F370126

General Info

Members Datasets Scaffolds Average Seq Length
261 199 211 331

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100002540|Ga0070659_10000254010
Length 307
Sequence MALRAGLIGLGMMGRHHARVLRSLDDVELVAVADPGGDVHGVAAGLPVEADIEGLLEHRLDMCVVAVPTALHEEVGLALAAAGVHALVEKPLASHIERYNPSLQTLRAHLEAGELGAIYQVITRRQGPFPNRIADVGVVKDLATHDIDLTAWVTRSPYASVSARVAYKSGRQHEDLVAAVGQLEDGTITNHLVNWLSPMKERVTIVTGERGCYVADTLTADLTLFRNASIPSEWDQMARFRGVSEGDMIRYAIPKPEPLRVEHEAFRDAVLGKDSDIVTMRQGLATVAVAEAVLASATSGTTVAIAG

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2643221613 Oerskovia sp. Root22 Isolate Unclassified
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
12 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
13 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
14 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
15 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
16 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
17 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
18 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
19 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
20 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
21 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
22 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
23 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
24 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
25 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
26 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
27 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
28 2919395869 Microbacterium resistens 2980 Isolate Unclassified
29 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
30 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
31 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
32 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
33 2928153084 Leifsonia sp. 563 Isolate Unclassified
34 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
35 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
36 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
37 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
38 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
39 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
40 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
41 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
42 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
43 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
195 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
196 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
197 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
198 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
199 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.41
Metatranscriptomes 8.43
Isolates 19.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 11.88
Rhizosphere 72.03
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000214 3300001979 Bacteria 24313
2 JGI24735J21928_10001295 3300002067 Bacteria 8870
3 JGI25154J39366_1001041 3300002738 Bacteria 11091
4 rootH2_10035357 3300003320 Bacteria 17880
5 rootL2_10197030 3300003322 Bacteria 7444
6 Ga0007427J51700_118629 3300003559 Bacteria 2425
7 Ga0070658_10054031 3300005327 Bacteria 3261
8 Ga0070683_100197309 3300005329 Bacteria 1911
9 Ga0068868_100023015 3300005338 Bacteria 4711
10 Ga0070660_100273935 3300005339 Bacteria 1380
11 Ga0070659_100000652 3300005366 Bacteria 25359
12 Ga0070659_100002540 3300005366 Bacteria 12978
13 Ga0070714_100048548 3300005435 Bacteria 3610
14 Ga0070663_100048826 3300005455 Bacteria 3003
15 Ga0068853_100238859 3300005539 Bacteria 1664
16 Ga0070696_100017840 3300005546 Bacteria 4792
17 Ga0070665_100052687 3300005548 Bacteria 4080
18 Ga0068855_100008484 3300005563 Bacteria 12422
19 Ga0068854_100001154 3300005578 Bacteria 15887
20 Ga0068856_100216563 3300005614 Bacteria 1930
21 Ga0105244_10009885 3300009036 Bacteria 5821
22 Ga0105241_10003430 3300009174 Bacteria 11794
23 Ga0105237_10032723 3300009545 Bacteria 5264
24 Ga0105238_10038771 3300009551 Bacteria 4837
25 Ga0105239_10143773 3300010375 Bacteria 2659
26 Ga0105246_10242087 3300011119 Bacteria 1427
27 Ga0157370_10000756 3300013104 Bacteria 40377
28 Ga0157369_10054755 3300013105 Bacteria 4307
29 Ga0157369_10144495 3300013105 Bacteria 2515
30 Ga0157375_10046010 3300013308 Bacteria 4251
31 Ga0197907_11239991 3300020069 Bacteria 2786
32 Ga0206356_10916127 3300020070 Bacteria 1199
33 Ga0206353_11647894 3300020082 Bacteria 12241
34 Ga0224712_10007336 3300022467 Bacteria 3205
35 Ga0224712_10057136 3300022467 Bacteria 1541
36 Ga0209646_1000134 3300025246 Bacteria 124492
37 Ga0209677_100389 3300025253 Bacteria 26734
38 Ga0209051_1002713 3300025303 Bacteria 12316
39 Ga0207697_10014399 3300025315 Bacteria 3280
40 Ga0207655_1001640 3300025728 Bacteria 19855
41 Ga0207655_1002286 3300025728 Bacteria 15774
42 Ga0207647_10007075 3300025904 Bacteria 8138
43 Ga0207705_10080898 3300025909 Bacteria 2368
44 Ga0207695_10005925 3300025913 Bacteria 16018
45 Ga0207671_10000052 3300025914 Bacteria 188462
46 Ga0207694_10002079 3300025924 Bacteria 16544
47 Ga0207694_10014307 3300025924 Bacteria 5982
48 Ga0207690_10000219 3300025932 Bacteria 43461
49 Ga0207709_10322165 3300025935 Bacteria 1157
50 Ga0207661_10082447 3300025944 Bacteria 2659
51 Ga0207677_10002301 3300026023 Bacteria 10039
52 Ga0207639_10062604 3300026041 Bacteria 2878
53 Ga0207678_10096490 3300026067 Bacteria 2526
54 Ga0307513_10094082 3300031456 Bacteria 3043
55 Ga0307408_100027416 3300031548 Bacteria 3925
56 Ga0307408_100035983 3300031548 Bacteria 3477
57 Ga0307408_100060696 3300031548 Bacteria 2757
58 Ga0307408_100078537 3300031548 Bacteria 2460
59 Ga0307405_10035101 3300031731 Bacteria 2992
60 Ga0307413_10004490 3300031824 Bacteria 6079
61 Ga0307413_10081697 3300031824 Bacteria 2073
62 Ga0307413_10084924 3300031824 Bacteria 2042
63 Ga0307410_10002984 3300031852 Bacteria 8354
64 Ga0307410_10005107 3300031852 Bacteria 6901
65 Ga0307410_10059704 3300031852 Bacteria 2604
66 Ga0307410_10193362 3300031852 Bacteria 1548
67 Ga0307406_10001795 3300031901 Bacteria 11724
68 Ga0307406_10051346 3300031901 Bacteria 2618
69 Ga0307407_10007578 3300031903 Bacteria 4924
70 Ga0307412_10001029 3300031911 Bacteria 15939
71 Ga0307412_10050069 3300031911 Bacteria 2755
72 Ga0307412_10110903 3300031911 Bacteria 1959
73 Ga0307412_10175314 3300031911 Bacteria 1607
74 Ga0307409_100001261 3300031995 Bacteria 12200
75 Ga0307409_100222227 3300031995 Bacteria 1706
76 Ga0307416_100021479 3300032002 Bacteria 4635
77 Ga0307411_10084680 3300032005 Bacteria 2194
78 Ga0307415_100017682 3300032126 Bacteria 4280
79 Ga0307415_100121706 3300032126 Bacteria 1958
80 Ga0395899_0003239 3300037312 Bacteria 12915
81 Ga0395899_0003287 3300037312 Bacteria 12816
82 Ga0395899_0038604 3300037312 Bacteria 3576
83 Ga0395900_0006202 3300037418 Bacteria 12485
84 Ga0395898_0023403 3300037466 Bacteria 6243
85 Ga0395898_0057258 3300037466 Bacteria 3799
86 Ga0395901_0006746 3300038443 Bacteria 11594
87 Ga0395901_0041686 3300038443 Bacteria 4758
88 Ga0395901_0132298 3300038443 Bacteria 2621
89 Ga0436363_0656077 3300039450 Bacteria 1434
90 Ga0439436_0001880 3300041404 Bacteria 6198
91 Ga0439442_000132 3300042002 Bacteria 18441
92 Ga0439449_0002677 3300042007 Bacteria 6939
93 Ga0439449_0011458 3300042007 Bacteria 3336
94 Ga0466969_0037199 3300044656 Bacteria 2456
95 Ga0466972_0007037 3300044658 Bacteria 5643
96 Ga0466965_0025479 3300044683 Bacteria 2863
97 Ga0466965_0050762 3300044683 Bacteria 2057
98 Ga0466966_0086917 3300044684 Bacteria 1944
99 Ga0466961_0005857 3300044693 Bacteria 7788
100 Ga0466961_0038781 3300044693 Bacteria 3055
101 Ga0466961_0069859 3300044693 Bacteria 2229
102 Ga0466963_0015606 3300044694 Bacteria 4708
103 Ga0466971_0007517 3300044719 Bacteria 4747
104 Ga0466971_0012856 3300044719 Bacteria 3670
105 Ga0466957_0042296 3300044842 Bacteria 2756
106 Ga0466960_0014530 3300044901 Bacteria 3373
107 Ga0466960_0034065 3300044901 Bacteria 2371
108 Ga0466958_0033429 3300045836 Bacteria 3063
109 Ga0466958_0217325 3300045836 Bacteria 1219
110 Ga0466967_0039300 3300045976 Bacteria 4066
111 Ga0495627_017660 3300046453 Bacteria 2420
112 Ga0495592_0149632 3300046454 Bacteria 1615
113 Ga0495603_0010025 3300046455 Bacteria 5732
114 Ga0495629_0002355 3300046459 Bacteria 14546
115 Ga0495641_0025109 3300046461 Bacteria 2928
116 Ga0495653_0009593 3300046463 Bacteria 7917
117 Ga0495664_0033059 3300046477 Bacteria 3039
118 Ga0495628_0011635 3300046516 Bacteria 7437
119 Ga0495652_0000755 3300046529 Bacteria 37251
120 Ga0495665_0001398 3300046531 Bacteria 12917
121 Ga0495645_0000579 3300046543 Bacteria 25051
122 Ga0495588_0012387 3300046674 Bacteria 4030
123 Ga0495623_0005576 3300046679 Bacteria 8217
124 Ga0495669_0019595 3300046684 Bacteria 2921
125 Ga0495613_0007381 3300046689 Bacteria 8192
126 Ga0495600_0022809 3300046809 Bacteria 4023
127 Ga0495581_0048034 3300047315 Bacteria 2465
128 Ga0495604_0225210 3300047317 Bacteria 1289
129 Ga0495676_0014428 3300047321 Bacteria 7068
130 Ga0495675_0106120 3300047444 Bacteria 1755
131 Ga0495675_0166348 3300047444 Bacteria 1356
132 Ga0495677_0038216 3300047445 Bacteria 1754
133 Ga0495593_0057832 3300047673 Bacteria 2035
134 Ga0495614_0000406 3300048089 Bacteria 17582
135 Ga0496100_0000455 3300048903 Bacteria 19701
136 Ga0496101_0002162 3300048904 Bacteria 12009
137 Ga0496102_0028567 3300048905 Bacteria 4982
138 Ga0496102_0029192 3300048905 Bacteria 4933
139 Ga0496102_0035487 3300048905 Bacteria 4488
140 Ga0496102_0124017 3300048905 Bacteria 2414
141 Ga0496103_0002365 3300048906 Bacteria 11894
142 Ga0496103_0012673 3300048906 Bacteria 5002
143 Ga0496103_0034874 3300048906 Bacteria 3078
144 Ga0496104_0010456 3300048907 Bacteria 8288
145 Ga0496105_0010855 3300048908 Bacteria 7172
146 Ga0496105_0022120 3300048908 Bacteria 5151
147 Ga0496105_0048513 3300048908 Bacteria 3505
148 Ga0496106_0002488 3300048909 Bacteria 13723
149 Ga0496106_0051957 3300048909 Bacteria 3091
150 Ga0496107_0003315 3300048910 Bacteria 10760
151 Ga0496108_0016724 3300048911 Bacteria 5992
152 Ga0496108_0024451 3300048911 Bacteria 4973
153 Ga0496109_0008120 3300048912 Bacteria 8899
154 Ga0496109_0020207 3300048912 Bacteria 5882
155 Ga0496110_0018778 3300048913 Bacteria 5803
156 Ga0496111_0032308 3300048914 Bacteria 3731
157 Ga0496113_0012072 3300048916 Bacteria 5795
158 Ga0496113_0123380 3300048916 Bacteria 2027
159 Ga0496114_0016350 3300048917 Bacteria 5976
160 Ga0496114_0111520 3300048917 Bacteria 2344
161 Ga0496114_0123074 3300048917 Bacteria 2232
162 Ga0496114_0142668 3300048917 Bacteria 2075
163 Ga0496115_0002415 3300048918 Bacteria 13411
164 Ga0496115_0078606 3300048918 Bacteria 2684
165 Ga0496115_0152754 3300048918 Bacteria 1907
166 Ga0496117_0004661 3300048920 Bacteria 14917
167 Ga0496117_0014954 3300048920 Bacteria 6649
168 Ga0496118_0083450 3300048921 Bacteria 2234
169 Ga0496122_0014517 3300048925 Bacteria 7604
170 Ga0496125_0015589 3300048928 Bacteria 7338
171 Ga0496125_0053311 3300048928 Bacteria 3316
172 Ga0496126_0053015 3300048929 Bacteria 3682
173 Ga0496126_0184190 3300048929 Bacteria 1772
174 Ga0496126_0374710 3300048929 Bacteria 1160
175 Ga0496126_0399466 3300048929 Bacteria 1115
176 Ga0501305_001353 3300049161 Bacteria 2374
177 Ga0501311_001123 3300049527 Bacteria 2228
178 Ga0501311_001899 3300049527 Bacteria 1916
179 Ga0501312_003562 3300049528 Bacteria 1776
180 Ga0501313_001989 3300049529 Bacteria 1882
181 Ga0501317_003176 3300049533 Bacteria 1615
182 Ga0501317_004919 3300049533 Bacteria 1410
183 Ga0501318_001137 3300049534 Bacteria 1996
184 Ga0501318_009083 3300049534 Bacteria 1077
185 Ga0501319_000327 3300049535 Bacteria 2122
186 Ga0501320_002851 3300049536 Bacteria 1418
187 Ga0501321_000679 3300049537 Bacteria 2338
188 Ga0501323_000263 3300049539 Bacteria 3547
189 Ga0501324_002569 3300049540 Bacteria 1325
190 Ga0501032_0002014 3300049569 Bacteria 16010
191 Ga0501034_0000051 3300049571 Bacteria 210960
192 Ga0501034_0001989 3300049571 Bacteria 25870
193 Ga0501034_0026078 3300049571 Bacteria 5952
194 Ga0501037_0013850 3300049573 Bacteria 5943
195 Ga0501038_0027063 3300049574 Bacteria 5105
196 Ga0501039_0158980 3300049575 Bacteria 1776
197 Ga0501043_0155359 3300049579 Bacteria 1789
198 Ga0501035_0010090 3300049822 Bacteria 8768
199 Ga0501044_0071092 3300049823 Bacteria 3539
200 Ga0501045_0021117 3300049824 Bacteria 4656
201 Ga0501045_0094407 3300049824 Bacteria 2212
202 nmdc:mga00v17_53554_c1 3300050491 Bacteria 2460
203 nmdc:mga00v17_86970_c1 3300050491 Bacteria 1959
204 Ga0495612_0020831 3300053078 Bacteria 2629
205 Ga0500635_0000004 3300053080 Bacteria 210675
206 Ga0495655_0004955 3300053083 Bacteria 2318
207 Ga0500573_0019373 3300053140 Bacteria 3893
208 Ga0587090_000422 3300059510 Bacteria 3468
209 Ga0587124_001756 3300059660 Bacteria 1451
210 Ga0466962_0004198 3300061719 Bacteria 6899
211 Ga0466962_0012896 3300061719 Bacteria 4020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0217325 Ga0466958_0217325_302_1204 273
2 3300048929 Ga0496126_0399466 Ga0496126_0399466_18_944 289
3 3300041404 Ga0439436_0001880 Ga0439436_0001880_4133_5038 301
4 3300042007 Ga0439449_0002677 Ga0439449_0002677_4336_5241 301
5 iso_pu_bacteria 2839986021 2839987573 304
6 3300005339 Ga0070660_100273935 Ga0070660_1002739352 305
7 3300005366 Ga0070659_100002540 Ga0070659_10000254010 305
8 3300003322 rootL2_10197030 rootL2_101970306 308
9 3300009036 Ga0105244_10009885 Ga0105244_100098854 316
10 3300037418 Ga0395900_0006202 Ga0395900_0006202_5283_6233 316
11 3300037466 Ga0395898_0023403 Ga0395898_0023403_4031_4981 316
12 3300038443 Ga0395901_0041686 Ga0395901_0041686_3318_4268 316
13 3300049540 Ga0501324_002569 Ga0501324_002569_10_966 316
14 3300049569 Ga0501032_0002014 Ga0501032_0002014_9564_10514 316
15 3300049571 Ga0501034_0000051 Ga0501034_0000051_146207_147157 316
16 3300049579 Ga0501043_0155359 Ga0501043_0155359_477_1427 316
17 3300042002 Ga0439442_000132 Ga0439442_000132_5818_6798 317
18 3300046461 Ga0495641_0025109 Ga0495641_0025109_1962_2915 317
19 3300048929 Ga0496126_0374710 Ga0496126_0374710_174_1139 317
20 3300049536 Ga0501320_002851 Ga0501320_002851_443_1402 317
21 iso_pu_bacteria 2795385470 2795780049 322
22 3300031456 Ga0307513_10094082 Ga0307513_100940822 323
23 3300031824 Ga0307413_10084924 Ga0307413_100849242 323
24 iso_pu_bacteria 2747842429 2747951957 323
25 iso_pu_bacteria 2870801768 2870802748 323
26 iso_pu_bacteria 2919055335 2919057220 323
27 iso_pu_bacteria 2919523602 2919527232 323
28 iso_pu_bacteria 2928090899 2928091141 323
29 iso_pu_bacteria 2928153084 2928154998 323
30 iso_pu_bacteria 2946080515 2946081475 323
31 iso_pu_bacteria 8004212874 8004213554 323
32 3300005327 Ga0070658_10054031 Ga0070658_100540313 324
33 3300005548 Ga0070665_100052687 Ga0070665_1000526871 324
34 3300005563 Ga0068855_100008484 Ga0068855_1000084848 324
35 3300005578 Ga0068854_100001154 Ga0068854_10000115416 324
36 3300005614 Ga0068856_100216563 Ga0068856_1002165632 324
37 3300009545 Ga0105237_10032723 Ga0105237_100327231 324
38 3300020069 Ga0197907_11239991 Ga0197907_112399911 324
39 3300022467 Ga0224712_10007336 Ga0224712_100073363 324
40 3300025904 Ga0207647_10007075 Ga0207647_100070752 324
41 3300025909 Ga0207705_10080898 Ga0207705_100808982 324
42 3300025913 Ga0207695_10005925 Ga0207695_100059252 324
43 3300025914 Ga0207671_10000052 Ga0207671_10000052173 324
44 3300025924 Ga0207694_10002079 Ga0207694_100020792 324
45 3300025924 Ga0207694_10014307 Ga0207694_100143076 324
46 3300026041 Ga0207639_10062604 Ga0207639_100626043 324
47 3300026067 Ga0207678_10096490 Ga0207678_100964902 324
48 iso_pu_bacteria 2643221597 2643996520 324
49 iso_pu_bacteria 2643221613 2644083660 324
50 iso_pu_bacteria 2643221632 2644180969 324
51 iso_pu_bacteria 2643221635 2644197068 324
52 iso_pu_bacteria 2857740372 2857741356 324
53 iso_pu_bacteria 2887443736 2887445922 324
54 iso_pu_bacteria 2895660088 2895663395 324
55 iso_pu_bacteria 2904497146 2904499830 324
56 iso_pu_bacteria 2904776348 2904776601 324
57 iso_pu_bacteria 2910809715 2910810685 324
58 iso_pu_bacteria 2919034639 2919037724 324
59 iso_pu_bacteria 2919059106 2919061729 324
60 iso_pu_bacteria 2919395869 2919396772 324
61 iso_pu_bacteria 2919538618 2919542134 324
62 iso_pu_bacteria 2932426870 2932429206 324
63 iso_pu_bacteria 2932431166 2932433154 324
64 iso_pu_bacteria 2933418574 2933420690 324
65 iso_pu_bacteria 2935890801 2935891549 324
66 iso_pu_bacteria 2939647034 2939648895 324
67 iso_pu_bacteria 2939674588 2939676097 324
68 iso_pu_bacteria 2945968032 2945971264 324
69 iso_pu_bacteria 8002811521 8002812243 324
70 iso_pu_bacteria 8055037949 8055040546 324
71 3300044684 Ga0466966_0086917 Ga0466966_0086917_666_1730 325
72 iso_pu_bacteria 2643221572 2643874589 325
73 iso_pu_bacteria 2643221669 2644381645 325
74 iso_pu_bacteria 2808606365 2808875227 325
75 iso_pu_bacteria 2919391150 2919391411 325
76 iso_pu_bacteria 2919446982 2919447669 325
77 iso_pu_bacteria 2945941187 2945942424 325
78 iso_pu_bacteria 2945968032 2945970821 325
79 iso_pu_bacteria 2946033335 2946034320 325
80 iso_pu_bacteria 8004021418 8004023429 325
81 iso_pu_bacteria 8004025490 8004026488 325
82 iso_pu_bacteria 8004182704 8004185932 325
83 3300002067 JGI24735J21928_10001295 JGI24735J21928_100012953 326
84 3300005435 Ga0070714_100048548 Ga0070714_1000485483 326
85 3300005455 Ga0070663_100048826 Ga0070663_1000488262 326
86 3300005539 Ga0068853_100238859 Ga0068853_1002388592 326
87 3300009174 Ga0105241_10003430 Ga0105241_100034302 326
88 3300009551 Ga0105238_10038771 Ga0105238_100387711 326
89 3300020070 Ga0206356_10916127 Ga0206356_109161272 326
90 3300020082 Ga0206353_11647894 Ga0206353_116478942 326
91 3300022467 Ga0224712_10057136 Ga0224712_100571361 326
92 3300025253 Ga0209677_100389 Ga0209677_1003895 326
93 3300037312 Ga0395899_0003239 Ga0395899_0003239_6718_7734 326
94 3300037466 Ga0395898_0057258 Ga0395898_0057258_1052_2068 326
95 3300044693 Ga0466961_0038781 Ga0466961_0038781_929_1957 326
96 3300044693 Ga0466961_0069859 Ga0466961_0069859_1069_2088 326
97 3300046454 Ga0495592_0149632 Ga0495592_0149632_202_1227 326
98 3300046516 Ga0495628_0011635 Ga0495628_0011635_3892_4917 326
99 3300046529 Ga0495652_0000755 Ga0495652_0000755_12084_13109 326
100 3300046809 Ga0495600_0022809 Ga0495600_0022809_882_1907 326
101 3300047317 Ga0495604_0225210 Ga0495604_0225210_213_1238 326
102 3300048920 Ga0496117_0014954 Ga0496117_0014954_1725_2768 326
103 3300053078 Ga0495612_0020831 Ga0495612_0020831_255_1301 326
104 iso_pu_bacteria 2675903059 2676484124 326
105 iso_pu_bacteria 2848551377 2848552977 326
106 iso_pu_bacteria 2897561785 2897564092 326
107 iso_pu_bacteria 2904430863 2904431423 326
108 3300002738 JGI25154J39366_1001041 JGI25154J39366_10010418 327
109 3300003559 Ga0007427J51700_118629 Ga0007427J51700_1186293 327
110 3300005366 Ga0070659_100000652 Ga0070659_10000065217 327
111 3300010375 Ga0105239_10143773 Ga0105239_101437734 327
112 3300011119 Ga0105246_10242087 Ga0105246_102420872 327
113 3300025246 Ga0209646_1000134 Ga0209646_100013414 327
114 3300025303 Ga0209051_1002713 Ga0209051_10027138 327
115 3300025315 Ga0207697_10014399 Ga0207697_100143992 327
116 3300025728 Ga0207655_1001640 Ga0207655_10016404 327
117 3300025728 Ga0207655_1002286 Ga0207655_10022862 327
118 3300025932 Ga0207690_10000219 Ga0207690_1000021935 327
119 3300025935 Ga0207709_10322165 Ga0207709_103221651 327
120 3300031548 Ga0307408_100027416 Ga0307408_1000274164 327
121 3300031548 Ga0307408_100060696 Ga0307408_1000606963 327
122 3300031731 Ga0307405_10035101 Ga0307405_100351011 327
123 3300031824 Ga0307413_10004490 Ga0307413_100044903 327
124 3300031852 Ga0307410_10002984 Ga0307410_100029844 327
125 3300031901 Ga0307406_10001795 Ga0307406_100017954 327
126 3300031903 Ga0307407_10007578 Ga0307407_100075783 327
127 3300031911 Ga0307412_10001029 Ga0307412_100010294 327
128 3300031995 Ga0307409_100001261 Ga0307409_1000012617 327
129 3300037312 Ga0395899_0003287 Ga0395899_0003287_4843_5832 327
130 3300038443 Ga0395901_0006746 Ga0395901_0006746_8193_9179 327
131 3300044683 Ga0466965_0050762 Ga0466965_0050762_731_1720 327
132 3300044901 Ga0466960_0014530 Ga0466960_0014530_930_1916 327
133 3300047444 Ga0495675_0166348 Ga0495675_0166348_306_1322 327
134 3300048907 Ga0496104_0010456 Ga0496104_0010456_1150_2136 327
135 3300048908 Ga0496105_0010855 Ga0496105_0010855_5180_6166 327
136 3300048911 Ga0496108_0024451 Ga0496108_0024451_3666_4652 327
137 3300048912 Ga0496109_0008120 Ga0496109_0008120_2458_3444 327
138 3300048914 Ga0496111_0032308 Ga0496111_0032308_1493_2479 327
139 3300048916 Ga0496113_0012072 Ga0496113_0012072_2178_3164 327
140 3300048917 Ga0496114_0123074 Ga0496114_0123074_561_1547 327
141 3300048917 Ga0496114_0142668 Ga0496114_0142668_803_1789 327
142 3300048918 Ga0496115_0078606 Ga0496115_0078606_1497_2483 327
143 3300048925 Ga0496122_0014517 Ga0496122_0014517_4325_5311 327
144 3300048928 Ga0496125_0015589 Ga0496125_0015589_352_1338 327
145 3300048929 Ga0496126_0053015 Ga0496126_0053015_55_1041 327
146 3300049571 Ga0501034_0001989 Ga0501034_0001989_22300_23286 327
147 3300049571 Ga0501034_0026078 Ga0501034_0026078_4700_5686 327
148 3300049573 Ga0501037_0013850 Ga0501037_0013850_1830_2816 327
149 3300049574 Ga0501038_0027063 Ga0501038_0027063_1497_2483 327
150 3300050491 nmdc:mga00v17_53554_c1 nmdc:mga00v17_53554_c1_517_1503 327
151 3300050491 nmdc:mga00v17_86970_c1 nmdc:mga00v17_86970_c1_948_1934 327
152 3300053140 Ga0500573_0019373 Ga0500573_0019373_2828_3850 327
153 iso_pu_bacteria 2537561592 2537898101 327
154 3300001979 JGI24740J21852_10000214 JGI24740J21852_100002147 328
155 3300003320 rootH2_10035357 rootH2_100353572 328
156 3300005329 Ga0070683_100197309 Ga0070683_1001973092 328
157 3300005338 Ga0068868_100023015 Ga0068868_1000230154 328
158 3300005546 Ga0070696_100017840 Ga0070696_1000178405 328
159 3300013104 Ga0157370_10000756 Ga0157370_100007566 328
160 3300013105 Ga0157369_10054755 Ga0157369_100547553 328
161 3300013105 Ga0157369_10144495 Ga0157369_101444952 328
162 3300013308 Ga0157375_10046010 Ga0157375_100460104 328
163 3300025944 Ga0207661_10082447 Ga0207661_100824472 328
164 3300026023 Ga0207677_10002301 Ga0207677_1000230111 328
165 3300031548 Ga0307408_100035983 Ga0307408_1000359832 328
166 3300031548 Ga0307408_100078537 Ga0307408_1000785372 328
167 3300031824 Ga0307413_10081697 Ga0307413_100816972 328
168 3300031852 Ga0307410_10005107 Ga0307410_100051073 328
169 3300031852 Ga0307410_10059704 Ga0307410_100597043 328
170 3300031852 Ga0307410_10193362 Ga0307410_101933622 328
171 3300031901 Ga0307406_10051346 Ga0307406_100513462 328
172 3300031911 Ga0307412_10050069 Ga0307412_100500693 328
173 3300031911 Ga0307412_10110903 Ga0307412_101109032 328
174 3300031911 Ga0307412_10175314 Ga0307412_101753142 328
175 3300031995 Ga0307409_100222227 Ga0307409_1002222272 328
176 3300032002 Ga0307416_100021479 Ga0307416_1000214792 328
177 3300032005 Ga0307411_10084680 Ga0307411_100846802 328
178 3300032126 Ga0307415_100017682 Ga0307415_1000176824 328
179 3300032126 Ga0307415_100121706 Ga0307415_1001217062 328
180 3300037312 Ga0395899_0038604 Ga0395899_0038604_1053_2048 328
181 3300038443 Ga0395901_0132298 Ga0395901_0132298_504_1499 328
182 3300039450 Ga0436363_0656077 Ga0436363_0656077_325_1329 328
183 3300042007 Ga0439449_0011458 Ga0439449_0011458_1374_2369 328
184 3300044656 Ga0466969_0037199 Ga0466969_0037199_1104_2099 328
185 3300044658 Ga0466972_0007037 Ga0466972_0007037_119_1114 328
186 3300044683 Ga0466965_0025479 Ga0466965_0025479_978_1970 328
187 3300044693 Ga0466961_0005857 Ga0466961_0005857_2738_3730 328
188 3300044694 Ga0466963_0015606 Ga0466963_0015606_2211_3203 328
189 3300044719 Ga0466971_0007517 Ga0466971_0007517_2639_3631 328
190 3300044719 Ga0466971_0012856 Ga0466971_0012856_2378_3412 328
191 3300044842 Ga0466957_0042296 Ga0466957_0042296_1173_2165 328
192 3300044901 Ga0466960_0034065 Ga0466960_0034065_38_1096 328
193 3300045836 Ga0466958_0033429 Ga0466958_0033429_1202_2194 328
194 3300045976 Ga0466967_0039300 Ga0466967_0039300_948_1940 328
195 3300046453 Ga0495627_017660 Ga0495627_017660_192_1193 328
196 3300046455 Ga0495603_0010025 Ga0495603_0010025_4169_5191 328
197 3300046459 Ga0495629_0002355 Ga0495629_0002355_2280_3302 328
198 3300046463 Ga0495653_0009593 Ga0495653_0009593_294_1289 328
199 3300046477 Ga0495664_0033059 Ga0495664_0033059_1438_2433 328
200 3300046531 Ga0495665_0001398 Ga0495665_0001398_6765_7760 328
201 3300046543 Ga0495645_0000579 Ga0495645_0000579_16032_17027 328
202 3300046674 Ga0495588_0012387 Ga0495588_0012387_34_1029 328
203 3300046679 Ga0495623_0005576 Ga0495623_0005576_2020_3015 328
204 3300046684 Ga0495669_0019595 Ga0495669_0019595_749_1768 328
205 3300046689 Ga0495613_0007381 Ga0495613_0007381_3014_4036 328
206 3300047315 Ga0495581_0048034 Ga0495581_0048034_673_1668 328
207 3300047321 Ga0495676_0014428 Ga0495676_0014428_2190_3212 328
208 3300047444 Ga0495675_0106120 Ga0495675_0106120_250_1245 328
209 3300047445 Ga0495677_0038216 Ga0495677_0038216_421_1416 328
210 3300047673 Ga0495593_0057832 Ga0495593_0057832_956_1951 328
211 3300048089 Ga0495614_0000406 Ga0495614_0000406_5113_6135 328
212 3300048903 Ga0496100_0000455 Ga0496100_0000455_3108_4103 328
213 3300048904 Ga0496101_0002162 Ga0496101_0002162_1089_2084 328
214 3300048905 Ga0496102_0028567 Ga0496102_0028567_2701_3696 328
215 3300048905 Ga0496102_0029192 Ga0496102_0029192_609_1604 328
216 3300048905 Ga0496102_0035487 Ga0496102_0035487_2593_3588 328
217 3300048905 Ga0496102_0124017 Ga0496102_0124017_771_1769 328
218 3300048906 Ga0496103_0002365 Ga0496103_0002365_1359_2354 328
219 3300048906 Ga0496103_0012673 Ga0496103_0012673_411_1415 328
220 3300048906 Ga0496103_0034874 Ga0496103_0034874_892_1887 328
221 3300048908 Ga0496105_0022120 Ga0496105_0022120_4121_5119 328
222 3300048908 Ga0496105_0048513 Ga0496105_0048513_101_1099 328
223 3300048909 Ga0496106_0002488 Ga0496106_0002488_6758_7753 328
224 3300048909 Ga0496106_0051957 Ga0496106_0051957_647_1642 328
225 3300048910 Ga0496107_0003315 Ga0496107_0003315_2701_3696 328
226 3300048911 Ga0496108_0016724 Ga0496108_0016724_501_1496 328
227 3300048912 Ga0496109_0020207 Ga0496109_0020207_3984_4979 328
228 3300048913 Ga0496110_0018778 Ga0496110_0018778_4780_5775 328
229 3300048916 Ga0496113_0123380 Ga0496113_0123380_452_1447 328
230 3300048917 Ga0496114_0016350 Ga0496114_0016350_3247_4251 328
231 3300048917 Ga0496114_0111520 Ga0496114_0111520_1110_2105 328
232 3300048918 Ga0496115_0002415 Ga0496115_0002415_9192_10190 328
233 3300048918 Ga0496115_0152754 Ga0496115_0152754_551_1555 328
234 3300048920 Ga0496117_0004661 Ga0496117_0004661_5563_6555 328
235 3300048921 Ga0496118_0083450 Ga0496118_0083450_72_1070 328
236 3300048928 Ga0496125_0053311 Ga0496125_0053311_165_1169 328
237 3300048929 Ga0496126_0184190 Ga0496126_0184190_39_1037 328
238 3300049161 Ga0501305_001353 Ga0501305_001353_894_1889 328
239 3300049527 Ga0501311_001123 Ga0501311_001123_139_1134 328
240 3300049527 Ga0501311_001899 Ga0501311_001899_452_1447 328
241 3300049528 Ga0501312_003562 Ga0501312_003562_330_1325 328
242 3300049529 Ga0501313_001989 Ga0501313_001989_394_1389 328
243 3300049533 Ga0501317_003176 Ga0501317_003176_170_1165 328
244 3300049533 Ga0501317_004919 Ga0501317_004919_267_1292 328
245 3300049534 Ga0501318_001137 Ga0501318_001137_868_1863 328
246 3300049534 Ga0501318_009083 Ga0501318_009083_28_1023 328
247 3300049535 Ga0501319_000327 Ga0501319_000327_33_1028 328
248 3300049537 Ga0501321_000679 Ga0501321_000679_991_1986 328
249 3300049539 Ga0501323_000263 Ga0501323_000263_1661_2656 328
250 3300049575 Ga0501039_0158980 Ga0501039_0158980_116_1114 328
251 3300049822 Ga0501035_0010090 Ga0501035_0010090_2302_3324 328
252 3300049823 Ga0501044_0071092 Ga0501044_0071092_1564_2586 328
253 3300049824 Ga0501045_0021117 Ga0501045_0021117_255_1253 328
254 3300049824 Ga0501045_0094407 Ga0501045_0094407_536_1534 328
255 3300053080 Ga0500635_0000004 Ga0500635_0000004_128186_129187 328
256 3300053083 Ga0495655_0004955 Ga0495655_0004955_859_1941 328
257 3300059510 Ga0587090_000422 Ga0587090_000422_1583_2578 328
258 3300059660 Ga0587124_001756 Ga0587124_001756_78_1073 328
259 3300061719 Ga0466962_0004198 Ga0466962_0004198_3572_4606 328
260 3300061719 Ga0466962_0012896 Ga0466962_0012896_926_1918 328
261 iso_pu_bacteria 2731639228 2731908765 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

103

214

0.94

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

3

112

0.89

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

107

305

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9257 1 321
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9204 1 321
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9163 1 321
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9141 1 321
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.911 1 321
ID Description Score Start End Superfamily
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9446 3 116 3.30.360.10
af_A0A1D8PQS5_5_151_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 1 139 3.40.50.720
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 1 116 3.40.50.720
af_P77503_5_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 2 132 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9269 3 121 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A836BGI8-F1-model_v4 Oxidoreductase domain-containing protein 0.968 53 328 GO:0000166
GO:0016491
AF-A0A836BIF0-F1-model_v4 GFO/IDH/MocA-like oxidoreductase domain-containing protein 0.9625 143 328
AF-A0A534N3G6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9614 2 231 GO:0000166
GO:0016491
AF-A0A836BGI8-F1-model_v4 Oxidoreductase domain-containing protein 0.9535 53 328 GO:0000166
GO:0016491
AF-A0A358G524-F1-model_v4 deleted 0.9503 2 109

Feature Viewer

pLDDT pTM Quality
93.77 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map