F370536

General Info

Members Datasets Scaffolds Average Seq Length
261 156 261 435

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0002678|Ga0466964_0002678_2791_4248
Length 485
Sequence VAEAERQHPNVTLAILALGAAAYALLQSAVVPALSDLQRSLHTSETGIAWVLTAYLLSASVATPVLGRLGDMFGKERVLLWTYVLLAAGTLMAALVDSVGLLDVARVIQGAGGGVFPLAFGIIRDEFPREKVAGAIGLLSAILGIGAGAGIVLGGLIVEHLSWHWLFWLPLIALVGAVVLTALYVPESPVRVPGRINWLSGLLMGLGLSAVLLAISEATVWGWGSAKTVGLLLGGLAVCVAWVLAELRSAEPLVDMGMMRLRGVWTTNLAGFLLGGGMYASFILIPQFVEEPHSTGYGFGASVLAGGIYLLPSTVAMLVTGSLAGRLXXXFGSKSALVAGAVICAGAYLILTLAHSRPWHVYVAAGLLGAGIGLAFAAMGNLIVQAVPAGQTGVASGMNTVLRTIGGAVGVALAATLIAAHTGPGGLPAEHGYVLAFLLSLAFLAVCVLASLLVPGASSVDEDEAERHEAEHARRRGHRERAVRA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 12.64
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10012791 3300003320 Bacteria 9344
2 Ga0070683_100027982 3300005329 Bacteria 5090
3 Ga0070680_100006974 3300005336 Bacteria 8612
4 Ga0070680_100018757 3300005336 Bacteria 5474
5 Ga0070680_100046006 3300005336 Bacteria 3549
6 Ga0070682_100007912 3300005337 Bacteria 5984
7 Ga0070682_100008022 3300005337 Bacteria 5945
8 Ga0070660_100020926 3300005339 Bacteria 4815
9 Ga0070660_100051728 3300005339 Bacteria 3164
10 Ga0070660_100079959 3300005339 Bacteria 2565
11 Ga0070660_100187256 3300005339 Bacteria 1676
12 Ga0070661_100033052 3300005344 Bacteria 3746
13 Ga0070668_100010552 3300005347 Bacteria 6871
14 Ga0070659_100082297 3300005366 Bacteria 2572
15 Ga0070667_100000192 3300005367 Bacteria 72961
16 Ga0070709_10010432 3300005434 Bacteria 5148
17 Ga0070714_100111391 3300005435 Bacteria 2424
18 Ga0070713_100085812 3300005436 Bacteria 2697
19 Ga0070711_100052472 3300005439 Bacteria 2806
20 Ga0070708_100008324 3300005445 Bacteria 8329
21 Ga0070681_10021702 3300005458 Bacteria 6438
22 Ga0070681_10022968 3300005458 Bacteria 6268
23 Ga0070681_10029115 3300005458 Bacteria 5545
24 Ga0070681_10122676 3300005458 Bacteria 2531
25 Ga0070681_10168840 3300005458 Bacteria 2110
26 Ga0070706_100056733 3300005467 Bacteria 3614
27 Ga0070707_100211144 3300005468 Bacteria 1892
28 Ga0070679_100018391 3300005530 Bacteria 6781
29 Ga0070679_100093640 3300005530 Bacteria 2992
30 Ga0070684_100009787 3300005535 Bacteria 7569
31 Ga0068853_100120063 3300005539 Bacteria 2344
32 Ga0068855_100222134 3300005563 Bacteria 2118
33 Ga0068856_100013467 3300005614 Bacteria 7914
34 Ga0068856_100069071 3300005614 Bacteria 3493
35 Ga0068856_100112961 3300005614 Bacteria 2714
36 Ga0068852_100026579 3300005616 Bacteria 4707
37 Ga0068852_100140842 3300005616 Bacteria 2232
38 Ga0068860_100169002 3300005843 Bacteria 2112
39 Ga0068862_100000050 3300005844 Bacteria 145502
40 Ga0070717_10006294 3300006028 Bacteria 8718
41 Ga0070717_10007865 3300006028 Bacteria 7938
42 Ga0070712_100033911 3300006175 Bacteria 3457
43 Ga0105245_10004769 3300009098 Bacteria 11968
44 Ga0105241_10178997 3300009174 Bacteria 1757
45 Ga0105238_10164695 3300009551 Bacteria 2193
46 Ga0105249_10001649 3300009553 Bacteria 19558
47 Ga0157370_10154006 3300013104 Bacteria 2139
48 Ga0157369_10006313 3300013105 Bacteria 13763
49 Ga0157369_10046925 3300013105 Bacteria 4693
50 Ga0157369_10106705 3300013105 Bacteria 2980
51 Ga0157369_10189646 3300013105 Bacteria 2160
52 Ga0157369_10213613 3300013105 Bacteria 2021
53 Ga0157372_10054576 3300013307 Bacteria 4458
54 Ga0157372_10185139 3300013307 Bacteria 2411
55 Ga0157379_10037383 3300014968 Bacteria 4329
56 Ga0206353_10703416 3300020082 Bacteria 1968
57 Ga0206353_12004089 3300020082 Bacteria 3371
58 Ga0213874_10000147 3300021377 Bacteria 12174
59 Ga0207707_10146230 3300025912 Bacteria 2066
60 Ga0207663_10061636 3300025916 Bacteria 2381
61 Ga0207660_10004053 3300025917 Bacteria 9559
62 Ga0207657_10003035 3300025919 Bacteria 17975
63 Ga0207657_10012499 3300025919 Bacteria 8380
64 Ga0207657_10032982 3300025919 Bacteria 4672
65 Ga0207657_10033517 3300025919 Bacteria 4629
66 Ga0207657_10057428 3300025919 Bacteria 3354
67 Ga0207657_10182743 3300025919 Bacteria 1694
68 Ga0207649_10069977 3300025920 Bacteria 2236
69 Ga0207652_10033539 3300025921 Bacteria 4323
70 Ga0207652_10036746 3300025921 Bacteria 4142
71 Ga0207652_10064519 3300025921 Bacteria 3169
72 Ga0207687_10057308 3300025927 Bacteria 2737
73 Ga0207700_10000002 3300025928 Bacteria 775978
74 Ga0207700_10006260 3300025928 Bacteria 7178
75 Ga0207664_10008067 3300025929 Bacteria 7324
76 Ga0207664_10032855 3300025929 Bacteria 3981
77 Ga0207664_10142091 3300025929 Bacteria 2032
78 Ga0207690_10181929 3300025932 Bacteria 1583
79 Ga0207667_10169206 3300025949 Bacteria 2246
80 Ga0207712_10001339 3300025961 Bacteria 16877
81 Ga0207668_10021142 3300025972 Bacteria 4147
82 Ga0207658_10009938 3300025986 Bacteria 6464
83 Ga0207702_10009768 3300026078 Bacteria 8053
84 Ga0207674_10006044 3300026116 Bacteria 14320
85 Ga0207698_10115834 3300026142 Bacteria 2257
86 Ga0268265_10001491 3300028380 Bacteria 19606
87 Ga0268264_10178869 3300028381 Bacteria 1925
88 Ga0265337_1000952 3300028556 Bacteria 15138
89 Ga0265319_1000217 3300028563 Bacteria 43119
90 Ga0265318_10000748 3300028577 Bacteria 21649
91 Ga0265338_10004577 3300028800 Bacteria 18602
92 Ga0265324_10002016 3300029957 Bacteria 10818
93 Ga0265327_10006463 3300031251 Bacteria 9361
94 Ga0265316_10016540 3300031344 Bacteria 6394
95 Ga0373926_0048863 3300035083 Bacteria 1522
96 Ga0373945_0024372 3300035116 Bacteria 2096
97 Ga0373943_0001587 3300035170 Bacteria 10292
98 Ga0373943_0024172 3300035170 Bacteria 2831
99 Ga0373946_0041967 3300035171 Bacteria 1878
100 Ga0373935_0035614 3300035692 Bacteria 3107
101 Ga0373927_0026571 3300035695 Bacteria 3784
102 Ga0373947_0001682 3300035725 Bacteria 13546
103 Ga0373947_0012906 3300035725 Bacteria 4789
104 Ga0373937_0262179 3300036401 Bacteria 1630
105 Ga0373925_0018101 3300037068 Bacteria 5116
106 Ga0373925_0066686 3300037068 Bacteria 2713
107 Ga0395898_0082160 3300037466 Bacteria 3106
108 Ga0436364_0068592 3300037853 Bacteria 1598
109 Ga0436364_0757072 3300037853 Bacteria 9325
110 Ga0395901_0079464 3300038443 Bacteria 3425
111 Ga0436365_0116219 3300039437 Bacteria 10872
112 Ga0436365_0911509 3300039437 Bacteria 21390
113 Ga0436365_1158902 3300039437 Bacteria 18203
114 Ga0436365_1290693 3300039437 Bacteria 14319
115 Ga0436363_0062885 3300039450 Bacteria 7989
116 Ga0436363_0592624 3300039450 Bacteria 2494
117 Ga0436363_0812143 3300039450 Bacteria 15027
118 Ga0466966_0003309 3300044684 Bacteria 10620
119 Ga0466961_0001051 3300044693 Bacteria 17008
120 Ga0466961_0100068 3300044693 Bacteria 1827
121 Ga0466963_0000220 3300044694 Bacteria 24498
122 Ga0466963_0011095 3300044694 Bacteria 5479
123 Ga0466963_0019503 3300044694 Bacteria 4255
124 Ga0466963_0020952 3300044694 Bacteria 4119
125 Ga0466963_0021266 3300044694 Bacteria 4091
126 Ga0466963_0026094 3300044694 Bacteria 3734
127 Ga0466964_0002678 3300044706 Bacteria 6380
128 Ga0466964_0028292 3300044706 Bacteria 2207
129 Ga0466971_0012489 3300044719 Bacteria 3724
130 Ga0466968_0022208 3300044735 Bacteria 2578
131 Ga0466957_0025823 3300044842 Bacteria 3482
132 Ga0466957_0044698 3300044842 Bacteria 2685
133 Ga0466959_0020196 3300045049 Bacteria 4904
134 Ga0466959_0085907 3300045049 Bacteria 2263
135 Ga0466958_0013873 3300045836 Bacteria 4595
136 Ga0466958_0016453 3300045836 Bacteria 4259
137 Ga0466958_0018560 3300045836 Bacteria 4039
138 Ga0466967_0000877 3300045976 Bacteria 16005
139 Ga0466967_0004825 3300045976 Bacteria 9194
140 Ga0466967_0009371 3300045976 Bacteria 7260
141 Ga0466967_0018450 3300045976 Bacteria 5576
142 Ga0466967_0033921 3300045976 Bacteria 4326
143 Ga0466967_0045660 3300045976 Bacteria 3807
144 Ga0466967_0060160 3300045976 Bacteria 3365
145 Ga0466967_0108759 3300045976 Bacteria 2544
146 Ga0466967_0132912 3300045976 Bacteria 2312
147 Ga0466967_0182625 3300045976 Bacteria 1979
148 Ga0495629_0001090 3300046459 Bacteria 21521
149 Ga0495641_0000278 3300046461 Bacteria 40927
150 Ga0495641_0000681 3300046461 Bacteria 28646
151 Ga0495651_0021156 3300046462 Bacteria 5053
152 Ga0495653_0012799 3300046463 Bacteria 6849
153 Ga0495582_0000643 3300046473 Bacteria 19225
154 Ga0495639_0004028 3300046475 Bacteria 6298
155 Ga0495639_0044673 3300046475 Unclassified 2003
156 Ga0495662_0004046 3300046476 Bacteria 7384
157 Ga0495596_0008688 3300046500 Bacteria 4503
158 Ga0495608_0005769 3300046511 Bacteria 8821
159 Ga0495608_0015842 3300046511 Bacteria 5217
160 Ga0495630_0018406 3300046517 Bacteria 5132
161 Ga0495630_0021922 3300046517 Bacteria 4718
162 Ga0495644_0004279 3300046523 Bacteria 5606
163 Ga0495652_0048142 3300046529 Bacteria 3654
164 Ga0495652_0051555 3300046529 Bacteria 3513
165 Ga0495652_0072051 3300046529 Bacteria 2881
166 Ga0495665_0078848 3300046531 Bacteria 1732
167 Ga0495587_0019825 3300046536 Bacteria 4158
168 Ga0495667_0077596 3300046559 Bacteria 2160
169 Ga0495634_0022658 3300046642 Bacteria 4424
170 Ga0495635_0045918 3300046663 Bacteria 3013
171 Ga0495657_0015152 3300046675 Bacteria 5647
172 Ga0495599_0046376 3300046678 Bacteria 2725
173 Ga0495647_0007134 3300046681 Bacteria 3731
174 Ga0495658_0001015 3300046683 Bacteria 14833
175 Ga0495658_0009396 3300046683 Bacteria 4873
176 Ga0495658_0032206 3300046683 Bacteria 2861
177 Ga0495581_0067158 3300047315 Bacteria 2073
178 Ga0495674_0142584 3300047319 Bacteria 2013
179 Ga0495676_0002253 3300047321 Bacteria 17120
180 Ga0495680_0004584 3300047322 Bacteria 13179
181 Ga0495680_0016691 3300047322 Bacteria 6300
182 Ga0495673_0009073 3300047469 Bacteria 5527
183 Ga0495684_0012130 3300047471 Bacteria 6647
184 Ga0495684_0026916 3300047471 Bacteria 4418
185 Ga0495686_0000008 3300047472 Bacteria 727479
186 Ga0495686_0008219 3300047472 Bacteria 7696
187 Ga0495593_0007614 3300047673 Bacteria 6324
188 Ga0496100_0003771 3300048903 Bacteria 7936
189 Ga0496101_0009221 3300048904 Bacteria 6479
190 Ga0496101_0025871 3300048904 Bacteria 4075
191 Ga0496101_0065725 3300048904 Bacteria 2644
192 Ga0496102_0001364 3300048905 Bacteria 21868
193 Ga0496102_0004474 3300048905 Bacteria 11794
194 Ga0496103_0004682 3300048906 Bacteria 8279
195 Ga0496104_0005235 3300048907 Bacteria 11341
196 Ga0496104_0006824 3300048907 Bacteria 10058
197 Ga0496104_0067895 3300048907 Bacteria 3387
198 Ga0496104_0214402 3300048907 Bacteria 1837
199 Ga0496105_0000566 3300048908 Bacteria 24464
200 Ga0496105_0014208 3300048908 Bacteria 6337
201 Ga0496106_0018665 3300048909 Bacteria 5134
202 Ga0496107_0006083 3300048910 Bacteria 8288
203 Ga0496107_0014032 3300048910 Bacteria 5608
204 Ga0496107_0027770 3300048910 Bacteria 4021
205 Ga0496108_0010466 3300048911 Bacteria 7535
206 Ga0496109_0006065 3300048912 Bacteria 10155
207 Ga0496111_0002185 3300048914 Bacteria 11720
208 Ga0496111_0003191 3300048914 Bacteria 10112
209 Ga0496111_0031969 3300048914 Bacteria 3751
210 Ga0496112_0037489 3300048915 Bacteria 4731
211 Ga0496112_0117813 3300048915 Bacteria 2626
212 Ga0496114_0000364 3300048917 Bacteria 33204
213 Ga0496114_0006762 3300048917 Bacteria 9034
214 Ga0496114_0029299 3300048917 Bacteria 4522
215 Ga0496114_0031206 3300048917 Bacteria 4384
216 Ga0496114_0163924 3300048917 Bacteria 1934
217 Ga0496115_0008815 3300048918 Bacteria 7473
218 Ga0496115_0024273 3300048918 Bacteria 4710
219 Ga0496115_0024411 3300048918 Bacteria 4698
220 Ga0496115_0036104 3300048918 Bacteria 3912
221 Ga0496121_0030603 3300048924 Bacteria 4940
222 Ga0501032_0019781 3300049569 Bacteria 4702
223 Ga0501032_0167102 3300049569 Bacteria 1443
224 Ga0501037_0030747 3300049573 Bacteria 3966
225 Ga0501046_0009334 3300049580 Bacteria 8486
226 Ga0501047_0000178 3300049581 Bacteria 77670
227 Ga0501047_0027160 3300049581 Bacteria 5514
228 Ga0501047_0107025 3300049581 Bacteria 2677
229 Ga0501068_0002675 3300049584 Bacteria 9438
230 Ga0501069_0003158 3300049585 Bacteria 8445
231 Ga0501070_0000096 3300049586 Bacteria 75811
232 Ga0501070_0015162 3300049586 Bacteria 6485
233 Ga0501070_0026682 3300049586 Bacteria 4846
234 Ga0501070_0067502 3300049586 Bacteria 2962
235 Ga0501071_0057056 3300049587 Bacteria 2822
236 Ga0501072_0000266 3300049588 Bacteria 38055
237 Ga0501073_0000049 3300049589 Bacteria 75259
238 Ga0501074_0000136 3300049590 Bacteria 38031
239 Ga0501074_0005011 3300049590 Bacteria 9506
240 Ga0501079_0000329 3300049741 Bacteria 29869
241 Ga0501079_0040097 3300049741 Bacteria 3612
242 Ga0501080_0000008 3300049742 Bacteria 134920
243 Ga0501080_0024119 3300049742 Bacteria 5638
244 Ga0501080_0081531 3300049742 Bacteria 3005
245 Ga0501080_0175683 3300049742 Bacteria 1973
246 Ga0501083_0000196 3300049744 Bacteria 39027
247 Ga0501035_0008475 3300049822 Bacteria 9576
248 Ga0501044_0000559 3300049823 Bacteria 45231
249 Ga0501044_0003405 3300049823 Bacteria 17914
250 nmdc:mga0a205_5874_c1 3300050515 Bacteria 11053
251 Ga0495601_0046494 3300053077 Bacteria 2732
252 Ga0495612_0023972 3300053078 Bacteria 2450
253 Ga0495595_0036070 3300053084 Bacteria 2242
254 Ga0495619_0001024 3300053085 Bacteria 18310
255 Ga0495619_0012579 3300053085 Bacteria 5327
256 Ga0495619_0051612 3300053085 Bacteria 2718
257 Ga0500616_0006663 3300053153 Bacteria 7510
258 Ga0501084_0029115 3300054114 Bacteria 4619
259 Ga0501082_0000124 3300060353 Bacteria 61918
260 Ga0466962_0000159 3300061719 Bacteria 28442
261 Ga0466962_0028346 3300061719 Bacteria 2683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10164695 Ga0105238_101646952 305
2 3300013307 Ga0157372_10185139 Ga0157372_101851392 305
3 3300045976 Ga0466967_0004825 Ga0466967_0004825_6337_7755 308
4 3300044706 Ga0466964_0028292 Ga0466964_0028292_431_1849 310
5 3300045976 Ga0466967_0045660 Ga0466967_0045660_1179_2597 310
6 3300025919 Ga0207657_10032982 Ga0207657_100329823 313
7 3300025921 Ga0207652_10064519 Ga0207652_100645193 313
8 3300005344 Ga0070661_100033052 Ga0070661_1000330523 314
9 3300005563 Ga0068855_100222134 Ga0068855_1002221342 314
10 3300005614 Ga0068856_100069071 Ga0068856_1000690713 314
11 3300005616 Ga0068852_100026579 Ga0068852_1000265793 314
12 3300025920 Ga0207649_10069977 Ga0207649_100699772 314
13 3300044842 Ga0466957_0025823 Ga0466957_0025823_2118_3458 317
14 3300048924 Ga0496121_0030603 Ga0496121_0030603_298_1755 326
15 3300037068 Ga0373925_0066686 Ga0373925_0066686_841_2262 327
16 3300046517 Ga0495630_0018406 Ga0495630_0018406_1959_3380 327
17 3300035083 Ga0373926_0048863 Ga0373926_0048863_87_1508 328
18 3300035116 Ga0373945_0024372 Ga0373945_0024372_642_2063 328
19 3300035170 Ga0373943_0024172 Ga0373943_0024172_822_2243 328
20 3300035171 Ga0373946_0041967 Ga0373946_0041967_211_1632 328
21 3300035725 Ga0373947_0012906 Ga0373947_0012906_2901_4322 328
22 3300046683 Ga0495658_0032206 Ga0495658_0032206_876_2297 328
23 3300044694 Ga0466963_0011095 Ga0466963_0011095_3945_5369 330
24 3300048914 Ga0496111_0002185 Ga0496111_0002185_10156_11577 335
25 3300005336 Ga0070680_100006974 Ga0070680_1000069747 336
26 3300005337 Ga0070682_100007912 Ga0070682_1000079124 336
27 3300005339 Ga0070660_100187256 Ga0070660_1001872562 336
28 3300005434 Ga0070709_10010432 Ga0070709_100104323 336
29 3300005458 Ga0070681_10022968 Ga0070681_100229682 336
30 3300005535 Ga0070684_100009787 Ga0070684_1000097873 336
31 3300005614 Ga0068856_100013467 Ga0068856_1000134677 336
32 3300009098 Ga0105245_10004769 Ga0105245_1000476911 336
33 3300025917 Ga0207660_10004053 Ga0207660_100040532 336
34 3300025919 Ga0207657_10182743 Ga0207657_101827431 336
35 3300025921 Ga0207652_10036746 Ga0207652_100367464 336
36 3300025927 Ga0207687_10057308 Ga0207687_100573082 336
37 3300025928 Ga0207700_10000002 Ga0207700_10000002715 336
38 3300026078 Ga0207702_10009768 Ga0207702_100097682 336
39 3300048905 Ga0496102_0001364 Ga0496102_0001364_3566_4987 336
40 3300048906 Ga0496103_0004682 Ga0496103_0004682_6128_7549 336
41 3300048907 Ga0496104_0005235 Ga0496104_0005235_7650_9071 336
42 3300048908 Ga0496105_0014208 Ga0496105_0014208_1341_2762 336
43 3300048914 Ga0496111_0031969 Ga0496111_0031969_1168_2589 336
44 3300048917 Ga0496114_0000364 Ga0496114_0000364_9202_10623 336
45 3300048918 Ga0496115_0036104 Ga0496115_0036104_1016_2437 336
46 3300061719 Ga0466962_0028346 Ga0466962_0028346_903_2315 336
47 3300037853 Ga0436364_0757072 Ga0436364_0757072_7709_9238 340
48 3300039437 Ga0436365_0911509 Ga0436365_0911509_11756_13285 340
49 3300005616 Ga0068852_100140842 Ga0068852_1001408422 341
50 3300020082 Ga0206353_10703416 Ga0206353_107034162 341
51 3300013105 Ga0157369_10106705 Ga0157369_101067052 342
52 3300005339 Ga0070660_100020926 Ga0070660_1000209262 343
53 3300005436 Ga0070713_100085812 Ga0070713_1000858122 343
54 3300005439 Ga0070711_100052472 Ga0070711_1000524722 343
55 3300006028 Ga0070717_10007865 Ga0070717_100078653 343
56 3300006175 Ga0070712_100033911 Ga0070712_1000339111 343
57 3300013105 Ga0157369_10189646 Ga0157369_101896462 343
58 3300025916 Ga0207663_10061636 Ga0207663_100616362 343
59 3300025919 Ga0207657_10012499 Ga0207657_100124992 343
60 3300025949 Ga0207667_10169206 Ga0207667_101692062 343
61 3300045976 Ga0466967_0000877 Ga0466967_0000877_485_1879 343
62 3300048903 Ga0496100_0003771 Ga0496100_0003771_1558_2979 343
63 3300048904 Ga0496101_0009221 Ga0496101_0009221_1806_3215 343
64 3300048905 Ga0496102_0004474 Ga0496102_0004474_4602_6023 343
65 3300048907 Ga0496104_0006824 Ga0496104_0006824_3970_5379 343
66 3300048908 Ga0496105_0000566 Ga0496105_0000566_19468_20877 343
67 3300048910 Ga0496107_0006083 Ga0496107_0006083_4299_5708 343
68 3300048911 Ga0496108_0010466 Ga0496108_0010466_4611_6020 343
69 3300048912 Ga0496109_0006065 Ga0496109_0006065_5777_7198 343
70 3300048914 Ga0496111_0003191 Ga0496111_0003191_3319_4728 343
71 3300048917 Ga0496114_0029299 Ga0496114_0029299_657_2066 343
72 3300048918 Ga0496115_0008815 Ga0496115_0008815_209_1630 343
73 3300025929 Ga0207664_10008067 Ga0207664_100080674 344
74 3300044693 Ga0466961_0001051 Ga0466961_0001051_14109_15518 346
75 3300044694 Ga0466963_0000220 Ga0466963_0000220_9827_11236 346
76 3300044719 Ga0466971_0012489 Ga0466971_0012489_610_2019 346
77 3300045976 Ga0466967_0033921 Ga0466967_0033921_1397_2818 346
78 3300061719 Ga0466962_0000159 Ga0466962_0000159_1034_2443 346
79 3300005435 Ga0070714_100111391 Ga0070714_1001113912 348
80 3300013105 Ga0157369_10006313 Ga0157369_1000631311 348
81 3300025929 Ga0207664_10032855 Ga0207664_100328552 348
82 3300044693 Ga0466961_0100068 Ga0466961_0100068_140_1543 350
83 3300044694 Ga0466963_0020952 Ga0466963_0020952_2602_4074 350
84 3300005329 Ga0070683_100027982 Ga0070683_1000279823 351
85 3300005339 Ga0070660_100079959 Ga0070660_1000799592 351
86 3300005366 Ga0070659_100082297 Ga0070659_1000822971 351
87 3300005530 Ga0070679_100093640 Ga0070679_1000936403 351
88 3300014968 Ga0157379_10037383 Ga0157379_100373835 351
89 3300025919 Ga0207657_10057428 Ga0207657_100574283 351
90 3300025932 Ga0207690_10181929 Ga0207690_101819291 351
91 3300021377 Ga0213874_10000147 Ga0213874_100001477 352
92 3300039437 Ga0436365_0116219 Ga0436365_0116219_1055_2539 352
93 3300039450 Ga0436363_0812143 Ga0436363_0812143_7227_8711 352
94 3300005458 Ga0070681_10029115 Ga0070681_100291153 353
95 3300045976 Ga0466967_0132912 Ga0466967_0132912_711_2141 353
96 3300049586 Ga0501070_0026682 Ga0501070_0026682_1128_2549 354
97 3300049742 Ga0501080_0081531 Ga0501080_0081531_1543_2964 354
98 3300009174 Ga0105241_10178997 Ga0105241_101789972 355
99 3300025929 Ga0207664_10142091 Ga0207664_101420912 355
100 3300037466 Ga0395898_0082160 Ga0395898_0082160_1089_2486 355
101 3300038443 Ga0395901_0079464 Ga0395901_0079464_523_1920 355
102 3300039450 Ga0436363_0062885 Ga0436363_0062885_4974_6503 355
103 3300039450 Ga0436363_0592624 Ga0436363_0592624_291_1820 355
104 3300048904 Ga0496101_0065725 Ga0496101_0065725_811_2244 355
105 3300048907 Ga0496104_0214402 Ga0496104_0214402_394_1827 355
106 3300048910 Ga0496107_0027770 Ga0496107_0027770_1641_3074 355
107 3300048915 Ga0496112_0037489 Ga0496112_0037489_629_2032 355
108 3300048917 Ga0496114_0031206 Ga0496114_0031206_2599_4032 355
109 3300048918 Ga0496115_0024411 Ga0496115_0024411_963_2396 355
110 3300049569 Ga0501032_0167102 Ga0501032_0167102_34_1416 355
111 3300005336 Ga0070680_100018757 Ga0070680_1000187576 356
112 3300005337 Ga0070682_100008022 Ga0070682_1000080224 356
113 3300005339 Ga0070660_100051728 Ga0070660_1000517282 356
114 3300005445 Ga0070708_100008324 Ga0070708_1000083243 356
115 3300005458 Ga0070681_10122676 Ga0070681_101226762 356
116 3300005467 Ga0070706_100056733 Ga0070706_1000567332 356
117 3300006028 Ga0070717_10006294 Ga0070717_100062942 356
118 3300013105 Ga0157369_10213613 Ga0157369_102136132 356
119 3300020082 Ga0206353_12004089 Ga0206353_120040892 356
120 3300025912 Ga0207707_10146230 Ga0207707_101462302 356
121 3300025919 Ga0207657_10003035 Ga0207657_1000303517 356
122 3300026142 Ga0207698_10115834 Ga0207698_101158342 356
123 3300046462 Ga0495651_0021156 Ga0495651_0021156_1820_3256 356
124 3300046463 Ga0495653_0012799 Ga0495653_0012799_3330_4766 356
125 3300046511 Ga0495608_0015842 Ga0495608_0015842_2865_4301 356
126 3300046529 Ga0495652_0048142 Ga0495652_0048142_1189_2625 356
127 3300046536 Ga0495587_0019825 Ga0495587_0019825_1187_2623 356
128 3300046559 Ga0495667_0077596 Ga0495667_0077596_36_1472 356
129 3300046663 Ga0495635_0045918 Ga0495635_0045918_119_1555 356
130 3300047319 Ga0495674_0142584 Ga0495674_0142584_277_1713 356
131 3300047322 Ga0495680_0004584 Ga0495680_0004584_7044_8480 356
132 3300047471 Ga0495684_0026916 Ga0495684_0026916_1949_3385 356
133 3300053078 Ga0495612_0023972 Ga0495612_0023972_929_2365 356
134 3300053085 Ga0495619_0001024 Ga0495619_0001024_4741_6177 356
135 3300013104 Ga0157370_10154006 Ga0157370_101540062 357
136 3300013105 Ga0157369_10046925 Ga0157369_100469252 357
137 3300048915 Ga0496112_0117813 Ga0496112_0117813_1125_2558 357
138 3300049569 Ga0501032_0019781 Ga0501032_0019781_2037_3524 357
139 3300049573 Ga0501037_0030747 Ga0501037_0030747_1685_3172 357
140 3300049585 Ga0501069_0003158 Ga0501069_0003158_890_2377 357
141 3300049586 Ga0501070_0015162 Ga0501070_0015162_3749_5236 357
142 3300049587 Ga0501071_0057056 Ga0501071_0057056_235_1722 357
143 3300049590 Ga0501074_0005011 Ga0501074_0005011_5931_7418 357
144 3300049741 Ga0501079_0040097 Ga0501079_0040097_797_2284 357
145 3300049742 Ga0501080_0024119 Ga0501080_0024119_4043_5530 357
146 3300049823 Ga0501044_0000559 Ga0501044_0000559_28457_29944 357
147 3300036401 Ga0373937_0262179 Ga0373937_0262179_136_1605 358
148 3300046511 Ga0495608_0005769 Ga0495608_0005769_7300_8766 358
149 3300046517 Ga0495630_0021922 Ga0495630_0021922_1384_2850 358
150 3300046529 Ga0495652_0051555 Ga0495652_0051555_1052_2518 358
151 3300046675 Ga0495657_0015152 Ga0495657_0015152_2096_3562 358
152 3300046678 Ga0495599_0046376 Ga0495599_0046376_589_2055 358
153 3300047322 Ga0495680_0016691 Ga0495680_0016691_4768_6234 358
154 3300053077 Ga0495601_0046494 Ga0495601_0046494_889_2355 358
155 3300028800 Ga0265338_10004577 Ga0265338_1000457710 359
156 3300031251 Ga0265327_10006463 Ga0265327_100064631 359
157 3300037853 Ga0436364_0068592 Ga0436364_0068592_160_1566 360
158 3300044694 Ga0466963_0021266 Ga0466963_0021266_725_2170 360
159 3300045836 Ga0466958_0016453 Ga0466958_0016453_704_2149 360
160 3300045976 Ga0466967_0060160 Ga0466967_0060160_457_1911 360
161 3300005458 Ga0070681_10168840 Ga0070681_101688402 361
162 3300045976 Ga0466967_0018450 Ga0466967_0018450_3760_5208 361
163 3300053085 Ga0495619_0051612 Ga0495619_0051612_787_2199 361
164 3300005336 Ga0070680_100046006 Ga0070680_1000460063 362
165 3300005347 Ga0070668_100010552 Ga0070668_1000105526 362
166 3300005367 Ga0070667_100000192 Ga0070667_10000019231 362
167 3300005458 Ga0070681_10021702 Ga0070681_100217023 362
168 3300005530 Ga0070679_100018391 Ga0070679_1000183912 362
169 3300005539 Ga0068853_100120063 Ga0068853_1001200632 362
170 3300005614 Ga0068856_100112961 Ga0068856_1001129613 362
171 3300005843 Ga0068860_100169002 Ga0068860_1001690022 362
172 3300005844 Ga0068862_100000050 Ga0068862_10000005062 362
173 3300009553 Ga0105249_10001649 Ga0105249_100016494 362
174 3300013307 Ga0157372_10054576 Ga0157372_100545763 362
175 3300025919 Ga0207657_10033517 Ga0207657_100335173 362
176 3300025921 Ga0207652_10033539 Ga0207652_100335393 362
177 3300025961 Ga0207712_10001339 Ga0207712_100013396 362
178 3300025972 Ga0207668_10021142 Ga0207668_100211422 362
179 3300025986 Ga0207658_10009938 Ga0207658_100099386 362
180 3300026116 Ga0207674_10006044 Ga0207674_1000604417 362
181 3300028380 Ga0268265_10001491 Ga0268265_100014911 362
182 3300028381 Ga0268264_10178869 Ga0268264_101788692 362
183 3300048904 Ga0496101_0025871 Ga0496101_0025871_1547_3034 362
184 3300048917 Ga0496114_0163924 Ga0496114_0163924_22_1509 362
185 3300049581 Ga0501047_0027160 Ga0501047_0027160_1837_3258 362
186 3300049742 Ga0501080_0175683 Ga0501080_0175683_152_1573 362
187 3300044684 Ga0466966_0003309 Ga0466966_0003309_1721_3142 363
188 3300045049 Ga0466959_0020196 Ga0466959_0020196_2183_3604 363
189 3300045976 Ga0466967_0108759 Ga0466967_0108759_775_2193 363
190 3300048917 Ga0496114_0006762 Ga0496114_0006762_5931_7367 363
191 3300035170 Ga0373943_0001587 Ga0373943_0001587_6795_8231 364
192 3300035692 Ga0373935_0035614 Ga0373935_0035614_983_2419 364
193 3300035695 Ga0373927_0026571 Ga0373927_0026571_1445_2881 364
194 3300035725 Ga0373947_0001682 Ga0373947_0001682_1962_3398 364
195 3300037068 Ga0373925_0018101 Ga0373925_0018101_332_1768 364
196 3300044694 Ga0466963_0026094 Ga0466963_0026094_2052_3482 364
197 3300044842 Ga0466957_0044698 Ga0466957_0044698_946_2376 364
198 3300045049 Ga0466959_0085907 Ga0466959_0085907_205_1635 364
199 3300045836 Ga0466958_0013873 Ga0466958_0013873_2968_4398 364
200 3300045976 Ga0466967_0182625 Ga0466967_0182625_523_1953 364
201 3300046459 Ga0495629_0001090 Ga0495629_0001090_205_1641 364
202 3300046461 Ga0495641_0000681 Ga0495641_0000681_17996_19432 364
203 3300046473 Ga0495582_0000643 Ga0495582_0000643_13086_14522 364
204 3300046475 Ga0495639_0004028 Ga0495639_0004028_4699_6135 364
205 3300046476 Ga0495662_0004046 Ga0495662_0004046_2062_3498 364
206 3300046531 Ga0495665_0078848 Ga0495665_0078848_132_1568 364
207 3300046681 Ga0495647_0007134 Ga0495647_0007134_841_2277 364
208 3300046683 Ga0495658_0001015 Ga0495658_0001015_9529_10965 364
209 3300047315 Ga0495581_0067158 Ga0495581_0067158_433_1869 364
210 3300047321 Ga0495676_0002253 Ga0495676_0002253_10976_12412 364
211 3300047471 Ga0495684_0012130 Ga0495684_0012130_478_1914 364
212 3300047673 Ga0495593_0007614 Ga0495593_0007614_204_1640 364
213 3300053085 Ga0495619_0012579 Ga0495619_0012579_671_2107 364
214 3300046529 Ga0495652_0072051 Ga0495652_0072051_1017_2483 365
215 3300028556 Ga0265337_1000952 Ga0265337_10009522 366
216 3300028563 Ga0265319_1000217 Ga0265319_100021738 366
217 3300028577 Ga0265318_10000748 Ga0265318_1000074811 366
218 3300029957 Ga0265324_10002016 Ga0265324_1000201612 366
219 3300031344 Ga0265316_10016540 Ga0265316_100165406 366
220 3300039437 Ga0436365_1158902 Ga0436365_1158902_6017_7495 367
221 3300048907 Ga0496104_0067895 Ga0496104_0067895_626_2065 367
222 3300039437 Ga0436365_1290693 Ga0436365_1290693_8110_9555 368
223 3300044735 Ga0466968_0022208 Ga0466968_0022208_725_2158 368
224 3300025928 Ga0207700_10006260 Ga0207700_100062605 369
225 3300044694 Ga0466963_0019503 Ga0466963_0019503_1508_2959 369
226 3300045836 Ga0466958_0018560 Ga0466958_0018560_1334_2785 369
227 3300045976 Ga0466967_0009371 Ga0466967_0009371_1127_2578 369
228 3300046642 Ga0495634_0022658 Ga0495634_0022658_2885_4324 370
229 3300049580 Ga0501046_0009334 Ga0501046_0009334_652_2133 372
230 3300049581 Ga0501047_0000178 Ga0501047_0000178_23001_24482 372
231 3300049584 Ga0501068_0002675 Ga0501068_0002675_6599_8080 372
232 3300049586 Ga0501070_0000096 Ga0501070_0000096_22734_24215 372
233 3300049588 Ga0501072_0000266 Ga0501072_0000266_13727_15208 372
234 3300049589 Ga0501073_0000049 Ga0501073_0000049_22458_23939 372
235 3300049590 Ga0501074_0000136 Ga0501074_0000136_22452_23933 372
236 3300049741 Ga0501079_0000329 Ga0501079_0000329_11054_12535 372
237 3300049742 Ga0501080_0000008 Ga0501080_0000008_81802_83283 372
238 3300049744 Ga0501083_0000196 Ga0501083_0000196_22696_24177 372
239 3300049822 Ga0501035_0008475 Ga0501035_0008475_4497_5978 372
240 3300049823 Ga0501044_0003405 Ga0501044_0003405_1467_2948 372
241 3300054114 Ga0501084_0029115 Ga0501084_0029115_2048_3529 372
242 3300060353 Ga0501082_0000124 Ga0501082_0000124_37951_39432 372
243 3300048909 Ga0496106_0018665 Ga0496106_0018665_2213_3634 373
244 3300048910 Ga0496107_0014032 Ga0496107_0014032_2672_4093 373
245 3300049586 Ga0501070_0067502 Ga0501070_0067502_650_2068 373
246 3300049581 Ga0501047_0107025 Ga0501047_0107025_317_1744 374
247 3300053084 Ga0495595_0036070 Ga0495595_0036070_151_1656 376
248 3300046500 Ga0495596_0008688 Ga0495596_0008688_537_1913 380
249 3300005468 Ga0070707_100211144 Ga0070707_1002111441 383
250 3300048918 Ga0496115_0024273 Ga0496115_0024273_2388_3875 383
251 3300046461 Ga0495641_0000278 Ga0495641_0000278_15008_16447 392
252 3300046475 Ga0495639_0044673 Ga0495639_0044673_465_1904 392
253 3300046523 Ga0495644_0004279 Ga0495644_0004279_3354_4847 392
254 3300046683 Ga0495658_0009396 Ga0495658_0009396_2081_3520 392
255 3300047469 Ga0495673_0009073 Ga0495673_0009073_1711_3204 392
256 3300047472 Ga0495686_0000008 Ga0495686_0000008_360654_362090 392
257 3300047472 Ga0495686_0008219 Ga0495686_0008219_3515_4999 392
258 3300053153 Ga0500616_0006663 Ga0500616_0006663_4952_6397 392
259 3300003320 rootH2_10012791 rootH2_100127914 394
260 3300044706 Ga0466964_0002678 Ga0466964_0002678_2791_4248 394
261 3300050515 nmdc:mga0a205_5874_c1 nmdc:mga0a205_5874_c1_7260_8702 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

16

411

0.85

PF06609

TRI12

Fungal trichothecene efflux pump (TRI12)

8

296

0.79

PF07690

MFS_1

Major Facilitator Superfamily

267

483

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7735 1 381
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7521 1 381
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7383 5 378
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7195 5 378
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7064 5 378
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9069 5 166 1.20.1250.20
af_A0A1D8PCL5_75_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8951 11 171 1.20.1250.20
af_P33335_10_275_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.889 10 224 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8878 10 225 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8841 12 233 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A538CTW0-F1-model_v4 MFS transporter 0.9249 1 196 GO:0005886
GO:0022857
AF-A0A4Q3WQQ0-F1-model_v4 MFS transporter 0.9112 6 239 GO:0005886
GO:0022857
AF-A0A4Y9VE53-F1-model_v4 deleted 0.908 2 389
AF-A0A3B8PDS0-F1-model_v4 deleted 0.904 6 243
AF-A0A5C8X8R8-F1-model_v4 deleted 0.903 6 211

Feature Viewer

pLDDT pTM Quality
75.82 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map