F369905

General Info

Members Datasets Scaffolds Average Seq Length
260 145 260 230

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0453744|Ga0501081_0453744_145_924
Length 259
Sequence VRDVSHDTALDSEVDDAPGNVLADSSLSEATLADPTVRSRIPRFTDAELAELNAEFDDLPAAKIVQWAVDQFSPHLSLTASMTDAVLIDIAVKVDPAIEVVFIDTGYHFPETLDTVEQVRRRYGLNMKIMTVAHHDEELWRVDPENCCSAVKVGQLDRALAGKAAWMSGLRRAEADTRQSAPIIARDLRGLIKVNPLAAWTDDDVAGYIDDHDIIVNPLIAQGYLSIGCMPCTTKVAPGEHARSGRWAGRDKTECGLHQ

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0
Rhizoplane 0
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10005053 3300003373 Bacteria 3227
2 Ga0070676_10080088 3300005328 Bacteria 1979
3 Ga0070680_100542371 3300005336 Bacteria 997
4 Ga0070680_100607475 3300005336 Bacteria 939
5 Ga0070661_100052658 3300005344 Bacteria 2979
6 Ga0070667_100089254 3300005367 Bacteria 2648
7 Ga0070708_100092762 3300005445 Bacteria 2751
8 Ga0070706_100004421 3300005467 Bacteria 13575
9 Ga0070699_100722975 3300005518 Bacteria 910
10 Ga0070697_100476208 3300005536 Bacteria 1090
11 Ga0068856_100196912 3300005614 Bacteria 2029
12 Ga0068860_100138359 3300005843 Bacteria 2339
13 Ga0081455_10000348 3300005937 Bacteria 60678
14 Ga0081455_10012373 3300005937 Bacteria 8515
15 Ga0081455_10018960 3300005937 Bacteria 6524
16 Ga0081455_10048249 3300005937 Bacteria 3681
17 Ga0081455_10075404 3300005937 Bacteria 2783
18 Ga0081455_10329023 3300005937 Bacteria 1085
19 Ga0081538_10001628 3300005981 Bacteria 23020
20 Ga0081538_10007297 3300005981 Bacteria 9581
21 Ga0075365_10006736 3300006038 Bacteria 6355
22 Ga0075365_10058990 3300006038 Bacteria 2556
23 Ga0075365_10308596 3300006038 Bacteria 1114
24 Ga0075365_10352368 3300006038 Bacteria 1038
25 Ga0075363_100114325 3300006048 Bacteria 1502
26 Ga0075364_10000351 3300006051 Bacteria 22879
27 Ga0075364_10172979 3300006051 Bacteria 1460
28 Ga0075364_10355854 3300006051 Bacteria 998
29 Ga0075367_10008895 3300006178 Bacteria 5225
30 Ga0075428_100000156 3300006844 Bacteria 62057
31 Ga0075428_100001826 3300006844 Bacteria 22800
32 Ga0075428_100011341 3300006844 Bacteria 9916
33 Ga0075428_100952595 3300006844 Bacteria 909
34 Ga0075430_100000810 3300006846 Bacteria 24365
35 Ga0075430_100002139 3300006846 Bacteria 16354
36 Ga0075430_100049510 3300006846 Bacteria 3546
37 Ga0075430_100099342 3300006846 Bacteria 2430
38 Ga0075430_100178528 3300006846 Bacteria 1766
39 Ga0075430_100308578 3300006846 Bacteria 1308
40 Ga0075431_100000246 3300006847 Bacteria 41024
41 Ga0075431_100041919 3300006847 Bacteria 4720
42 Ga0075431_100116446 3300006847 Bacteria 2758
43 Ga0075431_100255983 3300006847 Bacteria 1778
44 Ga0075431_100265432 3300006847 Bacteria 1741
45 Ga0075429_100001378 3300006880 Bacteria 19884
46 Ga0075429_100027012 3300006880 Bacteria 4985
47 Ga0075429_100478653 3300006880 Bacteria 1091
48 Ga0111539_10001123 3300009094 Bacteria 35397
49 Ga0114129_10001676 3300009147 Bacteria 30184
50 Ga0114129_10028635 3300009147 Bacteria 7893
51 Ga0157369_10166710 3300013105 Bacteria 2323
52 Ga0157378_10542154 3300013297 Bacteria 1167
53 Ga0157378_10852960 3300013297 Bacteria 939
54 Ga0163162_10923696 3300013306 Bacteria 985
55 Ga0157375_10186098 3300013308 Bacteria 2230
56 Ga0157375_10781364 3300013308 Bacteria 1105
57 Ga0157379_10398666 3300014968 Bacteria 1264
58 Ga0206356_10180085 3300020070 Bacteria 991
59 Ga0206352_10956486 3300020078 Bacteria 818
60 Ga0154015_1123049 3300020610 Bacteria 1010
61 Ga0213873_10003755 3300021358 Bacteria 2771
62 Ga0213876_10022661 3300021384 Bacteria 3319
63 Ga0224712_10012787 3300022467 Bacteria 2654
64 Ga0207645_10073952 3300025907 Bacteria 2182
65 Ga0207684_10189723 3300025910 Bacteria 1772
66 Ga0207684_10199492 3300025910 Bacteria 1726
67 Ga0207649_10059583 3300025920 Bacteria 2396
68 Ga0207659_10327303 3300025926 Bacteria 1266
69 Ga0207687_10174761 3300025927 Bacteria 1659
70 Ga0207664_10120235 3300025929 Bacteria 2197
71 Ga0207644_10180511 3300025931 Bacteria 1654
72 Ga0207661_10958849 3300025944 Bacteria 788
73 Ga0207667_10122532 3300025949 Bacteria 2679
74 Ga0207702_10135087 3300026078 Bacteria 2224
75 Ga0207674_10537814 3300026116 Bacteria 1129
76 Ga0207683_10432840 3300026121 Bacteria 1212
77 Ga0268264_10142947 3300028381 Bacteria 2136
78 Ga0265334_10002063 3300028573 Bacteria 9508
79 Ga0265327_10038502 3300031251 Bacteria 2609
80 Ga0316579_10040876 3300031691 Bacteria 2152
81 Ga0316576_10002852 3300031727 Bacteria 9963
82 Ga0316578_10008253 3300031728 Bacteria 5287
83 Ga0316578_10059034 3300031728 Bacteria 2256
84 Ga0307405_10134200 3300031731 Bacteria 1716
85 Ga0316577_10077041 3300031733 Bacteria 1862
86 Ga0307413_10046357 3300031824 Bacteria 2584
87 Ga0307410_10007633 3300031852 Bacteria 5933
88 Ga0307406_10321004 3300031901 Bacteria 1198
89 Ga0307409_100027331 3300031995 Bacteria 4041
90 Ga0307416_100138516 3300032002 Bacteria 2207
91 Ga0307416_101338278 3300032002 Unclassified 822
92 Ga0307411_10215016 3300032005 Bacteria 1487
93 Ga0307415_100026858 3300032126 Bacteria 3639
94 Ga0307415_100398038 3300032126 Bacteria 1175
95 Ga0373928_0033015 3300035084 Bacteria 1156
96 Ga0373932_0000520 3300035112 Bacteria 11831
97 Ga0373957_0148605 3300035120 Bacteria 961
98 Ga0316574_0022064 3300035398 Bacteria 3788
99 Ga0316574_0067541 3300035398 Bacteria 2254
100 Ga0316574_0105209 3300035398 Bacteria 1807
101 Ga0373931_0000001 3300035691 Bacteria 634029
102 Ga0373931_0000022 3300035691 Bacteria 137028
103 Ga0373933_0160245 3300035724 Bacteria 1428
104 Ga0373937_0192668 3300036401 Bacteria 1916
105 Ga0373937_0310156 3300036401 Bacteria 1492
106 Ga0316582_0045420 3300036647 Bacteria 2766
107 Ga0316584_0030312 3300036712 Bacteria 3995
108 Ga0373925_0115245 3300037068 Bacteria 2081
109 Ga0436365_0778338 3300039437 Bacteria 2234
110 Ga0436365_1661830 3300039437 Bacteria 4260
111 Ga0436360_0188167 3300039438 Bacteria 8314
112 Ga0436361_0439103 3300039447 Bacteria 2809
113 Ga0436362_0463748 3300039453 Bacteria 5352
114 Ga0436362_0893042 3300039453 Bacteria 6484
115 Ga0436362_1298938 3300039453 Bacteria 1289
116 Ga0439448_0063458 3300042005 Bacteria 1223
117 Ga0439432_115886 3300042006 Bacteria 795
118 Ga0439450_001996 3300042008 Bacteria 3121
119 Ga0439463_014164 3300042016 Bacteria 1965
120 Ga0439434_0003060 3300042435 Bacteria 4904
121 Ga0439464_0046895 3300042439 Bacteria 1242
122 Ga0439460_0007696 3300042461 Bacteria 2701
123 Ga0439440_0000440 3300042993 Bacteria 6959
124 Ga0495651_0010167 3300046462 Bacteria 7226
125 Ga0495651_0463738 3300046462 Bacteria 817
126 Ga0495653_0221335 3300046463 Bacteria 1272
127 Ga0495608_0127415 3300046511 Bacteria 1630
128 Ga0495618_0111472 3300046514 Bacteria 1752
129 Ga0495667_0007847 3300046559 Bacteria 7234
130 Ga0495667_0148216 3300046559 Bacteria 1511
131 Ga0495599_0448885 3300046678 Bacteria 764
132 Ga0495623_0033274 3300046679 Bacteria 3308
133 Ga0495589_0191100 3300046794 Bacteria 969
134 Ga0495672_0000785 3300047320 Bacteria 34425
135 Ga0495676_0258350 3300047321 Bacteria 1186
136 Ga0495676_0348028 3300047321 Bacteria 991
137 Ga0495680_0018817 3300047322 Bacteria 5853
138 Ga0501031_0016713 3300049568 Bacteria 4767
139 Ga0501031_0125623 3300049568 Bacteria 1676
140 Ga0501032_0015006 3300049569 Bacteria 5477
141 Ga0501032_0168339 3300049569 Bacteria 1437
142 Ga0501033_0002241 3300049570 Bacteria 16583
143 Ga0501033_0051994 3300049570 Bacteria 3036
144 Ga0501033_0150209 3300049570 Bacteria 1681
145 Ga0501034_0000666 3300049571 Bacteria 52372
146 Ga0501034_0000723 3300049571 Bacteria 50099
147 Ga0501034_0026918 3300049571 Bacteria 5850
148 Ga0501034_0064266 3300049571 Bacteria 3684
149 Ga0501034_0244854 3300049571 Bacteria 1738
150 Ga0501034_0344420 3300049571 Bacteria 1420
151 Ga0501036_0002598 3300049572 Bacteria 14235
152 Ga0501036_0270316 3300049572 Bacteria 1423
153 Ga0501036_0319737 3300049572 Bacteria 1297
154 Ga0501037_0014420 3300049573 Bacteria 5818
155 Ga0501037_0018057 3300049573 Bacteria 5195
156 Ga0501038_0045972 3300049574 Bacteria 3787
157 Ga0501039_0003715 3300049575 Bacteria 11460
158 Ga0501039_0007909 3300049575 Bacteria 8103
159 Ga0501040_0005185 3300049576 Bacteria 8425
160 Ga0501040_0016614 3300049576 Bacteria 4876
161 Ga0501040_0395959 3300049576 Bacteria 992
162 Ga0501041_0001373 3300049577 Bacteria 13447
163 Ga0501042_0017955 3300049578 Bacteria 4892
164 Ga0501043_0036896 3300049579 Bacteria 3845
165 Ga0501043_0107989 3300049579 Bacteria 2186
166 Ga0501046_0010757 3300049580 Bacteria 7847
167 Ga0501046_0016688 3300049580 Bacteria 6143
168 Ga0501047_0166285 3300049581 Bacteria 2076
169 Ga0501048_0054451 3300049582 Bacteria 2842
170 Ga0501048_0144840 3300049582 Bacteria 1680
171 Ga0501067_0080773 3300049583 Bacteria 1802
172 Ga0501068_0000098 3300049584 Bacteria 37486
173 Ga0501068_0004276 3300049584 Bacteria 7755
174 Ga0501068_0018852 3300049584 Bacteria 3998
175 Ga0501069_0000036 3300049585 Bacteria 86365
176 Ga0501070_0000001 3300049586 Bacteria 519187
177 Ga0501070_0000956 3300049586 Bacteria 26049
178 Ga0501070_0065587 3300049586 Bacteria 3006
179 Ga0501071_0017452 3300049587 Bacteria 4950
180 Ga0501071_0044457 3300049587 Bacteria 3185
181 Ga0501071_0132064 3300049587 Bacteria 1856
182 Ga0501072_0003721 3300049588 Bacteria 11502
183 Ga0501072_0018593 3300049588 Bacteria 5355
184 Ga0501072_0055162 3300049588 Bacteria 3132
185 Ga0501072_0119284 3300049588 Bacteria 2102
186 Ga0501073_0000578 3300049589 Bacteria 25821
187 Ga0501073_0002974 3300049589 Bacteria 12705
188 Ga0501073_0126679 3300049589 Bacteria 1770
189 Ga0501073_0207054 3300049589 Unclassified 1356
190 Ga0501074_0000333 3300049590 Bacteria 27445
191 Ga0501074_0147472 3300049590 Bacteria 1683
192 Ga0501074_0182878 3300049590 Bacteria 1495
193 Ga0501074_0213285 3300049590 Bacteria 1375
194 Ga0501074_0558409 3300049590 Bacteria 810
195 Ga0501075_0004343 3300049591 Bacteria 9593
196 Ga0501075_0032420 3300049591 Bacteria 3881
197 Ga0501076_0003837 3300049592 Bacteria 10585
198 Ga0501076_0013640 3300049592 Bacteria 6096
199 Ga0501076_0468397 3300049592 Bacteria 1038
200 Ga0501077_0000905 3300049593 Bacteria 17835
201 Ga0501077_0004444 3300049593 Bacteria 8517
202 Ga0501077_0092440 3300049593 Bacteria 1917
203 Ga0501079_0010953 3300049741 Bacteria 6909
204 Ga0501079_0029548 3300049741 Bacteria 4209
205 Ga0501079_0072086 3300049741 Bacteria 2669
206 Ga0501080_0002292 3300049742 Bacteria 16670
207 Ga0501080_0005133 3300049742 Bacteria 11663
208 Ga0501080_0122856 3300049742 Bacteria 2405
209 Ga0501080_0239568 3300049742 Bacteria 1656
210 Ga0501080_0669613 3300049742 Bacteria 917
211 Ga0501081_0007526 3300049743 Bacteria 7063
212 Ga0501081_0453744 3300049743 Bacteria 953
213 Ga0501083_0000154 3300049744 Bacteria 45503
214 Ga0501083_0032737 3300049744 Bacteria 3564
215 Ga0501035_0067797 3300049822 Bacteria 3165
216 Ga0501035_0154540 3300049822 Bacteria 1989
217 Ga0501044_0010305 3300049823 Bacteria 10154
218 Ga0501044_0070347 3300049823 Bacteria 3559
219 Ga0501045_0004150 3300049824 Bacteria 10010
220 Ga0501045_0027899 3300049824 Bacteria 4071
221 nmdc:mga00v17_228966_c1 3300050491 Bacteria 1204
222 nmdc:mga00v17_78779_c1 3300050491 Bacteria 2054
223 nmdc:mga00v17_86775_c1 3300050491 Bacteria 1961
224 nmdc:mga0yw44_1472_c1 3300050492 Bacteria 9377
225 nmdc:mga0yw44_269032_c1 3300050492 Bacteria 1137
226 nmdc:mga06z11_175672_c1 3300050494 Bacteria 1232
227 nmdc:mga06z11_20409_c1 3300050494 Bacteria 3062
228 nmdc:mga05p37_240114_c1 3300050507 Bacteria 2179
229 nmdc:mga05p37_44428_c1 3300050507 Bacteria 5466
230 nmdc:mga05p37_688112_c1 3300050507 Bacteria 1138
231 nmdc:mga09592_1585_c1 3300050508 Bacteria 18320
232 nmdc:mga09592_19020_c1 3300050508 Bacteria 5637
233 nmdc:mga09592_29003_c1 3300050508 Bacteria 4602
234 nmdc:mga0qj67_103387_c1 3300050509 Bacteria 2298
235 nmdc:mga0qj67_193655_c1 3300050509 Bacteria 1652
236 nmdc:mga0qj67_257764_c1 3300050509 Bacteria 1415
237 nmdc:mga06r32_114135_c1 3300050510 Bacteria 2659
238 nmdc:mga06r32_193728_c1 3300050510 Bacteria 2020
239 nmdc:mga06r32_343764_c1 3300050510 Bacteria 1477
240 nmdc:mga06r32_515_c1 3300050510 Bacteria 33313
241 nmdc:mga08y16_14967_c1 3300050511 Bacteria 8159
242 nmdc:mga08y16_271706_c1 3300050511 Bacteria 1750
243 nmdc:mga08y16_75837_c1 3300050511 Bacteria 3505
244 nmdc:mga0n895_653192_c1 3300050512 Bacteria 1050
245 nmdc:mga08x19_495269_c1 3300050514 Bacteria 862
246 Ga0495595_0079490 3300053084 Bacteria 1560
247 Ga0495619_0357462 3300053085 Bacteria 1010
248 Ga0500566_0000127 3300053094 Bacteria 38928
249 Ga0500568_0000182 3300053139 Bacteria 55216
250 Ga0500616_0002998 3300053153 Bacteria 13339
251 Ga0501084_0008127 3300054114 Bacteria 8645
252 Ga0501084_0013460 3300054114 Bacteria 6771
253 Ga0501084_0057792 3300054114 Bacteria 3245
254 Ga0501082_0005847 3300060353 Bacteria 10678
255 Ga0501082_0048549 3300060353 Bacteria 3658
256 Ga0501082_0212710 3300060353 Bacteria 1682
257 Ga0501082_0724460 3300060353 Bacteria 870
258 Ga0530510_0002648 3300061734 Bacteria 12303
259 Ga0530510_0006115 3300061734 Bacteria 8358
260 Ga0530510_0277547 3300061734 Bacteria 1251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0463748 Ga0436362_0463748_642_1277 211
2 3300050514 nmdc:mga08x19_495269_c1 nmdc:mga08x19_495269_c1_24_659 211
3 3300049592 Ga0501076_0468397 Ga0501076_0468397_376_1023 215
4 3300005328 Ga0070676_10080088 Ga0070676_100800883 217
5 3300006038 Ga0075365_10308596 Ga0075365_103085962 217
6 3300020070 Ga0206356_10180085 Ga0206356_101800852 217
7 3300025907 Ga0207645_10073952 Ga0207645_100739522 217
8 3300035084 Ga0373928_0033015 Ga0373928_0033015_336_1052 217
9 3300035112 Ga0373932_0000520 Ga0373932_0000520_8285_9001 217
10 3300035691 Ga0373931_0000001 Ga0373931_0000001_144474_145190 217
11 3300035691 Ga0373931_0000022 Ga0373931_0000022_100678_101385 217
12 3300050492 nmdc:mga0yw44_269032_c1 nmdc:mga0yw44_269032_c1_305_1021 217
13 3300049570 Ga0501033_0002241 Ga0501033_0002241_14976_15695 218
14 3300049823 Ga0501044_0070347 Ga0501044_0070347_357_1064 218
15 3300032002 Ga0307416_101338278 Ga0307416_1013382781 219
16 3300005367 Ga0070667_100089254 Ga0070667_1000892543 220
17 3300025931 Ga0207644_10180511 Ga0207644_101805112 220
18 3300049589 Ga0501073_0207054 Ga0501073_0207054_23_745 220
19 3300005445 Ga0070708_100092762 Ga0070708_1000927622 221
20 3300005518 Ga0070699_100722975 Ga0070699_1007229752 221
21 3300005536 Ga0070697_100476208 Ga0070697_1004762081 221
22 3300005843 Ga0068860_100138359 Ga0068860_1001383593 221
23 3300014968 Ga0157379_10398666 Ga0157379_103986662 221
24 3300025910 Ga0207684_10199492 Ga0207684_101994922 221
25 3300028381 Ga0268264_10142947 Ga0268264_101429473 221
26 3300049569 Ga0501032_0015006 Ga0501032_0015006_1968_2651 221
27 3300049571 Ga0501034_0064266 Ga0501034_0064266_56_739 221
28 3300049572 Ga0501036_0270316 Ga0501036_0270316_597_1280 221
29 3300049573 Ga0501037_0018057 Ga0501037_0018057_2470_3153 221
30 3300049579 Ga0501043_0036896 Ga0501043_0036896_1234_1917 221
31 3300049586 Ga0501070_0065587 Ga0501070_0065587_435_1118 221
32 3300049590 Ga0501074_0182878 Ga0501074_0182878_137_820 221
33 3300049742 Ga0501080_0669613 Ga0501080_0669613_167_856 221
34 3300049822 Ga0501035_0154540 Ga0501035_0154540_620_1303 221
35 3300049823 Ga0501044_0010305 Ga0501044_0010305_2423_3106 221
36 3300005336 Ga0070680_100607475 Ga0070680_1006074751 224
37 3300025944 Ga0207661_10958849 Ga0207661_109588492 224
38 3300025949 Ga0207667_10122532 Ga0207667_101225323 224
39 3300037068 Ga0373925_0115245 Ga0373925_0115245_749_1465 224
40 3300042006 Ga0439432_115886 Ga0439432_115886_20_694 224
41 3300049584 Ga0501068_0018852 Ga0501068_0018852_386_1060 224
42 3300049586 Ga0501070_0000956 Ga0501070_0000956_20674_21348 224
43 3300049587 Ga0501071_0017452 Ga0501071_0017452_200_874 224
44 3300049589 Ga0501073_0002974 Ga0501073_0002974_7395_8069 224
45 3300049741 Ga0501079_0010953 Ga0501079_0010953_2025_2699 224
46 3300049744 Ga0501083_0000154 Ga0501083_0000154_16998_17672 224
47 3300054114 Ga0501084_0013460 Ga0501084_0013460_4671_5345 224
48 3300060353 Ga0501082_0724460 Ga0501082_0724460_184_858 224
49 3300005336 Ga0070680_100542371 Ga0070680_1005423712 225
50 3300005614 Ga0068856_100196912 Ga0068856_1001969123 225
51 3300021358 Ga0213873_10003755 Ga0213873_100037553 225
52 3300021384 Ga0213876_10022661 Ga0213876_100226613 225
53 3300026078 Ga0207702_10135087 Ga0207702_101350872 225
54 3300032002 Ga0307416_100138516 Ga0307416_1001385162 225
55 3300035120 Ga0373957_0148605 Ga0373957_0148605_45_737 225
56 3300035724 Ga0373933_0160245 Ga0373933_0160245_389_1081 225
57 3300036401 Ga0373937_0310156 Ga0373937_0310156_735_1427 225
58 3300039437 Ga0436365_0778338 Ga0436365_0778338_757_1434 225
59 3300039437 Ga0436365_1661830 Ga0436365_1661830_1127_1822 225
60 3300039447 Ga0436361_0439103 Ga0436361_0439103_171_848 225
61 3300039453 Ga0436362_0893042 Ga0436362_0893042_3509_4186 225
62 3300042435 Ga0439434_0003060 Ga0439434_0003060_3664_4350 225
63 3300046462 Ga0495651_0010167 Ga0495651_0010167_2194_2886 225
64 3300046463 Ga0495653_0221335 Ga0495653_0221335_44_736 225
65 3300046559 Ga0495667_0007847 Ga0495667_0007847_431_1123 225
66 3300046679 Ga0495623_0033274 Ga0495623_0033274_847_1539 225
67 3300047322 Ga0495680_0018817 Ga0495680_0018817_5122_5814 225
68 3300049571 Ga0501034_0000666 Ga0501034_0000666_5595_6281 225
69 3300049573 Ga0501037_0014420 Ga0501037_0014420_2993_3679 225
70 3300049583 Ga0501067_0080773 Ga0501067_0080773_386_1084 225
71 3300049584 Ga0501068_0000098 Ga0501068_0000098_21711_22397 225
72 3300049587 Ga0501071_0132064 Ga0501071_0132064_728_1405 225
73 3300049588 Ga0501072_0018593 Ga0501072_0018593_2627_3313 225
74 3300049589 Ga0501073_0000578 Ga0501073_0000578_13170_13856 225
75 3300049590 Ga0501074_0000333 Ga0501074_0000333_16241_16927 225
76 3300049590 Ga0501074_0213285 Ga0501074_0213285_209_904 225
77 3300049742 Ga0501080_0002292 Ga0501080_0002292_2755_3441 225
78 3300049742 Ga0501080_0122856 Ga0501080_0122856_333_1019 225
79 3300049744 Ga0501083_0032737 Ga0501083_0032737_2126_2812 225
80 3300050512 nmdc:mga0n895_653192_c1 nmdc:mga0n895_653192_c1_352_1035 225
81 3300053084 Ga0495595_0079490 Ga0495595_0079490_742_1434 225
82 3300053085 Ga0495619_0357462 Ga0495619_0357462_270_962 225
83 3300061734 Ga0530510_0277547 Ga0530510_0277547_346_1032 225
84 3300005467 Ga0070706_100004421 Ga0070706_1000044211 226
85 3300006038 Ga0075365_10352368 Ga0075365_103523682 226
86 3300006048 Ga0075363_100114325 Ga0075363_1001143252 226
87 3300006051 Ga0075364_10172979 Ga0075364_101729791 226
88 3300006051 Ga0075364_10355854 Ga0075364_103558541 226
89 3300006178 Ga0075367_10008895 Ga0075367_100088952 226
90 3300013105 Ga0157369_10166710 Ga0157369_101667101 226
91 3300020078 Ga0206352_10956486 Ga0206352_109564861 226
92 3300025910 Ga0207684_10189723 Ga0207684_101897231 226
93 3300025929 Ga0207664_10120235 Ga0207664_101202352 226
94 3300028573 Ga0265334_10002063 Ga0265334_100020632 226
95 3300031691 Ga0316579_10040876 Ga0316579_100408762 226
96 3300031727 Ga0316576_10002852 Ga0316576_100028524 226
97 3300031728 Ga0316578_10008253 Ga0316578_100082534 226
98 3300031731 Ga0307405_10134200 Ga0307405_101342002 226
99 3300031733 Ga0316577_10077041 Ga0316577_100770412 226
100 3300031824 Ga0307413_10046357 Ga0307413_100463572 226
101 3300031852 Ga0307410_10007633 Ga0307410_100076335 226
102 3300031901 Ga0307406_10321004 Ga0307406_103210041 226
103 3300031995 Ga0307409_100027331 Ga0307409_1000273313 226
104 3300032005 Ga0307411_10215016 Ga0307411_102150162 226
105 3300032126 Ga0307415_100026858 Ga0307415_1000268583 226
106 3300032126 Ga0307415_100398038 Ga0307415_1003980382 226
107 3300035398 Ga0316574_0022064 Ga0316574_0022064_1970_2662 226
108 3300035398 Ga0316574_0105209 Ga0316574_0105209_616_1299 226
109 3300036647 Ga0316582_0045420 Ga0316582_0045420_122_814 226
110 3300036712 Ga0316584_0030312 Ga0316584_0030312_1470_2162 226
111 3300046559 Ga0495667_0148216 Ga0495667_0148216_596_1285 226
112 3300047320 Ga0495672_0000785 Ga0495672_0000785_25217_25915 226
113 3300049571 Ga0501034_0244854 Ga0501034_0244854_979_1662 226
114 3300049576 Ga0501040_0395959 Ga0501040_0395959_80_802 226
115 3300049581 Ga0501047_0166285 Ga0501047_0166285_554_1237 226
116 3300049584 Ga0501068_0004276 Ga0501068_0004276_6145_6843 226
117 3300049585 Ga0501069_0000036 Ga0501069_0000036_3477_4163 226
118 3300049586 Ga0501070_0000001 Ga0501070_0000001_207928_208614 226
119 3300049589 Ga0501073_0126679 Ga0501073_0126679_462_1160 226
120 3300049590 Ga0501074_0147472 Ga0501074_0147472_862_1548 226
121 3300049742 Ga0501080_0005133 Ga0501080_0005133_8314_9000 226
122 3300049742 Ga0501080_0239568 Ga0501080_0239568_796_1482 226
123 3300050491 nmdc:mga00v17_86775_c1 nmdc:mga00v17_86775_c1_924_1607 226
124 3300050494 nmdc:mga06z11_175672_c1 nmdc:mga06z11_175672_c1_22_705 226
125 3300050494 nmdc:mga06z11_20409_c1 nmdc:mga06z11_20409_c1_394_1077 226
126 3300053139 Ga0500568_0000182 Ga0500568_0000182_3912_4595 226
127 3300053153 Ga0500616_0002998 Ga0500616_0002998_10481_11179 226
128 3300060353 Ga0501082_0212710 Ga0501082_0212710_27_725 226
129 3300005344 Ga0070661_100052658 Ga0070661_1000526582 227
130 3300013297 Ga0157378_10542154 Ga0157378_105421542 227
131 3300013297 Ga0157378_10852960 Ga0157378_108529601 227
132 3300013308 Ga0157375_10781364 Ga0157375_107813642 227
133 3300020610 Ga0154015_1123049 Ga0154015_11230492 227
134 3300022467 Ga0224712_10012787 Ga0224712_100127872 227
135 3300025920 Ga0207649_10059583 Ga0207649_100595832 227
136 3300036401 Ga0373937_0192668 Ga0373937_0192668_448_1149 227
137 3300046462 Ga0495651_0463738 Ga0495651_0463738_68_769 227
138 3300046511 Ga0495608_0127415 Ga0495608_0127415_445_1146 227
139 3300046514 Ga0495618_0111472 Ga0495618_0111472_631_1323 227
140 3300046678 Ga0495599_0448885 Ga0495599_0448885_21_716 227
141 3300047321 Ga0495676_0348028 Ga0495676_0348028_28_729 227
142 3300005937 Ga0081455_10018960 Ga0081455_100189604 229
143 3300005937 Ga0081455_10075404 Ga0081455_100754042 229
144 3300006844 Ga0075428_100001826 Ga0075428_10000182619 229
145 3300006846 Ga0075430_100000810 Ga0075430_10000081022 229
146 3300006846 Ga0075430_100049510 Ga0075430_1000495102 229
147 3300006846 Ga0075430_100308578 Ga0075430_1003085782 229
148 3300006847 Ga0075431_100116446 Ga0075431_1001164462 229
149 3300006847 Ga0075431_100265432 Ga0075431_1002654322 229
150 3300006880 Ga0075429_100001378 Ga0075429_1000013784 229
151 3300009147 Ga0114129_10001676 Ga0114129_100016765 229
152 3300026116 Ga0207674_10537814 Ga0207674_105378141 229
153 3300039438 Ga0436360_0188167 Ga0436360_0188167_1213_1908 229
154 3300039453 Ga0436362_1298938 Ga0436362_1298938_413_1108 229
155 3300050507 nmdc:mga05p37_44428_c1 nmdc:mga05p37_44428_c1_3364_4098 229
156 3300050508 nmdc:mga09592_19020_c1 nmdc:mga09592_19020_c1_2232_2921 229
157 3300050509 nmdc:mga0qj67_257764_c1 nmdc:mga0qj67_257764_c1_712_1401 229
158 3300050510 nmdc:mga06r32_343764_c1 nmdc:mga06r32_343764_c1_670_1359 229
159 3300050511 nmdc:mga08y16_271706_c1 nmdc:mga08y16_271706_c1_951_1685 229
160 3300050511 nmdc:mga08y16_75837_c1 nmdc:mga08y16_75837_c1_2587_3276 229
161 3300003373 JGI25407J50210_10005053 JGI25407J50210_100050531 230
162 3300005937 Ga0081455_10000348 Ga0081455_100003484 230
163 3300005937 Ga0081455_10012373 Ga0081455_100123737 230
164 3300005937 Ga0081455_10048249 Ga0081455_100482493 230
165 3300005937 Ga0081455_10329023 Ga0081455_103290232 230
166 3300005981 Ga0081538_10001628 Ga0081538_100016284 230
167 3300005981 Ga0081538_10007297 Ga0081538_100072974 230
168 3300006038 Ga0075365_10006736 Ga0075365_100067362 230
169 3300006038 Ga0075365_10058990 Ga0075365_100589902 230
170 3300006051 Ga0075364_10000351 Ga0075364_1000035118 230
171 3300006844 Ga0075428_100000156 Ga0075428_10000015642 230
172 3300006844 Ga0075428_100011341 Ga0075428_1000113416 230
173 3300006844 Ga0075428_100952595 Ga0075428_1009525952 230
174 3300006846 Ga0075430_100002139 Ga0075430_1000021393 230
175 3300006846 Ga0075430_100099342 Ga0075430_1000993423 230
176 3300006846 Ga0075430_100178528 Ga0075430_1001785281 230
177 3300006847 Ga0075431_100000246 Ga0075431_1000002468 230
178 3300006847 Ga0075431_100041919 Ga0075431_1000419194 230
179 3300006847 Ga0075431_100255983 Ga0075431_1002559832 230
180 3300006880 Ga0075429_100027012 Ga0075429_1000270123 230
181 3300006880 Ga0075429_100478653 Ga0075429_1004786532 230
182 3300009094 Ga0111539_10001123 Ga0111539_1000112317 230
183 3300009147 Ga0114129_10028635 Ga0114129_100286353 230
184 3300013306 Ga0163162_10923696 Ga0163162_109236962 230
185 3300013308 Ga0157375_10186098 Ga0157375_101860982 230
186 3300025926 Ga0207659_10327303 Ga0207659_103273032 230
187 3300025927 Ga0207687_10174761 Ga0207687_101747612 230
188 3300026121 Ga0207683_10432840 Ga0207683_104328401 230
189 3300031251 Ga0265327_10038502 Ga0265327_100385022 230
190 3300031728 Ga0316578_10059034 Ga0316578_100590342 230
191 3300035398 Ga0316574_0067541 Ga0316574_0067541_1126_1869 230
192 3300042005 Ga0439448_0063458 Ga0439448_0063458_490_1182 230
193 3300042008 Ga0439450_001996 Ga0439450_001996_1281_1973 230
194 3300042016 Ga0439463_014164 Ga0439463_014164_253_945 230
195 3300042439 Ga0439464_0046895 Ga0439464_0046895_522_1214 230
196 3300042461 Ga0439460_0007696 Ga0439460_0007696_1773_2465 230
197 3300042993 Ga0439440_0000440 Ga0439440_0000440_3325_4017 230
198 3300046794 Ga0495589_0191100 Ga0495589_0191100_41_748 230
199 3300047321 Ga0495676_0258350 Ga0495676_0258350_440_1165 230
200 3300049568 Ga0501031_0016713 Ga0501031_0016713_1484_2176 230
201 3300049568 Ga0501031_0125623 Ga0501031_0125623_785_1477 230
202 3300049569 Ga0501032_0168339 Ga0501032_0168339_177_869 230
203 3300049570 Ga0501033_0051994 Ga0501033_0051994_1956_2648 230
204 3300049570 Ga0501033_0150209 Ga0501033_0150209_785_1477 230
205 3300049571 Ga0501034_0000723 Ga0501034_0000723_48890_49639 230
206 3300049571 Ga0501034_0026918 Ga0501034_0026918_1425_2174 230
207 3300049571 Ga0501034_0344420 Ga0501034_0344420_589_1347 230
208 3300049572 Ga0501036_0002598 Ga0501036_0002598_2389_3081 230
209 3300049572 Ga0501036_0319737 Ga0501036_0319737_587_1279 230
210 3300049574 Ga0501038_0045972 Ga0501038_0045972_1254_1946 230
211 3300049575 Ga0501039_0003715 Ga0501039_0003715_8697_9389 230
212 3300049575 Ga0501039_0007909 Ga0501039_0007909_4768_5460 230
213 3300049576 Ga0501040_0005185 Ga0501040_0005185_4038_4730 230
214 3300049576 Ga0501040_0016614 Ga0501040_0016614_1498_2190 230
215 3300049577 Ga0501041_0001373 Ga0501041_0001373_10131_10823 230
216 3300049578 Ga0501042_0017955 Ga0501042_0017955_945_1637 230
217 3300049579 Ga0501043_0107989 Ga0501043_0107989_780_1472 230
218 3300049580 Ga0501046_0010757 Ga0501046_0010757_2918_3610 230
219 3300049580 Ga0501046_0016688 Ga0501046_0016688_1280_1972 230
220 3300049582 Ga0501048_0054451 Ga0501048_0054451_2087_2779 230
221 3300049582 Ga0501048_0144840 Ga0501048_0144840_713_1405 230
222 3300049587 Ga0501071_0044457 Ga0501071_0044457_1177_1869 230
223 3300049588 Ga0501072_0003721 Ga0501072_0003721_3023_3715 230
224 3300049588 Ga0501072_0055162 Ga0501072_0055162_1169_1861 230
225 3300049588 Ga0501072_0119284 Ga0501072_0119284_584_1276 230
226 3300049590 Ga0501074_0558409 Ga0501074_0558409_16_708 230
227 3300049591 Ga0501075_0004343 Ga0501075_0004343_3096_3788 230
228 3300049591 Ga0501075_0032420 Ga0501075_0032420_741_1433 230
229 3300049592 Ga0501076_0003837 Ga0501076_0003837_3006_3698 230
230 3300049592 Ga0501076_0013640 Ga0501076_0013640_3462_4154 230
231 3300049593 Ga0501077_0000905 Ga0501077_0000905_15269_15961 230
232 3300049593 Ga0501077_0004444 Ga0501077_0004444_38_730 230
233 3300049593 Ga0501077_0092440 Ga0501077_0092440_1187_1879 230
234 3300049741 Ga0501079_0029548 Ga0501079_0029548_3004_3696 230
235 3300049741 Ga0501079_0072086 Ga0501079_0072086_66_758 230
236 3300049743 Ga0501081_0007526 Ga0501081_0007526_2250_2942 230
237 3300049743 Ga0501081_0453744 Ga0501081_0453744_145_924 230
238 3300049822 Ga0501035_0067797 Ga0501035_0067797_879_1571 230
239 3300049824 Ga0501045_0004150 Ga0501045_0004150_5979_6671 230
240 3300049824 Ga0501045_0027899 Ga0501045_0027899_1180_1872 230
241 3300050491 nmdc:mga00v17_228966_c1 nmdc:mga00v17_228966_c1_152_859 230
242 3300050491 nmdc:mga00v17_78779_c1 nmdc:mga00v17_78779_c1_155_859 230
243 3300050492 nmdc:mga0yw44_1472_c1 nmdc:mga0yw44_1472_c1_8408_9115 230
244 3300050507 nmdc:mga05p37_240114_c1 nmdc:mga05p37_240114_c1_878_1570 230
245 3300050507 nmdc:mga05p37_688112_c1 nmdc:mga05p37_688112_c1_26_721 230
246 3300050508 nmdc:mga09592_1585_c1 nmdc:mga09592_1585_c1_16844_17536 230
247 3300050508 nmdc:mga09592_29003_c1 nmdc:mga09592_29003_c1_3137_3829 230
248 3300050509 nmdc:mga0qj67_103387_c1 nmdc:mga0qj67_103387_c1_1049_1744 230
249 3300050509 nmdc:mga0qj67_193655_c1 nmdc:mga0qj67_193655_c1_618_1310 230
250 3300050510 nmdc:mga06r32_114135_c1 nmdc:mga06r32_114135_c1_1103_1798 230
251 3300050510 nmdc:mga06r32_193728_c1 nmdc:mga06r32_193728_c1_1113_1805 230
252 3300050510 nmdc:mga06r32_515_c1 nmdc:mga06r32_515_c1_24713_25405 230
253 3300050511 nmdc:mga08y16_14967_c1 nmdc:mga08y16_14967_c1_6925_7617 230
254 3300053094 Ga0500566_0000127 Ga0500566_0000127_20371_21087 230
255 3300054114 Ga0501084_0008127 Ga0501084_0008127_6847_7539 230
256 3300054114 Ga0501084_0057792 Ga0501084_0057792_1298_1990 230
257 3300060353 Ga0501082_0005847 Ga0501082_0005847_5187_5879 230
258 3300060353 Ga0501082_0048549 Ga0501082_0048549_1116_1808 230
259 3300061734 Ga0530510_0002648 Ga0530510_0002648_5010_5702 230
260 3300061734 Ga0530510_0006115 Ga0530510_0006115_7612_8304 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

73

235

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8v-assembly1.cif.gz_A paps reductase in a covalent complex with thioredoxin c35a 0.9166 18 201
2goy-assembly2.cif.gz_E crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps 0.9007 20 218
1sur-assembly1.cif.gz_A-2 phospho-adenylyl-sulfate reductase 0.8961 14 201
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.892 15 207
6vpu-assembly3.cif.gz_C 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.8918 15 201
ID Description Score Start End Superfamily
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9243 17 229 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9023 14 201 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9007 20 218 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8624 15 229 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8548 17 229 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W0KRT1-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9875 38 230 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814
AF-A0A6L7JNM5-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9827 10 230 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814
AF-A0A7W1YT88-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9769 125 230 GO:0004604
GO:0005737
GO:0019379
AF-A0A7K1BM91-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9757 8 212 GO:0004604
GO:0005737
GO:0019379
AF-A0A7W0KRT1-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9725 38 230 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814

Feature Viewer

pLDDT pTM Quality
91.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map