F369913

General Info

Members Datasets Scaffolds Average Seq Length
260 144 520 304

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_62566_c1|nmdc:mga0yw44_62566_c1_869_2086
Length 356
Sequence MLLDSASMYFRAFFGVPEITNDEGTPVNAVRGFMDFISRLVEQYDPDRLVCCWDNDWRPAWRVELIPTYKTHRVVVEVASGPDVEEVPDPLEIQVPIILEVLDAFGICVRGAEGYEADDVIGTLATGAGGPVDVVTGDRDLFQLVDDDAGVRVLYIARGVGNHERVDNAWVRGKYGIEAAQYADFATLRGDASDGLPGVAGIGEKTAATLLSRFGDMAGILAAAQDPDSELGPGPRGKVKAAAEYLEVAPRVVAVARDLDLDRTGLDRPVTPRDPDLVASLASKYNLEGPATRLVEAPQRGLTRPLVRWRACPASPSSGATARWPDTCWSHCAAPSTTRSHWYGRSASGPSTWKAR

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
63 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
64 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
65 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
126 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2643221576 Nocardioides sp. Root614 Isolate Unclassified
134 2643221590 Nocardioides sp. Root682 Isolate Unclassified
135 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
136 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
137 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
138 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
139 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
140 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
141 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
142 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
143 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
144 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 1.15
Bulb 0
Endosphere 20
Nodule 0
Rhizoplane 12.69
Rhizosphere 63.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_62566_c1 3300050492 Bacteria 2286
2 LJQas_1001856 3300000549 Bacteria 3071
3 Ga0070683_100007950 3300005329 Bacteria 8996
4 Ga0070683_100026348 3300005329 Bacteria 5233
5 Ga0070683_100103269 3300005329 Bacteria 2686
6 Ga0070682_100017718 3300005337 Bacteria 4154
7 Ga0070692_10011544 3300005345 Bacteria 4059
8 Ga0070674_100098864 3300005356 Bacteria 2121
9 Ga0070659_100043152 3300005366 Bacteria 3527
10 Ga0070667_100026598 3300005367 Bacteria 4813
11 Ga0070667_100159992 3300005367 Bacteria 1983
12 Ga0070678_100221437 3300005456 Bacteria 1573
13 Ga0070684_100005626 3300005535 Bacteria 9634
14 Ga0070684_100445192 3300005535 Bacteria 1197
15 Ga0070693_100025248 3300005547 Bacteria 3196
16 Ga0070665_100000522 3300005548 Bacteria 54684
17 Ga0070665_100228879 3300005548 Bacteria 1859
18 Ga0068855_100099722 3300005563 Bacteria 3345
19 Ga0070664_100223831 3300005564 Bacteria 1684
20 Ga0068857_100017060 3300005577 Bacteria 6359
21 Ga0068856_100016885 3300005614 Bacteria 7075
22 Ga0070702_100026819 3300005615 Bacteria 3101
23 Ga0068861_100373860 3300005719 Bacteria 1257
24 Ga0068861_100387984 3300005719 Bacteria 1236
25 Ga0068870_10137780 3300005840 Bacteria 1425
26 Ga0068858_100054658 3300005842 Bacteria 3692
27 Ga0068860_100000882 3300005843 Bacteria 33314
28 Ga0068860_100056166 3300005843 Bacteria 3744
29 Ga0075365_10008642 3300006038 Bacteria 5799
30 Ga0075365_10025226 3300006038 Bacteria 3762
31 Ga0075365_10026302 3300006038 Bacteria 3693
32 Ga0075365_10036222 3300006038 Bacteria 3196
33 Ga0075365_10045528 3300006038 Bacteria 2878
34 Ga0075365_10068961 3300006038 Bacteria 2377
35 Ga0075365_10190598 3300006038 Bacteria 1435
36 Ga0075368_10007476 3300006042 Bacteria 3853
37 Ga0075368_10007833 3300006042 Bacteria 3786
38 Ga0075363_100012008 3300006048 Bacteria 4164
39 Ga0075363_100022575 3300006048 Bacteria 3182
40 Ga0075363_100154027 3300006048 Bacteria 1298
41 Ga0075364_10006519 3300006051 Bacteria 6863
42 Ga0075364_10012902 3300006051 Bacteria 5127
43 Ga0075364_10022966 3300006051 Bacteria 3945
44 Ga0075364_10096920 3300006051 Bacteria 1962
45 Ga0075364_10137658 3300006051 Bacteria 1641
46 Ga0075362_10028137 3300006177 Bacteria 2412
47 Ga0075367_10002998 3300006178 Bacteria 7901
48 Ga0075367_10016028 3300006178 Bacteria 4086
49 Ga0075367_10215025 3300006178 Bacteria 1202
50 Ga0075370_10003967 3300006353 Bacteria 7110
51 Ga0075370_10006859 3300006353 Bacteria 5761
52 Ga0075370_10100344 3300006353 Bacteria 1675
53 Ga0068865_100011354 3300006881 Bacteria 5571
54 Ga0105245_10050112 3300009098 Bacteria 3741
55 Ga0105248_10113210 3300009177 Bacteria 3060
56 Ga0105239_10035810 3300010375 Bacteria 5450
57 Ga0105246_10010838 3300011119 Bacteria 5650
58 Ga0157369_10019433 3300013105 Bacteria 7600
59 Ga0157369_10697226 3300013105 Bacteria 1046
60 Ga0157375_10069612 3300013308 Bacteria 3526
61 Ga0157375_10149300 3300013308 Bacteria 2471
62 Ga0157375_10203998 3300013308 Bacteria 2133
63 Ga0157375_10337563 3300013308 Bacteria 1672
64 Ga0157375_10796365 3300013308 Bacteria 1094
65 Ga0163163_10170835 3300014325 Bacteria 2221
66 Ga0163163_10297772 3300014325 Bacteria 1665
67 Ga0157377_10050823 3300014745 Bacteria 2336
68 Ga0157379_10021173 3300014968 Bacteria 5754
69 Ga0157376_10413913 3300014969 Bacteria 1306
70 Ga0207688_10136400 3300025901 Bacteria 1441
71 Ga0207687_10004283 3300025927 Bacteria 9534
72 Ga0207664_10002158 3300025929 Bacteria 12938
73 Ga0207686_10090607 3300025934 Bacteria 2018
74 Ga0207669_10089336 3300025937 Bacteria 2001
75 Ga0207704_10013283 3300025938 Bacteria 4116
76 Ga0207711_10378224 3300025941 Bacteria 1314
77 Ga0207661_10041245 3300025944 Bacteria 3632
78 Ga0207661_10097374 3300025944 Bacteria 2463
79 Ga0207679_10139733 3300025945 Bacteria 1956
80 Ga0207658_10088258 3300025986 Bacteria 2397
81 Ga0207703_10090052 3300026035 Bacteria 2578
82 Ga0207639_10107345 3300026041 Bacteria 2268
83 Ga0207674_10013123 3300026116 Bacteria 9221
84 Ga0207675_100188522 3300026118 Bacteria 1977
85 Ga0207675_100223783 3300026118 Bacteria 1814
86 Ga0207683_10177717 3300026121 Bacteria 1929
87 Ga0207698_10250106 3300026142 Bacteria 1621
88 Ga0209813_10012208 3300027866 Bacteria 2264
89 Ga0209813_10092756 3300027866 Bacteria 1016
90 Ga0268266_10001311 3300028379 Bacteria 30195
91 Ga0268266_10178538 3300028379 Bacteria 1932
92 Ga0268264_10005476 3300028381 Bacteria 10765
93 Ga0268264_10041379 3300028381 Bacteria 3812
94 Ga0307416_100227678 3300032002 Bacteria 1794
95 Ga0307415_100046075 3300032126 Bacteria 2927
96 Ga0307415_100069290 3300032126 Bacteria 2473
97 Ga0395901_0408274 3300038443 Bacteria 1395
98 Ga0439447_016268 3300041407 Bacteria 2046
99 Ga0450907_004481 3300042146 Bacteria 2407
100 Ga0439446_0003604 3300042156 Bacteria 3858
101 Ga0439434_0003910 3300042435 Bacteria 4350
102 Ga0466961_0107032 3300044693 Bacteria 1760
103 Ga0466961_0131545 3300044693 Bacteria 1568
104 Ga0466963_0173625 3300044694 Bacteria 1503
105 Ga0466963_0176215 3300044694 Bacteria 1492
106 Ga0466963_0190845 3300044694 Bacteria 1431
107 Ga0466964_0069755 3300044706 Bacteria 1483
108 Ga0466970_0002953 3300044765 Bacteria 8243
109 Ga0466970_0134762 3300044765 Bacteria 1358
110 Ga0466960_0003594 3300044901 Bacteria 5982
111 Ga0466960_0015295 3300044901 Bacteria 3305
112 Ga0466960_0107174 3300044901 Bacteria 1447
113 Ga0466958_0016062 3300045836 Bacteria 4305
114 Ga0466967_0032723 3300045976 Bacteria 4394
115 Ga0466967_0053027 3300045976 Bacteria 3563
116 Ga0466967_0233747 3300045976 Bacteria 1751
117 Ga0466967_0439190 3300045976 Bacteria 1274
118 Ga0495658_0137659 3300046683 Bacteria 1491
119 Ga0495674_0399316 3300047319 Bacteria 1110
120 Ga0496100_0074311 3300048903 Bacteria 2277
121 Ga0496101_0106477 3300048904 Bacteria 2105
122 Ga0496102_0014536 3300048905 Bacteria 6840
123 Ga0496102_0015315 3300048905 Bacteria 6678
124 Ga0496102_0047629 3300048905 Bacteria 3897
125 Ga0496102_0064760 3300048905 Bacteria 3349
126 Ga0496102_0136152 3300048905 Bacteria 2301
127 Ga0496102_0343375 3300048905 Bacteria 1406
128 Ga0496103_0146629 3300048906 Bacteria 1511
129 Ga0496104_0013262 3300048907 Bacteria 7428
130 Ga0496105_0337582 3300048908 Bacteria 1205
131 Ga0496106_0005042 3300048909 Bacteria 9770
132 Ga0496106_0173045 3300048909 Bacteria 1712
133 Ga0496106_0190536 3300048909 Bacteria 1630
134 Ga0496107_0024211 3300048910 Bacteria 4294
135 Ga0496107_0032485 3300048910 Bacteria 3731
136 Ga0496107_0071979 3300048910 Bacteria 2513
137 Ga0496108_0030810 3300048911 Bacteria 4445
138 Ga0496108_0070800 3300048911 Bacteria 2943
139 Ga0496108_0150164 3300048911 Bacteria 2010
140 Ga0496108_0179881 3300048911 Bacteria 1831
141 Ga0496109_0015095 3300048912 Bacteria 6723
142 Ga0496109_0101962 3300048912 Bacteria 2664
143 Ga0496110_0084507 3300048913 Bacteria 2833
144 Ga0496110_0189110 3300048913 Bacteria 1870
145 Ga0496111_0032224 3300048914 Bacteria 3736
146 Ga0496112_0409266 3300048915 Bacteria 1296
147 Ga0496114_0036981 3300048917 Bacteria 4036
148 Ga0496114_0042888 3300048917 Bacteria 3750
149 Ga0496114_0112450 3300048917 Bacteria 2334
150 Ga0496114_0188097 3300048917 Bacteria 1805
151 Ga0496115_0036986 3300048918 Bacteria 3867
152 Ga0496115_0048319 3300048918 Bacteria 3403
153 Ga0501032_0044542 3300049569 Bacteria 3003
154 Ga0501033_0051954 3300049570 Bacteria 3038
155 Ga0501034_0006096 3300049571 Bacteria 13014
156 Ga0501034_0041932 3300049571 Bacteria 4631
157 Ga0501034_0056670 3300049571 Bacteria 3942
158 Ga0501034_0113248 3300049571 Bacteria 2703
159 Ga0501036_0057572 3300049572 Bacteria 3292
160 Ga0501036_0641263 3300049572 Bacteria 880
161 Ga0501037_0008083 3300049573 Bacteria 7707
162 Ga0501037_0070238 3300049573 Bacteria 2548
163 Ga0501038_0002800 3300049574 Bacteria 16233
164 Ga0501038_0003514 3300049574 Bacteria 14586
165 Ga0501039_0011496 3300049575 Bacteria 6737
166 Ga0501039_0249768 3300049575 Bacteria 1395
167 Ga0501040_0045248 3300049576 Bacteria 3001
168 Ga0501041_0012155 3300049577 Bacteria 5098
169 Ga0501042_0013027 3300049578 Bacteria 5650
170 Ga0501042_0034844 3300049578 Bacteria 3571
171 Ga0501043_0040764 3300049579 Bacteria 3649
172 Ga0501046_0004537 3300049580 Bacteria 12580
173 Ga0501046_0195264 3300049580 Bacteria 1508
174 Ga0501046_0250882 3300049580 Bacteria 1302
175 Ga0501047_0022006 3300049581 Bacteria 6123
176 Ga0501048_0047242 3300049582 Bacteria 3071
177 Ga0501048_0158078 3300049582 Bacteria 1603
178 Ga0501067_0000382 3300049583 Bacteria 24117
179 Ga0501067_0000999 3300049583 Bacteria 15200
180 Ga0501067_0090881 3300049583 Bacteria 1695
181 Ga0501068_0014957 3300049584 Bacteria 4446
182 Ga0501068_0021347 3300049584 Bacteria 3781
183 Ga0501068_0043768 3300049584 Bacteria 2694
184 Ga0501069_0005186 3300049585 Bacteria 6770
185 Ga0501069_0160275 3300049585 Bacteria 1295
186 Ga0501070_0004353 3300049586 Bacteria 12175
187 Ga0501070_0010524 3300049586 Bacteria 7821
188 Ga0501070_0027209 3300049586 Bacteria 4796
189 Ga0501070_0050776 3300049586 Bacteria 3442
190 Ga0501070_0123795 3300049586 Bacteria 2137
191 Ga0501070_0132963 3300049586 Bacteria 2054
192 Ga0501070_0143295 3300049586 Bacteria 1973
193 Ga0501070_0272555 3300049586 Bacteria 1382
194 Ga0501071_0005937 3300049587 Bacteria 7901
195 Ga0501071_0114352 3300049587 Bacteria 1996
196 Ga0501072_0080740 3300049588 Bacteria 2577
197 Ga0501073_0005340 3300049589 Bacteria 9634
198 Ga0501073_0007332 3300049589 Bacteria 8205
199 Ga0501073_0023053 3300049589 Bacteria 4476
200 Ga0501074_0001119 3300049590 Bacteria 17523
201 Ga0501074_0038933 3300049590 Bacteria 3444
202 Ga0501075_0012785 3300049591 Bacteria 5974
203 Ga0501076_0006303 3300049592 Bacteria 8597
204 Ga0501077_0142133 3300049593 Bacteria 1522
205 Ga0501079_0071232 3300049741 Bacteria 2685
206 Ga0501079_0142726 3300049741 Bacteria 1865
207 Ga0501079_0187184 3300049741 Bacteria 1616
208 Ga0501080_0004836 3300049742 Bacteria 12009
209 Ga0501080_0035638 3300049742 Bacteria 4644
210 Ga0501080_0050003 3300049742 Bacteria 3891
211 Ga0501080_0119856 3300049742 Bacteria 2439
212 Ga0501083_0008781 3300049744 Bacteria 7132
213 Ga0501083_0107554 3300049744 Bacteria 1835
214 Ga0501035_0002435 3300049822 Bacteria 18190
215 Ga0501035_0165149 3300049822 Bacteria 1915
216 Ga0501044_0004815 3300049823 Bacteria 15097
217 Ga0501044_0172454 3300049823 Bacteria 2133
218 nmdc:mga03n38_10434_c1 3300050490 Bacteria 3417
219 nmdc:mga03n38_550_c1 3300050490 Bacteria 9524
220 nmdc:mga00v17_153910_c1 3300050491 Bacteria 1478
221 nmdc:mga00v17_20771_c1 3300050491 Bacteria 3766
222 nmdc:mga00v17_2381_c1 3300050491 Bacteria 9628
223 nmdc:mga00v17_32995_c1 3300050491 Bacteria 3064
224 nmdc:mga00v17_40995_c1 3300050491 Bacteria 2779
225 nmdc:mga00v17_544_c1 3300050491 Bacteria 21085
226 nmdc:mga0yw44_12723_c1 3300050492 Bacteria 4398
227 nmdc:mga0yw44_14515_c1 3300050492 Bacteria 4187
228 nmdc:mga0yw44_19385_c1 3300050492 Bacteria 3750
229 nmdc:mga0yw44_27129_c1 3300050492 Bacteria 3278
230 nmdc:mga0yw44_76331_c1 3300050492 Bacteria 2091
231 nmdc:mga0yw44_77815_c1 3300050492 Bacteria 2073
232 nmdc:mga06z11_63936_c1 3300050494 Bacteria 1927
233 nmdc:mga04h51_65275_c1 3300050495 Bacteria 1258
234 nmdc:mga07m45_133102_c1 3300050496 Bacteria 1439
235 nmdc:mga07m45_40262_c1 3300050496 Bacteria 2614
236 nmdc:mga07m45_6036_c1 3300050496 Bacteria 6097
237 nmdc:mga07m45_6175_c1 3300050496 Bacteria 6042
238 Ga0500644_0000011 3300053088 Bacteria 125595
239 Ga0500554_050219 3300053102 Bacteria 1311
240 Ga0500556_0001332 3300053104 Bacteria 10929
241 Ga0500593_000847 3300053117 Bacteria 11384
242 Ga0500573_0127353 3300053140 Bacteria 1413
243 Ga0501084_0008793 3300054114 Bacteria 8355
244 Ga0501084_0024685 3300054114 Bacteria 5016
245 Ga0501084_0049689 3300054114 Bacteria 3510
246 Ga0501082_0008790 3300060353 Bacteria 8710
247 Ga0501082_0084981 3300060353 Bacteria 2729
248 Ga0466962_0001073 3300061719 Bacteria 12569
249 2643893520 2643221576 Bacteria 5214352
250 2643962570 2643221590 Bacteria 5214697
251 2731909298 2731639228 Bacteria 4187555
252 2774392640 2773857762 Bacteria 5971770
253 2799186377 2799112218 Bacteria 4315149
254 2809196440 2808606439 Bacteria 5952208
255 2812351404 2811994878 Bacteria 5992952
256 2857482565 2857481737 Bacteria 4761446
257 2891970978 2891968417 Bacteria 5821697
258 2984580119 2984576629 Bacteria 4248407
259 2984594794 2984592036 Bacteria 3670284
260 2990258970 2990256926 Bacteria 4252839
261 nmdc:mga0yw44_62566_c1
262 LJQas_1001856
263 Ga0070683_100007950
264 Ga0070683_100026348
265 Ga0070683_100103269
266 Ga0070682_100017718
267 Ga0070692_10011544
268 Ga0070674_100098864
269 Ga0070659_100043152
270 Ga0070667_100026598
271 Ga0070667_100159992
272 Ga0070678_100221437
273 Ga0070684_100005626
274 Ga0070684_100445192
275 Ga0070693_100025248
276 Ga0070665_100000522
277 Ga0070665_100228879
278 Ga0068855_100099722
279 Ga0070664_100223831
280 Ga0068857_100017060
281 Ga0068856_100016885
282 Ga0070702_100026819
283 Ga0068861_100373860
284 Ga0068861_100387984
285 Ga0068870_10137780
286 Ga0068858_100054658
287 Ga0068860_100000882
288 Ga0068860_100056166
289 Ga0075365_10008642
290 Ga0075365_10025226
291 Ga0075365_10026302
292 Ga0075365_10036222
293 Ga0075365_10045528
294 Ga0075365_10068961
295 Ga0075365_10190598
296 Ga0075368_10007476
297 Ga0075368_10007833
298 Ga0075363_100012008
299 Ga0075363_100022575
300 Ga0075363_100154027
301 Ga0075364_10006519
302 Ga0075364_10012902
303 Ga0075364_10022966
304 Ga0075364_10096920
305 Ga0075364_10137658
306 Ga0075362_10028137
307 Ga0075367_10002998
308 Ga0075367_10016028
309 Ga0075367_10215025
310 Ga0075370_10003967
311 Ga0075370_10006859
312 Ga0075370_10100344
313 Ga0068865_100011354
314 Ga0105245_10050112
315 Ga0105248_10113210
316 Ga0105239_10035810
317 Ga0105246_10010838
318 Ga0157369_10019433
319 Ga0157369_10697226
320 Ga0157375_10069612
321 Ga0157375_10149300
322 Ga0157375_10203998
323 Ga0157375_10337563
324 Ga0157375_10796365
325 Ga0163163_10170835
326 Ga0163163_10297772
327 Ga0157377_10050823
328 Ga0157379_10021173
329 Ga0157376_10413913
330 Ga0207688_10136400
331 Ga0207687_10004283
332 Ga0207664_10002158
333 Ga0207686_10090607
334 Ga0207669_10089336
335 Ga0207704_10013283
336 Ga0207711_10378224
337 Ga0207661_10041245
338 Ga0207661_10097374
339 Ga0207679_10139733
340 Ga0207658_10088258
341 Ga0207703_10090052
342 Ga0207639_10107345
343 Ga0207674_10013123
344 Ga0207675_100188522
345 Ga0207675_100223783
346 Ga0207683_10177717
347 Ga0207698_10250106
348 Ga0209813_10012208
349 Ga0209813_10092756
350 Ga0268266_10001311
351 Ga0268266_10178538
352 Ga0268264_10005476
353 Ga0268264_10041379
354 Ga0307416_100227678
355 Ga0307415_100046075
356 Ga0307415_100069290
357 Ga0395901_0408274
358 Ga0439447_016268
359 Ga0450907_004481
360 Ga0439446_0003604
361 Ga0439434_0003910
362 Ga0466961_0107032
363 Ga0466961_0131545
364 Ga0466963_0173625
365 Ga0466963_0176215
366 Ga0466963_0190845
367 Ga0466964_0069755
368 Ga0466970_0002953
369 Ga0466970_0134762
370 Ga0466960_0003594
371 Ga0466960_0015295
372 Ga0466960_0107174
373 Ga0466958_0016062
374 Ga0466967_0032723
375 Ga0466967_0053027
376 Ga0466967_0233747
377 Ga0466967_0439190
378 Ga0495658_0137659
379 Ga0495674_0399316
380 Ga0496100_0074311
381 Ga0496101_0106477
382 Ga0496102_0014536
383 Ga0496102_0015315
384 Ga0496102_0047629
385 Ga0496102_0064760
386 Ga0496102_0136152
387 Ga0496102_0343375
388 Ga0496103_0146629
389 Ga0496104_0013262
390 Ga0496105_0337582
391 Ga0496106_0005042
392 Ga0496106_0173045
393 Ga0496106_0190536
394 Ga0496107_0024211
395 Ga0496107_0032485
396 Ga0496107_0071979
397 Ga0496108_0030810
398 Ga0496108_0070800
399 Ga0496108_0150164
400 Ga0496108_0179881
401 Ga0496109_0015095
402 Ga0496109_0101962
403 Ga0496110_0084507
404 Ga0496110_0189110
405 Ga0496111_0032224
406 Ga0496112_0409266
407 Ga0496114_0036981
408 Ga0496114_0042888
409 Ga0496114_0112450
410 Ga0496114_0188097
411 Ga0496115_0036986
412 Ga0496115_0048319
413 Ga0501032_0044542
414 Ga0501033_0051954
415 Ga0501034_0006096
416 Ga0501034_0041932
417 Ga0501034_0056670
418 Ga0501034_0113248
419 Ga0501036_0057572
420 Ga0501036_0641263
421 Ga0501037_0008083
422 Ga0501037_0070238
423 Ga0501038_0002800
424 Ga0501038_0003514
425 Ga0501039_0011496
426 Ga0501039_0249768
427 Ga0501040_0045248
428 Ga0501041_0012155
429 Ga0501042_0013027
430 Ga0501042_0034844
431 Ga0501043_0040764
432 Ga0501046_0004537
433 Ga0501046_0195264
434 Ga0501046_0250882
435 Ga0501047_0022006
436 Ga0501048_0047242
437 Ga0501048_0158078
438 Ga0501067_0000382
439 Ga0501067_0000999
440 Ga0501067_0090881
441 Ga0501068_0014957
442 Ga0501068_0021347
443 Ga0501068_0043768
444 Ga0501069_0005186
445 Ga0501069_0160275
446 Ga0501070_0004353
447 Ga0501070_0010524
448 Ga0501070_0027209
449 Ga0501070_0050776
450 Ga0501070_0123795
451 Ga0501070_0132963
452 Ga0501070_0143295
453 Ga0501070_0272555
454 Ga0501071_0005937
455 Ga0501071_0114352
456 Ga0501072_0080740
457 Ga0501073_0005340
458 Ga0501073_0007332
459 Ga0501073_0023053
460 Ga0501074_0001119
461 Ga0501074_0038933
462 Ga0501075_0012785
463 Ga0501076_0006303
464 Ga0501077_0142133
465 Ga0501079_0071232
466 Ga0501079_0142726
467 Ga0501079_0187184
468 Ga0501080_0004836
469 Ga0501080_0035638
470 Ga0501080_0050003
471 Ga0501080_0119856
472 Ga0501083_0008781
473 Ga0501083_0107554
474 Ga0501035_0002435
475 Ga0501035_0165149
476 Ga0501044_0004815
477 Ga0501044_0172454
478 nmdc:mga03n38_10434_c1
479 nmdc:mga03n38_550_c1
480 nmdc:mga00v17_153910_c1
481 nmdc:mga00v17_20771_c1
482 nmdc:mga00v17_2381_c1
483 nmdc:mga00v17_32995_c1
484 nmdc:mga00v17_40995_c1
485 nmdc:mga00v17_544_c1
486 nmdc:mga0yw44_12723_c1
487 nmdc:mga0yw44_14515_c1
488 nmdc:mga0yw44_19385_c1
489 nmdc:mga0yw44_27129_c1
490 nmdc:mga0yw44_76331_c1
491 nmdc:mga0yw44_77815_c1
492 nmdc:mga06z11_63936_c1
493 nmdc:mga04h51_65275_c1
494 nmdc:mga07m45_133102_c1
495 nmdc:mga07m45_40262_c1
496 nmdc:mga07m45_6036_c1
497 nmdc:mga07m45_6175_c1
498 Ga0500644_0000011
499 Ga0500554_050219
500 Ga0500556_0001332
501 Ga0500593_000847
502 Ga0500573_0127353
503 Ga0501084_0008793
504 Ga0501084_0024685
505 Ga0501084_0049689
506 Ga0501082_0008790
507 Ga0501082_0084981
508 Ga0466962_0001073
509 2643893520
510 2643962570
511 2731909298
512 2774392640
513 2799186377
514 2809196440
515 2812351404
516 2857482565
517 2891970978
518 2984580119
519 2984594794
520 2990258970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

1

176

0.94

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

177

276

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.9696 7 307
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.9678 7 307
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.9671 7 307
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.967 7 307
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.942 7 307
ID Description Score Start End Superfamily
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9621 7 186 3.40.50.1010
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9385 7 184 3.40.50.1010
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9269 7 186 3.40.50.1010
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9224 7 184 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9148 2 185 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7M4DR32-F1-model_v4 5'-3' exonuclease (EC 3.1.11.-) 0.9811 5 307 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7K2N428-F1-model_v4 Flap endonuclease 0.9801 10 218 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7H8LQ09-F1-model_v4 deleted 0.9779 10 309
AF-A0A7X9LBM7-F1-model_v4 5'-3' exonuclease 0.975 7 215 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A852WZ57-F1-model_v4 5'-3' exonuclease 0.9744 6 307 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map