga0501038_0017008
472 Ga0501039_0033948
473 Ga0501039_0087736
474 Ga0501040_0095012
475 Ga0501041_0047262
476 Ga0501042_0173921
477 Ga0501043_0231952
478 Ga0501046_0021645
479 Ga0501046_0066920
480 Ga0501048_0085860
481 Ga0501048_0134652
482 Ga0501068_0015918
483 Ga0501069_0012945
484 Ga0501070_0027085
485 Ga0501070_0233482
486 Ga0501071_0033669
487 Ga0501074_0049595
488 Ga0501075_0036121
489 Ga0501076_0107626
490 Ga0501077_0015109
491 Ga0501077_0122767
492 Ga0501080_0056403
493 Ga0501081_0071199
494 Ga0501081_0101790
495 Ga0501081_0215230
496 Ga0501083_0018511
497 Ga0501035_0045553
498 Ga0501044_0037066
499 Ga0501045_0026954
500 Ga0501045_0049827
501 Ga0501045_0072486
502 nmdc:mga03n38_248018_c1
503 nmdc:mga05p37_225595_c1
504 nmdc:mga05p37_286266_c1
505 nmdc:mga05p37_43380_c1
506 nmdc:mga05p37_852235_c1
507 nmdc:mga09592_257955_c1
508 nmdc:mga06r32_124037_c1
509 nmdc:mga06r32_570108_c1
510 nmdc:mga06r32_84451_c1
511 nmdc:mga08y16_276945_c1
512 nmdc:mga08y16_39368_c1
513 nmdc:mga0n895_89586_c1
514 nmdc:mga08x19_14789_c1
515 nmdc:mga08x19_90841_c1
516 nmdc:mga0a205_243028_c1
517 nmdc:mga0a205_89308_c1
518 Ga0501084_0035153
519 Ga0501084_0200666
520 Ga0501082_0081796
521 Ga0501082_0143202
522 Ga0530510_0120759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

10

236

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9614 5 262
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9564 5 264
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9429 3 252
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9321 7 242
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.932 5 264
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9731 5 226 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9386 3 226 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9356 5 226 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9213 3 243 3.20.20.60
2qiwB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9093 5 226 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7Y7Y737-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9822 96 203 GO:0016829
AF-A0A7W1D5C7-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9813 1 118 GO:0016829
AF-A0A7W0SJ30-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9787 1 263 GO:0016829
AF-A0A538M4Z8-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9784 33 263 GO:0016829
AF-A0A2V6PFR3-F1-model_v4 2-methylisocitrate lyase 0.9762 23 177 GO:0016829

Map