F369925

General Info

Members Datasets Scaffolds Average Seq Length
260 191 520 208

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0015923|Ga0500644_0015923_1301_2026
Length 241
Sequence MVNRFFTIVTIVPCRQRTLISINHAGRELKGKAIAMPLQNRVTPFGEIVAIAQRGLMMGNRGIIHDPATKTLLQRRWAGKAWLICVCDYKGRRRDVMATRSWTELFFLDEAVALAAGHRPCFFCRRDAALAFSAAWGPAKGCRQPTAGEMDDVLHAERLDNGRKRIHPLPMAIPELPDGAVVVHASDAFTIAAGLAFRWTELGYEPPCKLRDADGLLTPPSTLIALRSGYRPILKVGTAIP

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
33 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
35 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
59 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
155 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
158 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
159 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
160 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
161 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
173 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
174 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
180 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
183 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
187 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
188 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
189 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
190 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
191 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.08
Nodule 0.77
Rhizoplane 3.46
Rhizosphere 55.77
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0015923 3300053088 Bacteria 2156
2 JGI25406J46586_10000125 3300003203 Bacteria 33575
3 Ga0055526_1013876 3300003771 Bacteria 3366
4 Ga0070658_10455019 3300005327 Bacteria 1103
5 Ga0070689_100544230 3300005340 Bacteria 999
6 Ga0070668_100055117 3300005347 Bacteria 3068
7 Ga0070669_100188946 3300005353 Bacteria 1615
8 Ga0070671_100903657 3300005355 Bacteria 771
9 Ga0070674_100047489 3300005356 Bacteria 2942
10 Ga0070673_100240469 3300005364 Bacteria 1574
11 Ga0070659_100095151 3300005366 Bacteria 2392
12 Ga0070663_100290709 3300005455 Bacteria 1305
13 Ga0070663_100296726 3300005455 Bacteria 1292
14 Ga0070663_100435469 3300005455 Bacteria 1078
15 Ga0070678_100049716 3300005456 Bacteria 3027
16 Ga0070662_100150848 3300005457 Bacteria 1809
17 Ga0070662_100750094 3300005457 Bacteria 828
18 Ga0070686_100187531 3300005544 Bacteria 1474
19 Ga0068860_100006537 3300005843 Bacteria 11700
20 Ga0081539_10000255 3300005985 Bacteria 123054
21 Ga0075365_10138672 3300006038 Bacteria 1687
22 Ga0075365_10540045 3300006038 Bacteria 824
23 Ga0075364_10074818 3300006051 Bacteria 2234
24 Ga0070712_100107260 3300006175 Bacteria 2078
25 Ga0075369_10095231 3300006186 Bacteria 1331
26 Ga0075369_10121347 3300006186 Bacteria 1183
27 Ga0097621_100324251 3300006237 Bacteria 1365
28 Ga0075434_100022476 3300006871 Bacteria 6142
29 Ga0075435_100184525 3300007076 Bacteria 1764
30 Ga0105245_10062446 3300009098 Bacteria 3361
31 Ga0105247_10229298 3300009101 Bacteria 1260
32 Ga0105243_10058458 3300009148 Bacteria 3073
33 Ga0105243_10432098 3300009148 Bacteria 1231
34 Ga0105239_10202315 3300010375 Bacteria 2225
35 Ga0163162_11301237 3300013306 Bacteria 826
36 Ga0157380_10230117 3300014326 Bacteria 1664
37 Ga0163161_10194373 3300017792 Bacteria 1561
38 Ga0209646_1006166 3300025246 Bacteria 2029
39 Ga0209148_1019055 3300025254 Bacteria 1144
40 Ga0209233_1017080 3300025261 Bacteria 1984
41 Ga0209455_1005202 3300025272 Bacteria 4074
42 Ga0209564_1000297 3300025295 Bacteria 100091
43 Ga0209564_1009375 3300025295 Bacteria 4669
44 Ga0207682_10285617 3300025893 Bacteria 772
45 Ga0207710_10065429 3300025900 Bacteria 1657
46 Ga0207705_10340722 3300025909 Bacteria 1154
47 Ga0207693_10141748 3300025915 Bacteria 1890
48 Ga0207663_10209793 3300025916 Bacteria 1411
49 Ga0207681_10203258 3300025923 Bacteria 1522
50 Ga0207644_11062329 3300025931 Bacteria 680
51 Ga0207706_10113977 3300025933 Bacteria 2378
52 Ga0207669_10039387 3300025937 Bacteria 2730
53 Ga0207667_11311118 3300025949 Bacteria 700
54 Ga0207651_10042591 3300025960 Bacteria 3023
55 Ga0207668_10024443 3300025972 Bacteria 3899
56 Ga0207708_10541805 3300026075 Bacteria 980
57 Ga0207675_100122180 3300026118 Bacteria 2465
58 Ga0207683_10147211 3300026121 Bacteria 2124
59 Ga0268266_10123863 3300028379 Bacteria 2304
60 Ga0268266_10942520 3300028379 Bacteria 835
61 Ga0268264_10000035 3300028381 Bacteria 398196
62 Ga0268264_10419938 3300028381 Unclassified 1289
63 Ga0265328_10056759 3300031239 Bacteria 1437
64 Ga0307509_10566898 3300031507 Bacteria 811
65 Ga0307508_10136673 3300031616 Bacteria 2054
66 Ga0307516_10176323 3300031730 Bacteria 1874
67 Ga0373950_0009393 3300034818 Bacteria 1561
68 Ga0373957_0016733 3300035120 Bacteria 2544
69 Ga0373943_0089917 3300035170 Bacteria 1589
70 Ga0373935_0060692 3300035692 Bacteria 2419
71 Ga0373927_0017751 3300035695 Bacteria 4681
72 Ga0373933_0093300 3300035724 Bacteria 1860
73 Ga0373947_0421768 3300035725 Bacteria 902
74 Ga0373925_0451609 3300037068 Unclassified 1052
75 Ga0373925_0722130 3300037068 Bacteria 821
76 Ga0451841_0848998 3300041498 Bacteria 893
77 Ga0466970_0186795 3300044765 Bacteria 1151
78 Ga0495592_0170601 3300046454 Bacteria 1490
79 Ga0495629_0076659 3300046459 Bacteria 2334
80 Ga0495638_0099998 3300046460 Bacteria 1735
81 Ga0495638_0102628 3300046460 Bacteria 1708
82 Ga0495638_0253858 3300046460 Bacteria 968
83 Ga0495651_0118889 3300046462 Bacteria 1944
84 Ga0495653_0039079 3300046463 Bacteria 3720
85 Ga0495662_0151630 3300046476 Bacteria 1142
86 Ga0495606_0004247 3300046507 Bacteria 14485
87 Ga0495610_0032084 3300046512 Bacteria 2734
88 Ga0495620_0031887 3300046515 Bacteria 2408
89 Ga0495654_0034391 3300046530 Bacteria 2557
90 Ga0495645_0011359 3300046543 Bacteria 6264
91 Ga0495622_0024113 3300046557 Bacteria 2840
92 Ga0495633_0196482 3300046558 Bacteria 927
93 Ga0495656_0104062 3300046615 Bacteria 1317
94 Ga0495634_0568842 3300046642 Bacteria 660
95 Ga0495611_0163207 3300046648 Bacteria 1041
96 Ga0495625_0050943 3300046660 Bacteria 2969
97 Ga0495635_0045942 3300046663 Bacteria 3012
98 Ga0495659_0061153 3300046664 Bacteria 1391
99 Ga0495588_0268470 3300046674 Bacteria 899
100 Ga0495599_0021603 3300046678 Bacteria 4017
101 Ga0495646_0072685 3300046680 Bacteria 2022
102 Ga0495669_0014084 3300046684 Bacteria 3417
103 Ga0495670_0002385 3300046691 Bacteria 9256
104 Ga0495671_0117653 3300046692 Bacteria 1297
105 Ga0495604_0085006 3300047317 Bacteria 2361
106 Ga0495680_0090148 3300047322 Bacteria 2300
107 Ga0495683_0208732 3300047323 Bacteria 877
108 Ga0495677_0113643 3300047445 Bacteria 1030
109 Ga0495681_0211492 3300047470 Bacteria 782
110 Ga0495686_0026779 3300047472 Bacteria 3771
111 Ga0495602_0038377 3300048088 Bacteria 4429
112 Ga0495626_0094265 3300048091 Bacteria 1313
113 Ga0496100_0333199 3300048903 Bacteria 1143
114 Ga0496102_0871922 3300048905 Bacteria 822
115 Ga0496106_0000933 3300048909 Bacteria 21283
116 Ga0496106_0466140 3300048909 Unclassified 1015
117 Ga0496112_0000016 3300048915 Bacteria 194634
118 Ga0496114_0161140 3300048917 Bacteria 1951
119 Ga0496114_0335105 3300048917 Bacteria 1338
120 Ga0496115_0000019 3300048918 Bacteria 180097
121 Ga0496116_0003781 3300048919 Bacteria 14794
122 Ga0496116_0126625 3300048919 Bacteria 1466
123 Ga0496116_0242988 3300048919 Bacteria 903
124 Ga0496117_0158876 3300048920 Bacteria 1327
125 Ga0496117_0194557 3300048920 Bacteria 1151
126 Ga0496117_0200907 3300048920 Bacteria 1126
127 Ga0496117_0240167 3300048920 Bacteria 995
128 Ga0496118_0013089 3300048921 Bacteria 7884
129 Ga0496118_0025668 3300048921 Bacteria 5043
130 Ga0496118_0028123 3300048921 Bacteria 4743
131 Ga0496118_0110047 3300048921 Bacteria 1831
132 Ga0496118_0256723 3300048921 Bacteria 989
133 Ga0496119_0043482 3300048922 Bacteria 2837
134 Ga0496119_0123755 3300048922 Bacteria 1417
135 Ga0496119_0204913 3300048922 Bacteria 1018
136 Ga0496120_0069377 3300048923 Bacteria 1941
137 Ga0496120_0212883 3300048923 Bacteria 928
138 Ga0496121_0001443 3300048924 Bacteria 40145
139 Ga0496121_0004775 3300048924 Bacteria 17874
140 Ga0496121_0006578 3300048924 Bacteria 14342
141 Ga0496121_0035303 3300048924 Bacteria 4483
142 Ga0496122_0026944 3300048925 Bacteria 4934
143 Ga0496124_0001386 3300048927 Bacteria 36318
144 Ga0496124_0002203 3300048927 Bacteria 25990
145 Ga0496124_0146549 3300048927 Bacteria 1857
146 Ga0496124_0650226 3300048927 Bacteria 677
147 Ga0496125_0001341 3300048928 Bacteria 36276
148 Ga0496125_0009813 3300048928 Bacteria 9756
149 Ga0496125_0085910 3300048928 Bacteria 2382
150 Ga0496125_0235935 3300048928 Bacteria 1165
151 Ga0496126_0000165 3300048929 Bacteria 152576
152 Ga0496126_0001307 3300048929 Bacteria 39693
153 Ga0496126_0022619 3300048929 Bacteria 6110
154 Ga0496126_0201126 3300048929 Bacteria 1682
155 Ga0496126_0219306 3300048929 Bacteria 1598
156 Ga0496126_0478593 3300048929 Bacteria 998
157 Ga0501031_0041020 3300049568 Bacteria 3022
158 Ga0501031_0052696 3300049568 Bacteria 2651
159 Ga0501032_0014863 3300049569 Bacteria 5508
160 Ga0501032_0314387 3300049569 Bacteria 1011
161 Ga0501033_0000767 3300049570 Bacteria 29521
162 Ga0501034_0044590 3300049571 Bacteria 4484
163 Ga0501034_0180936 3300049571 Bacteria 2073
164 Ga0501034_0449409 3300049571 Bacteria 1206
165 Ga0501034_0477958 3300049571 Bacteria 1161
166 Ga0501036_0101264 3300049572 Bacteria 2437
167 Ga0501036_0101900 3300049572 Bacteria 2428
168 Ga0501036_0202041 3300049572 Bacteria 1671
169 Ga0501037_0013860 3300049573 Bacteria 5941
170 Ga0501038_0033715 3300049574 Bacteria 4507
171 Ga0501038_0047498 3300049574 Bacteria 3718
172 Ga0501038_0075470 3300049574 Bacteria 2849
173 Ga0501039_0024656 3300049575 Bacteria 4620
174 Ga0501039_0051760 3300049575 Bacteria 3177
175 Ga0501039_0338481 3300049575 Bacteria 1182
176 Ga0501042_0068825 3300049578 Bacteria 2531
177 Ga0501043_0007511 3300049579 Bacteria 8657
178 Ga0501043_0031780 3300049579 Bacteria 4150
179 Ga0501046_0019051 3300049580 Bacteria 5696
180 Ga0501046_0074018 3300049580 Bacteria 2642
181 Ga0501046_0101919 3300049580 Bacteria 2201
182 Ga0501047_0214686 3300049581 Bacteria 1781
183 Ga0501048_0034129 3300049582 Bacteria 3673
184 Ga0501067_0061242 3300049583 Bacteria 2083
185 Ga0501067_0405116 3300049583 Bacteria 761
186 Ga0501069_0004603 3300049585 Bacteria 7135
187 Ga0501072_0034746 3300049588 Bacteria 3950
188 Ga0501074_0100926 3300049590 Bacteria 2065
189 Ga0501075_0116950 3300049591 Bacteria 2027
190 Ga0501077_0025312 3300049593 Bacteria 3770
191 Ga0501079_0524169 3300049741 Bacteria 932
192 Ga0501080_0480198 3300049742 Unclassified 1112
193 Ga0501083_0063480 3300049744 Bacteria 2463
194 Ga0501035_0006708 3300049822 Bacteria 10760
195 Ga0501035_0017148 3300049822 Bacteria 6673
196 Ga0501035_0069605 3300049822 Bacteria 3118
197 Ga0501035_0169881 3300049822 Bacteria 1884
198 Ga0501044_0027221 3300049823 Bacteria 6044
199 Ga0501044_0037392 3300049823 Bacteria 5074
200 Ga0501044_0193013 3300049823 Bacteria 1998
201 Ga0501045_0004796 3300049824 Bacteria 9341
202 nmdc:mga00v17_72263_c1 3300050491 Bacteria 2140
203 nmdc:mga0yw44_10668_c1 3300050492 Bacteria 4704
204 nmdc:mga0n895_3366_c1 3300050512 Bacteria 12859
205 nmdc:mga0rr50_45966_c1 3300050513 Bacteria 3212
206 nmdc:mga0sz30_198713_c1 3300050516 Bacteria 890
207 Ga0495601_0027235 3300053077 Bacteria 3533
208 Ga0495612_0121156 3300053078 Bacteria 1125
209 Ga0500635_0185895 3300053080 Bacteria 804
210 Ga0500578_0496475 3300053086 Bacteria 687
211 Ga0500644_0024497 3300053088 Bacteria 1845
212 Ga0500651_0002950 3300053093 Bacteria 9157
213 Ga0500651_0081590 3300053093 Bacteria 2002
214 Ga0500566_0031112 3300053094 Bacteria 3112
215 Ga0500641_0012479 3300053096 Bacteria 3104
216 Ga0500641_0022526 3300053096 Bacteria 2413
217 Ga0500650_0036143 3300053098 Bacteria 2265
218 Ga0500554_067956 3300053102 Bacteria 1155
219 Ga0500556_0000024 3300053104 Bacteria 167556
220 Ga0500562_005251 3300053108 Bacteria 3254
221 Ga0500562_138467 3300053108 Bacteria 663
222 Ga0500569_007181 3300053109 Bacteria 2486
223 Ga0500592_000573 3300053116 Bacteria 6093
224 Ga0500593_027607 3300053117 Bacteria 2534
225 Ga0500594_0037906 3300053118 Bacteria 1304
226 Ga0500595_003481 3300053119 Bacteria 7328
227 Ga0500607_182971 3300053121 Bacteria 926
228 Ga0500608_028378 3300053122 Bacteria 2641
229 Ga0500618_005018 3300053125 Bacteria 4089
230 Ga0500642_0000035 3300053130 Bacteria 106656
231 Ga0500652_000404 3300053131 Bacteria 15463
232 Ga0500658_0141742 3300053134 Bacteria 1078
233 Ga0500559_0006017 3300053136 Bacteria 5508
234 Ga0500559_0013655 3300053136 Bacteria 3436
235 Ga0500559_0058119 3300053136 Bacteria 1719
236 Ga0500564_255281 3300053138 Bacteria 693
237 Ga0500568_0005040 3300053139 Bacteria 6916
238 Ga0500568_0044078 3300053139 Bacteria 1781
239 Ga0500573_0016201 3300053140 Bacteria 4228
240 Ga0500577_0001147 3300053142 Bacteria 6786
241 Ga0500586_002475 3300053145 Bacteria 4181
242 Ga0500590_054399 3300053148 Bacteria 2027
243 Ga0500604_0017608 3300053151 Bacteria 1980
244 Ga0500616_0000122 3300053153 Bacteria 140228
245 Ga0500622_0000471 3300053156 Bacteria 37968
246 Ga0500622_0000790 3300053156 Bacteria 27440
247 Ga0500624_014393 3300053157 Bacteria 1196
248 Ga0500633_0218796 3300053160 Bacteria 711
249 Ga0500636_0006371 3300053177 Bacteria 6769
250 Ga0500636_0045990 3300053177 Bacteria 2573
251 Ga0500609_005597 3300053731 Bacteria 1717
252 Ga0500596_019279 3300053735 Bacteria 1024
253 Ga0501084_0613928 3300054114 Bacteria 919
254 Ga0500661_011654 3300055283 Bacteria 1589
255 2603861103 2602042107 Bacteria 6226103
256 2617380818 2617270742 Bacteria 6808054
257 2842485760 2842482326 Bacteria 7212537
258 2857528768 2857524615 Bacteria 6615449
259 2893068963 2893066018 Bacteria 6158120
260 2919079196 2919073203 Bacteria 6531949
261 Ga0500644_0015923
262 JGI25406J46586_10000125
263 Ga0055526_1013876
264 Ga0070658_10455019
265 Ga0070689_100544230
266 Ga0070668_100055117
267 Ga0070669_100188946
268 Ga0070671_100903657
269 Ga0070674_100047489
270 Ga0070673_100240469
271 Ga0070659_100095151
272 Ga0070663_100290709
273 Ga0070663_100296726
274 Ga0070663_100435469
275 Ga0070678_100049716
276 Ga0070662_100150848
277 Ga0070662_100750094
278 Ga0070686_100187531
279 Ga0068860_100006537
280 Ga0081539_10000255
281 Ga0075365_10138672
282 Ga0075365_10540045
283 Ga0075364_10074818
284 Ga0070712_100107260
285 Ga0075369_10095231
286 Ga0075369_10121347
287 Ga0097621_100324251
288 Ga0075434_100022476
289 Ga0075435_100184525
290 Ga0105245_10062446
291 Ga0105247_10229298
292 Ga0105243_10058458
293 Ga0105243_10432098
294 Ga0105239_10202315
295 Ga0163162_11301237
296 Ga0157380_10230117
297 Ga0163161_10194373
298 Ga0209646_1006166
299 Ga0209148_1019055
300 Ga0209233_1017080
301 Ga0209455_1005202
302 Ga0209564_1000297
303 Ga0209564_1009375
304 Ga0207682_10285617
305 Ga0207710_10065429
306 Ga0207705_10340722
307 Ga0207693_10141748
308 Ga0207663_10209793
309 Ga0207681_10203258
310 Ga0207644_11062329
311 Ga0207706_10113977
312 Ga0207669_10039387
313 Ga0207667_11311118
314 Ga0207651_10042591
315 Ga0207668_10024443
316 Ga0207708_10541805
317 Ga0207675_100122180
318 Ga0207683_10147211
319 Ga0268266_10123863
320 Ga0268266_10942520
321 Ga0268264_10000035
322 Ga0268264_10419938
323 Ga0265328_10056759
324 Ga0307509_10566898
325 Ga0307508_10136673
326 Ga0307516_10176323
327 Ga0373950_0009393
328 Ga0373957_0016733
329 Ga0373943_0089917
330 Ga0373935_0060692
331 Ga0373927_0017751
332 Ga0373933_0093300
333 Ga0373947_0421768
334 Ga0373925_0451609
335 Ga0373925_0722130
336 Ga0451841_0848998
337 Ga0466970_0186795
338 Ga0495592_0170601
339 Ga0495629_0076659
340 Ga0495638_0099998
341 Ga0495638_0102628
342 Ga0495638_0253858
343 Ga0495651_0118889
344 Ga0495653_0039079
345 Ga0495662_0151630
346 Ga0495606_0004247
347 Ga0495610_0032084
348 Ga0495620_0031887
349 Ga0495654_0034391
350 Ga0495645_0011359
351 Ga0495622_0024113
352 Ga0495633_0196482
353 Ga0495656_0104062
354 Ga0495634_0568842
355 Ga0495611_0163207
356 Ga0495625_0050943
357 Ga0495635_0045942
358 Ga0495659_0061153
359 Ga0495588_0268470
360 Ga0495599_0021603
361 Ga0495646_0072685
362 Ga0495669_0014084
363 Ga0495670_0002385
364 Ga0495671_0117653
365 Ga0495604_0085006
366 Ga0495680_0090148
367 Ga0495683_0208732
368 Ga0495677_0113643
369 Ga0495681_0211492
370 Ga0495686_0026779
371 Ga0495602_0038377
372 Ga0495626_0094265
373 Ga0496100_0333199
374 Ga0496102_0871922
375 Ga0496106_0000933
376 Ga0496106_0466140
377 Ga0496112_0000016
378 Ga0496114_0161140
379 Ga0496114_0335105
380 Ga0496115_0000019
381 Ga0496116_0003781
382 Ga0496116_0126625
383 Ga0496116_0242988
384 Ga0496117_0158876
385 Ga0496117_0194557
386 Ga0496117_0200907
387 Ga0496117_0240167
388 Ga0496118_0013089
389 Ga0496118_0025668
390 Ga0496118_0028123
391 Ga0496118_0110047
392 Ga0496118_0256723
393 Ga0496119_0043482
394 Ga0496119_0123755
395 Ga0496119_0204913
396 Ga0496120_0069377
397 Ga0496120_0212883
398 Ga0496121_0001443
399 Ga0496121_0004775
400 Ga0496121_0006578
401 Ga0496121_0035303
402 Ga0496122_0026944
403 Ga0496124_0001386
404 Ga0496124_0002203
405 Ga0496124_0146549
406 Ga0496124_0650226
407 Ga0496125_0001341
408 Ga0496125_0009813
409 Ga0496125_0085910
410 Ga0496125_0235935
411 Ga0496126_0000165
412 Ga0496126_0001307
413 Ga0496126_0022619
414 Ga0496126_0201126
415 Ga0496126_0219306
416 Ga0496126_0478593
417 Ga0501031_0041020
418 Ga0501031_0052696
419 Ga0501032_0014863
420 Ga0501032_0314387
421 Ga0501033_0000767
422 Ga0501034_0044590
423 Ga0501034_0180936
424 Ga0501034_0449409
425 Ga0501034_0477958
426 Ga0501036_0101264
427 Ga0501036_0101900
428 Ga0501036_0202041
429 Ga0501037_0013860
430 Ga0501038_0033715
431 Ga0501038_0047498
432 Ga0501038_0075470
433 Ga0501039_0024656
434 Ga0501039_0051760
435 Ga0501039_0338481
436 Ga0501042_0068825
437 Ga0501043_0007511
438 Ga0501043_0031780
439 Ga0501046_0019051
440 Ga0501046_0074018
441 Ga0501046_0101919
442 Ga0501047_0214686
443 Ga0501048_0034129
444 Ga0501067_0061242
445 Ga0501067_0405116
446 Ga0501069_0004603
447 Ga0501072_0034746
448 Ga0501074_0100926
449 Ga0501075_0116950
450 Ga0501077_0025312
451 Ga0501079_0524169
452 Ga0501080_0480198
453 Ga0501083_0063480
454 Ga0501035_0006708
455 Ga0501035_0017148
456 Ga0501035_0069605
457 Ga0501035_0169881
458 Ga0501044_0027221
459 Ga0501044_0037392
460 Ga0501044_0193013
461 Ga0501045_0004796
462 nmdc:mga00v17_72263_c1
463 nmdc:mga0yw44_10668_c1
464 nmdc:mga0n895_3366_c1
465 nmdc:mga0rr50_45966_c1
466 nmdc:mga0sz30_198713_c1
467 Ga0495601_0027235
468 Ga0495612_0121156
469 Ga0500635_0185895
470 Ga0500578_0496475
471 Ga0500644_0024497
472 Ga0500651_0002950
473 Ga0500651_0081590
474 Ga0500566_0031112
475 Ga0500641_0012479
476 Ga0500641_0022526
477 Ga0500650_0036143
478 Ga0500554_067956
479 Ga0500556_0000024
480 Ga0500562_005251
481 Ga0500562_138467
482 Ga0500569_007181
483 Ga0500592_000573
484 Ga0500593_027607
485 Ga0500594_0037906
486 Ga0500595_003481
487 Ga0500607_182971
488 Ga0500608_028378
489 Ga0500618_005018
490 Ga0500642_0000035
491 Ga0500652_000404
492 Ga0500658_0141742
493 Ga0500559_0006017
494 Ga0500559_0013655
495 Ga0500559_0058119
496 Ga0500564_255281
497 Ga0500568_0005040
498 Ga0500568_0044078
499 Ga0500573_0016201
500 Ga0500577_0001147
501 Ga0500586_002475
502 Ga0500590_054399
503 Ga0500604_0017608
504 Ga0500616_0000122
505 Ga0500622_0000471
506 Ga0500622_0000790
507 Ga0500624_014393
508 Ga0500633_0218796
509 Ga0500636_0006371
510 Ga0500636_0045990
511 Ga0500609_005597
512 Ga0500596_019279
513 Ga0501084_0613928
514 Ga0500661_011654
515 2603861103
516 2617380818
517 2842485760
518 2857528768
519 2893068963
520 2919079196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7npr-assembly1.cif.gz_B6 structure of an intact esx-5 inner membrane complex, composite c3 model 0.5649 129 163
5yvd-assembly1.cif.gz_A structural and biochemical characterization of endoribonuclease nsp15 encoded by middle east respiratory syndrome coronavirus 0.4498 132 175
8q00-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.388 127 196
8q00-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.382 127 197
1u8b-assembly1.cif.gz_A crystal structure of the methylated n-ada/dna complex 0.3551 48 119
ID Description Score Start End Superfamily
af_Q94K34_104_312_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6317 141 172 2.120.10.80
af_Q9T0E4_120_339_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6027 146 172 2.120.10.80
af_Q9FFV5_50_236_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5974 144 174 2.120.10.80
af_Q4DG39_137_476_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.5857 143 170 3.90.70.10
af_Q9M0E6_81_305_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5661 139 174 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A7W6ZVD4-F1-model_v4 Uncharacterized protein 0.9362 80 200
AF-A0A849E876-F1-model_v4 Uncharacterized protein 0.9287 74 198
AF-A0A7Y5W2G8-F1-model_v4 Uncharacterized protein 0.9263 68 194
AF-A0A7V9PER9-F1-model_v4 Uncharacterized protein 0.9137 136 196
AF-A0A3N6N3R0-F1-model_v4 Uncharacterized protein 0.9124 1 202

Map