F369900

General Info

Members Datasets Scaffolds Average Seq Length
260 173 260 341

Family's Representative Sequence

Representative Sequence 3300049656|Ga0501209_001936|Ga0501209_001936_1175_2410
Length 411
Sequence MTTIATPSALGYRMPAEWEPHRGTWLSWPHKEASXXXXFGPVPKIFAAMVRHVADHEEVHINVAGSEMEHDVRRLLADEGAGSGNVFFHYHPTNDAWCRDHGPIFVQRETPDQPQAIIDWDFNAWGGKYPPYDLDDVIPTRIAHELGLPVFNPGIVMEGGSIDVNGRGTLLTTEACLLNSNRNPHLNRDGIEEYLRAYLGVSHILWLGEGIEGDDTDGHVDDLTRFVSSDTVVTVVEDDPTDPNYEPLQNNLERLNRMTDQAGQPLRVVSLPMPRTLHHEGQRLPASYANFYIANGVVLLPTYDPSRDSEACATLQSLFPDREVVGIDCTDLVWGLGAFHCVTQQWPADPPCSAATTSARSPRGPPGALRSCRRQFPLYAADPPFCSPRTGQRPSDMPVRWYPPGTPTCRP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 3.08
Rhizosphere 94.23
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10066770 3300005328 Bacteria 2149
2 Ga0070690_100014581 3300005330 Bacteria 4665
3 Ga0070677_10003260 3300005333 Bacteria 5227
4 Ga0070680_100004850 3300005336 Bacteria 10127
5 Ga0070680_100178153 3300005336 Bacteria 1790
6 Ga0070689_100010879 3300005340 Bacteria 6502
7 Ga0070689_100026937 3300005340 Unclassified 4331
8 Ga0070689_100105842 3300005340 Bacteria 2231
9 Ga0070668_100001641 3300005347 Bacteria 16221
10 Ga0070669_100009416 3300005353 Bacteria 6954
11 Ga0070669_100101317 3300005353 Bacteria 2173
12 Ga0070675_100222788 3300005354 Bacteria 1643
13 Ga0070675_100300211 3300005354 Unclassified 1415
14 Ga0070674_100001154 3300005356 Bacteria 13918
15 Ga0070673_100171220 3300005364 Bacteria 1854
16 Ga0070688_100008589 3300005365 Bacteria 5556
17 Ga0070711_100370164 3300005439 Bacteria 1156
18 Ga0070705_100000614 3300005440 Bacteria 20625
19 Ga0070705_100024971 3300005440 Bacteria 3233
20 Ga0070694_100042433 3300005444 Bacteria 3038
21 Ga0070708_100002791 3300005445 Bacteria 13573
22 Ga0070708_100048845 3300005445 Bacteria 3743
23 Ga0070678_100046536 3300005456 Bacteria 3111
24 Ga0070662_100004666 3300005457 Bacteria 8691
25 Ga0068867_100004996 3300005459 Bacteria 9349
26 Ga0070706_100002873 3300005467 Bacteria 17160
27 Ga0070707_100013735 3300005468 Bacteria 7583
28 Ga0070699_100004839 3300005518 Bacteria 11879
29 Ga0070679_100038328 3300005530 Bacteria 4764
30 Ga0070697_100028520 3300005536 Bacteria 4470
31 Ga0070697_100035944 3300005536 Bacteria 3999
32 Ga0070697_100142644 3300005536 Bacteria 2015
33 Ga0070672_100096678 3300005543 Bacteria 2390
34 Ga0070686_100002954 3300005544 Bacteria 9327
35 Ga0070696_100008024 3300005546 Bacteria 7053
36 Ga0070696_100025301 3300005546 Bacteria 4034
37 Ga0070665_100027066 3300005548 Bacteria 5775
38 Ga0070704_100020577 3300005549 Bacteria 4257
39 Ga0070704_100139568 3300005549 Bacteria 1890
40 Ga0068855_100092050 3300005563 Bacteria 3497
41 Ga0068855_100115758 3300005563 Bacteria 3073
42 Ga0068859_100044071 3300005617 Unclassified 4484
43 Ga0068859_100122796 3300005617 Bacteria 2664
44 Ga0068866_10000672 3300005718 Bacteria 15505
45 Ga0068861_100033474 3300005719 Bacteria 3791
46 Ga0068860_100023982 3300005843 Bacteria 5897
47 Ga0075428_100007653 3300006844 Bacteria 11975
48 Ga0075428_100072833 3300006844 Bacteria 3752
49 Ga0075431_100016382 3300006847 Bacteria 7521
50 Ga0075431_100058624 3300006847 Bacteria 3974
51 Ga0075431_100119848 3300006847 Bacteria 2715
52 Ga0075433_10017655 3300006852 Bacteria 5918
53 Ga0075434_100001798 3300006871 Bacteria 18527
54 Ga0075429_100051741 3300006880 Unclassified 3573
55 Ga0068865_100000264 3300006881 Bacteria 28723
56 Ga0097620_100044072 3300006931 Unclassified 4484
57 Ga0097620_100122803 3300006931 Bacteria 2664
58 Ga0105240_10140122 3300009093 Bacteria 2892
59 Ga0111539_10087613 3300009094 Unclassified 3657
60 Ga0111539_10094701 3300009094 Bacteria 3509
61 Ga0111539_10115140 3300009094 Bacteria 3153
62 Ga0111539_10299376 3300009094 Bacteria 1872
63 Ga0105245_10163521 3300009098 Bacteria 2113
64 Ga0114129_10000471 3300009147 Bacteria 48410
65 Ga0114129_10199460 3300009147 Bacteria 2711
66 Ga0114129_10489974 3300009147 Bacteria 1607
67 Ga0105243_10002943 3300009148 Bacteria 14082
68 Ga0105241_10008224 3300009174 Bacteria 7681
69 Ga0105242_10041886 3300009176 Bacteria 3695
70 Ga0105248_10115325 3300009177 Bacteria 3030
71 Ga0105248_10185760 3300009177 Bacteria 2342
72 Ga0105249_10103863 3300009553 Bacteria 2677
73 Ga0105239_10059237 3300010375 Bacteria 4203
74 Ga0105239_10597799 3300010375 Bacteria 1258
75 Ga0157371_10054408 3300013102 Bacteria 2843
76 Ga0157378_10005877 3300013297 Bacteria 10749
77 Ga0163162_10036455 3300013306 Bacteria 4902
78 Ga0163162_10222507 3300013306 Bacteria 2017
79 Ga0157375_10367330 3300013308 Bacteria 1605
80 Ga0163163_10045914 3300014325 Bacteria 4289
81 Ga0157380_10086738 3300014326 Bacteria 2573
82 Ga0157379_10001200 3300014968 Bacteria 21089
83 Ga0157379_10059983 3300014968 Bacteria 3401
84 Ga0163161_10125781 3300017792 Bacteria 1930
85 Ga0213876_10030768 3300021384 Bacteria 2832
86 Ga0213876_10076050 3300021384 Bacteria 1773
87 Ga0207642_10021677 3300025899 Bacteria 2534
88 Ga0207645_10000536 3300025907 Bacteria 31571
89 Ga0207684_10009643 3300025910 Bacteria 8515
90 Ga0207654_10044785 3300025911 Bacteria 2515
91 Ga0207707_10077193 3300025912 Bacteria 2907
92 Ga0207707_10115354 3300025912 Bacteria 2347
93 Ga0207652_10138283 3300025921 Bacteria 2176
94 Ga0207646_10026722 3300025922 Bacteria 5265
95 Ga0207681_10157094 3300025923 Bacteria 1710
96 Ga0207659_10141536 3300025926 Bacteria 1868
97 Ga0207706_10000038 3300025933 Bacteria 132725
98 Ga0207686_10000481 3300025934 Bacteria 26333
99 Ga0207670_10000896 3300025936 Bacteria 15698
100 Ga0207670_10004343 3300025936 Bacteria 7619
101 Ga0207691_10059350 3300025940 Bacteria 3479
102 Ga0207711_10029091 3300025941 Bacteria 4657
103 Ga0207689_10000945 3300025942 Bacteria 27917
104 Ga0207679_10025186 3300025945 Bacteria 4089
105 Ga0207667_10079740 3300025949 Bacteria 3393
106 Ga0207651_10335934 3300025960 Bacteria 1268
107 Ga0207703_10146943 3300026035 Bacteria 2051
108 Ga0207708_10129285 3300026075 Bacteria 1974
109 Ga0207641_10092779 3300026088 Bacteria 2645
110 Ga0207648_10000036 3300026089 Bacteria 122209
111 Ga0207676_10009545 3300026095 Bacteria 6908
112 Ga0207675_100050955 3300026118 Bacteria 3863
113 Ga0268266_10000353 3300028379 Bacteria 70990
114 Ga0268264_10080355 3300028381 Bacteria 2784
115 Ga0265338_10000471 3300028800 Bacteria 71881
116 Ga0265338_10014520 3300028800 Bacteria 8754
117 Ga0307512_10157821 3300030522 Bacteria 1338
118 Ga0265332_10000044 3300031238 Bacteria 114444
119 Ga0265328_10077161 3300031239 Bacteria 1226
120 Ga0265325_10000151 3300031241 Bacteria 49073
121 Ga0265329_10002951 3300031242 Bacteria 7569
122 Ga0265329_10005817 3300031242 Bacteria 4949
123 Ga0265339_10000181 3300031249 Bacteria 53469
124 Ga0265339_10004898 3300031249 Bacteria 9030
125 Ga0265339_10031038 3300031249 Bacteria 3022
126 Ga0265331_10000076 3300031250 Bacteria 145884
127 Ga0265331_10000166 3300031250 Bacteria 81796
128 Ga0265331_10021155 3300031250 Bacteria 3332
129 Ga0265316_10000006 3300031344 Bacteria 289686
130 Ga0307408_100013430 3300031548 Bacteria 5435
131 Ga0265313_10000750 3300031595 Bacteria 33181
132 Ga0265314_10000056 3300031711 Bacteria 171647
133 Ga0265314_10000290 3300031711 Bacteria 72189
134 Ga0265314_10007990 3300031711 Bacteria 9123
135 Ga0265314_10030759 3300031711 Bacteria 3971
136 Ga0265342_10040771 3300031712 Bacteria 2814
137 Ga0307405_10021807 3300031731 Bacteria 3608
138 Ga0307405_10107097 3300031731 Bacteria 1886
139 Ga0307413_10004983 3300031824 Bacteria 5858
140 Ga0307413_10018306 3300031824 Unclassified 3672
141 Ga0307413_10176779 3300031824 Bacteria 1517
142 Ga0307410_10030065 3300031852 Bacteria 3467
143 Ga0307410_10073873 3300031852 Bacteria 2372
144 Ga0307410_10125851 3300031852 Bacteria 1876
145 Ga0307406_10078716 3300031901 Bacteria 2184
146 Ga0307412_10065185 3300031911 Bacteria 2464
147 Ga0307409_100006205 3300031995 Bacteria 6994
148 Ga0307409_100088093 3300031995 Bacteria 2533
149 Ga0307409_100218179 3300031995 Bacteria 1720
150 Ga0307416_100001477 3300032002 Bacteria 12800
151 Ga0307416_100005147 3300032002 Bacteria 7988
152 Ga0307416_100064448 3300032002 Bacteria 3006
153 Ga0307416_100139756 3300032002 Bacteria 2199
154 Ga0307411_10009060 3300032005 Bacteria 5207
155 Ga0307411_10010998 3300032005 Bacteria 4857
156 Ga0307411_10012258 3300032005 Bacteria 4668
157 Ga0307411_10019008 3300032005 Bacteria 3958
158 Ga0307411_10020253 3300032005 Bacteria 3864
159 Ga0307411_10053350 3300032005 Bacteria 2648
160 Ga0307411_10091965 3300032005 Bacteria 2121
161 Ga0307415_100005743 3300032126 Bacteria 6617
162 Ga0307415_100115954 3300032126 Bacteria 1997
163 Ga0307415_100126061 3300032126 Bacteria 1930
164 Ga0373935_0042043 3300035692 Bacteria 2873
165 Ga0373925_0009615 3300037068 Bacteria 7046
166 Ga0395901_0419072 3300038443 Bacteria 1373
167 Ga0436365_1679983 3300039437 Bacteria 1743
168 Ga0439435_0033144 3300042436 Bacteria 1413
169 Ga0451577_0011905 3300042876 Bacteria 8203
170 Ga0451577_0151428 3300042876 Bacteria 2087
171 Ga0453683_0002424 3300044673 Bacteria 14497
172 Ga0453683_0066955 3300044673 Bacteria 2245
173 Ga0451576_0001626 3300045051 Bacteria 37654
174 Ga0451576_0048737 3300045051 Bacteria 4448
175 Ga0451576_0189244 3300045051 Bacteria 2149
176 Ga0451576_0198598 3300045051 Bacteria 2095
177 Ga0495592_0000137 3300046454 Bacteria 64327
178 Ga0495603_0030029 3300046455 Bacteria 3275
179 Ga0495580_0001598 3300046472 Bacteria 19894
180 Ga0495662_0011848 3300046476 Unclassified 4261
181 Ga0495618_0016194 3300046514 Unclassified 4557
182 Ga0495628_0001043 3300046516 Bacteria 25365
183 Ga0495630_0017838 3300046517 Bacteria 5206
184 Ga0495586_0011562 3300046535 Bacteria 4695
185 Ga0495586_0023292 3300046535 Unclassified 3306
186 Ga0495645_0084329 3300046543 Bacteria 2275
187 Ga0495674_0015641 3300047319 Bacteria 7084
188 Ga0495680_0133695 3300047322 Unclassified 1820
189 Ga0496104_0007861 3300048907 Bacteria 9454
190 Ga0496108_0000224 3300048911 Bacteria 50600
191 Ga0496110_0079093 3300048913 Bacteria 2927
192 Ga0496112_0000156 3300048915 Bacteria 42945
193 Ga0496112_0225831 3300048915 Bacteria 1828
194 Ga0496113_0000224 3300048916 Bacteria 26509
195 Ga0496114_0016464 3300048917 Bacteria 5959
196 Ga0496115_0049348 3300048918 Bacteria 3369
197 Ga0496126_0048954 3300048929 Bacteria 3860
198 Ga0501034_0001775 3300049571 Bacteria 27580
199 Ga0501034_0126063 3300049571 Bacteria 2546
200 Ga0501034_0228942 3300049571 Bacteria 1808
201 Ga0501039_0305770 3300049575 Bacteria 1250
202 Ga0501043_0072459 3300049579 Bacteria 2706
203 Ga0501046_0015377 3300049580 Bacteria 6433
204 Ga0501046_0018055 3300049580 Bacteria 5877
205 Ga0501047_0077832 3300049581 Bacteria 3189
206 Ga0501047_0442524 3300049581 Bacteria 1129
207 Ga0501048_0146664 3300049582 Bacteria 1669
208 Ga0501067_0000266 3300049583 Bacteria 28520
209 Ga0501069_0000254 3300049585 Bacteria 24126
210 Ga0501070_0000849 3300049586 Bacteria 27734
211 Ga0501070_0001664 3300049586 Bacteria 19688
212 Ga0501070_0076853 3300049586 Bacteria 2764
213 Ga0501071_0197287 3300049587 Bacteria 1511
214 Ga0501072_0000338 3300049588 Bacteria 33400
215 Ga0501074_0000589 3300049590 Bacteria 22567
216 Ga0501075_0121131 3300049591 Bacteria 1991
217 Ga0501076_0430319 3300049592 Bacteria 1086
218 Ga0501077_0018620 3300049593 Bacteria 4391
219 Ga0501077_0027547 3300049593 Bacteria 3608
220 Ga0501209_001936 3300049656 Bacteria 3064
221 Ga0501257_034104 3300049686 Bacteria 1235
222 Ga0501079_0005587 3300049741 Bacteria 9385
223 Ga0501079_0119706 3300049741 Bacteria 2047
224 Ga0501080_0001482 3300049742 Bacteria 19788
225 Ga0501080_0067088 3300049742 Bacteria 3337
226 Ga0501080_0284593 3300049742 Bacteria 1502
227 Ga0501080_0292555 3300049742 Bacteria 1479
228 Ga0501081_0015656 3300049743 Bacteria 5005
229 Ga0501081_0035492 3300049743 Bacteria 3394
230 Ga0501081_0102652 3300049743 Bacteria 2023
231 Ga0501083_0000370 3300049744 Bacteria 28443
232 Ga0501272_004417 3300049769 Bacteria 1461
233 Ga0501044_0027130 3300049823 Bacteria 6058
234 Ga0501045_0113638 3300049824 Bacteria 2008
235 nmdc:mga05p37_267769_c1 3300050507 Bacteria 2042
236 nmdc:mga05p37_7556_c1 3300050507 Bacteria 12818
237 nmdc:mga09592_55109_c1 3300050508 Unclassified 3360
238 nmdc:mga09592_59073_c1 3300050508 Bacteria 3242
239 nmdc:mga0qj67_31390_c1 3300050509 Bacteria 4138
240 nmdc:mga06r32_112098_c1 3300050510 Bacteria 2684
241 nmdc:mga06r32_12300_c1 3300050510 Bacteria 7718
242 nmdc:mga06r32_21082_c1 3300050510 Bacteria 6012
243 nmdc:mga06r32_292504_c1 3300050510 Bacteria 1615
244 nmdc:mga08y16_38045_c1 3300050511 Bacteria 5051
245 nmdc:mga08y16_43826_c1 3300050511 Bacteria 4688
246 nmdc:mga0n895_19669_c1 3300050512 Bacteria 6278
247 nmdc:mga0rr50_200899_c1 3300050513 Bacteria 1638
248 Ga0495619_0219921 3300053085 Bacteria 1316
249 Ga0500555_000018 3300053103 Bacteria 183559
250 Ga0500616_0035266 3300053153 Bacteria 2721
251 Ga0501084_0023363 3300054114 Bacteria 5161
252 Ga0501084_0023550 3300054114 Bacteria 5136
253 Ga0501084_0116242 3300054114 Bacteria 2249
254 Ga0590071_001110 3300059421 Bacteria 7286
255 Ga0590071_007573 3300059421 Bacteria 2570
256 Ga0590075_007468 3300059424 Bacteria 2598
257 Ga0590077_007123 3300059426 Bacteria 2291
258 Ga0501082_0000782 3300060353 Bacteria 27952
259 Ga0501082_0114591 3300060353 Bacteria 2334
260 Ga0501082_0121504 3300060353 Bacteria 2264

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0030029 Ga0495603_0030029_728_1678 301
2 3300047319 Ga0495674_0015641 Ga0495674_0015641_84_1001 302
3 3300048915 Ga0496112_0225831 Ga0496112_0225831_602_1558 302
4 3300050508 nmdc:mga09592_59073_c1 nmdc:mga09592_59073_c1_2313_3224 302
5 3300050509 nmdc:mga0qj67_31390_c1 nmdc:mga0qj67_31390_c1_2005_2973 302
6 3300050510 nmdc:mga06r32_12300_c1 nmdc:mga06r32_12300_c1_6106_7074 302
7 3300059426 Ga0590077_007123 Ga0590077_007123_866_1783 302
8 3300010375 Ga0105239_10597799 Ga0105239_105977991 305
9 3300009094 Ga0111539_10094701 Ga0111539_100947011 308
10 3300031250 Ga0265331_10000166 Ga0265331_1000016629 311
11 3300031595 Ga0265313_10000750 Ga0265313_1000075027 311
12 3300031711 Ga0265314_10000290 Ga0265314_1000029029 311
13 3300005548 Ga0070665_100027066 Ga0070665_1000270665 312
14 3300028379 Ga0268266_10000353 Ga0268266_1000035364 312
15 3300006847 Ga0075431_100119848 Ga0075431_1001198483 313
16 3300006871 Ga0075434_100001798 Ga0075434_10000179814 313
17 3300009093 Ga0105240_10140122 Ga0105240_101401222 313
18 3300009098 Ga0105245_10163521 Ga0105245_101635213 313
19 3300009148 Ga0105243_10002943 Ga0105243_100029432 313
20 3300009174 Ga0105241_10008224 Ga0105241_100082246 313
21 3300009176 Ga0105242_10041886 Ga0105242_100418862 313
22 3300009177 Ga0105248_10185760 Ga0105248_101857602 313
23 3300009553 Ga0105249_10103863 Ga0105249_101038632 313
24 3300010375 Ga0105239_10059237 Ga0105239_100592373 313
25 3300013102 Ga0157371_10054408 Ga0157371_100544082 313
26 3300013297 Ga0157378_10005877 Ga0157378_100058775 313
27 3300013306 Ga0163162_10222507 Ga0163162_102225072 313
28 3300014326 Ga0157380_10086738 Ga0157380_100867383 313
29 3300014968 Ga0157379_10059983 Ga0157379_100599833 313
30 3300048917 Ga0496114_0016464 Ga0496114_0016464_4554_5495 313
31 3300053085 Ga0495619_0219921 Ga0495619_0219921_45_1040 313
32 3300049592 Ga0501076_0430319 Ga0501076_0430319_34_1050 318
33 3300009147 Ga0114129_10000471 Ga0114129_1000047130 320
34 3300028800 Ga0265338_10014520 Ga0265338_100145207 320
35 3300031241 Ga0265325_10000151 Ga0265325_1000015130 320
36 3300031249 Ga0265339_10000181 Ga0265339_1000018122 320
37 3300031712 Ga0265342_10040771 Ga0265342_100407713 320
38 3300032005 Ga0307411_10091965 Ga0307411_100919651 320
39 3300054114 Ga0501084_0116242 Ga0501084_0116242_355_1380 320
40 3300005439 Ga0070711_100370164 Ga0070711_1003701641 321
41 3300026088 Ga0207641_10092779 Ga0207641_100927793 321
42 3300026095 Ga0207676_10009545 Ga0207676_100095452 321
43 3300048907 Ga0496104_0007861 Ga0496104_0007861_4046_5056 321
44 3300048911 Ga0496108_0000224 Ga0496108_0000224_34163_35173 321
45 3300048913 Ga0496110_0079093 Ga0496110_0079093_442_1452 321
46 3300048915 Ga0496112_0000156 Ga0496112_0000156_14071_15081 321
47 3300048916 Ga0496113_0000224 Ga0496113_0000224_11414_12424 321
48 3300050507 nmdc:mga05p37_7556_c1 nmdc:mga05p37_7556_c1_5490_6545 321
49 3300050510 nmdc:mga06r32_112098_c1 nmdc:mga06r32_112098_c1_228_1283 321
50 3300050512 nmdc:mga0n895_19669_c1 nmdc:mga0n895_19669_c1_2779_3834 321
51 3300050513 nmdc:mga0rr50_200899_c1 nmdc:mga0rr50_200899_c1_415_1425 321
52 3300060353 Ga0501082_0121504 Ga0501082_0121504_1184_2197 321
53 3300032005 Ga0307411_10020253 Ga0307411_100202532 322
54 3300049571 Ga0501034_0228942 Ga0501034_0228942_547_1563 322
55 3300049580 Ga0501046_0018055 Ga0501046_0018055_4250_5266 322
56 3300049581 Ga0501047_0442524 Ga0501047_0442524_74_1090 322
57 3300049823 Ga0501044_0027130 Ga0501044_0027130_1574_2590 322
58 3300049575 Ga0501039_0305770 Ga0501039_0305770_205_1221 323
59 3300049587 Ga0501071_0197287 Ga0501071_0197287_481_1497 323
60 3300049593 Ga0501077_0018620 Ga0501077_0018620_173_1189 323
61 3300049743 Ga0501081_0102652 Ga0501081_0102652_816_1832 323
62 3300054114 Ga0501084_0023550 Ga0501084_0023550_3177_4193 323
63 3300005354 Ga0070675_100222788 Ga0070675_1002227882 324
64 3300009147 Ga0114129_10199460 Ga0114129_101994602 324
65 3300047322 Ga0495680_0133695 Ga0495680_0133695_571_1593 325
66 3300049579 Ga0501043_0072459 Ga0501043_0072459_1424_2452 325
67 3300049580 Ga0501046_0015377 Ga0501046_0015377_4454_5482 325
68 3300049581 Ga0501047_0077832 Ga0501047_0077832_1100_2128 325
69 3300049586 Ga0501070_0001664 Ga0501070_0001664_18447_19475 325
70 3300059421 Ga0590071_007573 Ga0590071_007573_60_1130 325
71 3300025945 Ga0207679_10025186 Ga0207679_100251863 326
72 3300031995 Ga0307409_100218179 Ga0307409_1002181792 326
73 3300059421 Ga0590071_001110 Ga0590071_001110_1337_2449 326
74 3300059424 Ga0590075_007468 Ga0590075_007468_1185_2297 326
75 3300046535 Ga0495586_0011562 Ga0495586_0011562_1241_2263 327
76 3300048918 Ga0496115_0049348 Ga0496115_0049348_1322_2368 327
77 3300048929 Ga0496126_0048954 Ga0496126_0048954_834_1880 327
78 3300032005 Ga0307411_10019008 Ga0307411_100190085 328
79 3300042876 Ga0451577_0011905 Ga0451577_0011905_708_1769 328
80 3300049582 Ga0501048_0146664 Ga0501048_0146664_108_1172 328
81 3300049591 Ga0501075_0121131 Ga0501075_0121131_328_1503 328
82 3300049593 Ga0501077_0027547 Ga0501077_0027547_2372_3547 328
83 3300049741 Ga0501079_0119706 Ga0501079_0119706_428_1603 328
84 3300049742 Ga0501080_0284593 Ga0501080_0284593_397_1461 328
85 3300049743 Ga0501081_0015656 Ga0501081_0015656_1190_2365 328
86 3300049824 Ga0501045_0113638 Ga0501045_0113638_698_1873 328
87 3300054114 Ga0501084_0023363 Ga0501084_0023363_557_1732 328
88 3300060353 Ga0501082_0114591 Ga0501082_0114591_400_1575 328
89 3300005347 Ga0070668_100001641 Ga0070668_1000016415 329
90 3300005543 Ga0070672_100096678 Ga0070672_1000966783 329
91 3300009177 Ga0105248_10115325 Ga0105248_101153253 329
92 3300014325 Ga0163163_10045914 Ga0163163_100459141 329
93 3300031731 Ga0307405_10021807 Ga0307405_100218073 329
94 3300031731 Ga0307405_10107097 Ga0307405_101070971 329
95 3300031852 Ga0307410_10073873 Ga0307410_100738732 329
96 3300031901 Ga0307406_10078716 Ga0307406_100787162 329
97 3300031911 Ga0307412_10065185 Ga0307412_100651852 329
98 3300032005 Ga0307411_10010998 Ga0307411_100109983 329
99 3300032126 Ga0307415_100115954 Ga0307415_1001159541 329
100 3300049571 Ga0501034_0001775 Ga0501034_0001775_15027_16094 329
101 3300049571 Ga0501034_0126063 Ga0501034_0126063_463_1461 329
102 3300049583 Ga0501067_0000266 Ga0501067_0000266_12303_13370 329
103 3300049585 Ga0501069_0000254 Ga0501069_0000254_13653_14720 329
104 3300049586 Ga0501070_0000849 Ga0501070_0000849_16053_17120 329
105 3300049588 Ga0501072_0000338 Ga0501072_0000338_16088_17155 329
106 3300049590 Ga0501074_0000589 Ga0501074_0000589_10617_11684 329
107 3300049686 Ga0501257_034104 Ga0501257_034104_49_1089 329
108 3300049742 Ga0501080_0001482 Ga0501080_0001482_12843_13916 329
109 3300049744 Ga0501083_0000370 Ga0501083_0000370_9433_10500 329
110 3300060353 Ga0501082_0000782 Ga0501082_0000782_10706_11773 329
111 3300005445 Ga0070708_100002791 Ga0070708_1000027915 330
112 3300005467 Ga0070706_100002873 Ga0070706_10000287314 330
113 3300005468 Ga0070707_100013735 Ga0070707_1000137354 330
114 3300005518 Ga0070699_100004839 Ga0070699_1000048397 330
115 3300005536 Ga0070697_100142644 Ga0070697_1001426441 330
116 3300005563 Ga0068855_100092050 Ga0068855_1000920502 330
117 3300005617 Ga0068859_100122796 Ga0068859_1001227963 330
118 3300006931 Ga0097620_100122803 Ga0097620_1001228033 330
119 3300025910 Ga0207684_10009643 Ga0207684_100096432 330
120 3300025912 Ga0207707_10077193 Ga0207707_100771932 330
121 3300025922 Ga0207646_10026722 Ga0207646_100267224 330
122 3300005336 Ga0070680_100004850 Ga0070680_1000048502 331
123 3300005530 Ga0070679_100038328 Ga0070679_1000383283 331
124 3300025912 Ga0207707_10115354 Ga0207707_101153542 331
125 3300025921 Ga0207652_10138283 Ga0207652_101382832 331
126 3300032002 Ga0307416_100001477 Ga0307416_1000014774 331
127 3300032005 Ga0307411_10009060 Ga0307411_100090602 331
128 3300032005 Ga0307411_10053350 Ga0307411_100533502 331
129 3300032126 Ga0307415_100005743 Ga0307415_1000057434 331
130 3300030522 Ga0307512_10157821 Ga0307512_101578212 332
131 3300031242 Ga0265329_10002951 Ga0265329_100029512 332
132 3300031250 Ga0265331_10021155 Ga0265331_100211553 332
133 3300031711 Ga0265314_10030759 Ga0265314_100307592 332
134 3300042436 Ga0439435_0033144 Ga0439435_0033144_67_1089 334
135 3300006847 Ga0075431_100016382 Ga0075431_1000163822 335
136 3300050510 nmdc:mga06r32_21082_c1 nmdc:mga06r32_21082_c1_1942_2961 335
137 3300005340 Ga0070689_100010879 Ga0070689_1000108794 336
138 3300005536 Ga0070697_100035944 Ga0070697_1000359443 336
139 3300006880 Ga0075429_100051741 Ga0075429_1000517413 336
140 3300025936 Ga0207670_10004343 Ga0207670_100043433 336
141 3300031824 Ga0307413_10018306 Ga0307413_100183064 336
142 3300032002 Ga0307416_100064448 Ga0307416_1000644482 336
143 3300044673 Ga0453683_0066955 Ga0453683_0066955_258_1268 336
144 3300050508 nmdc:mga09592_55109_c1 nmdc:mga09592_55109_c1_1850_2863 336
145 3300021384 Ga0213876_10030768 Ga0213876_100307682 337
146 3300021384 Ga0213876_10076050 Ga0213876_100760501 337
147 3300031238 Ga0265332_10000044 Ga0265332_1000004428 337
148 3300031239 Ga0265328_10077161 Ga0265328_100771611 337
149 3300031242 Ga0265329_10005817 Ga0265329_100058172 337
150 3300031249 Ga0265339_10031038 Ga0265339_100310382 337
151 3300031250 Ga0265331_10000076 Ga0265331_1000007693 337
152 3300031344 Ga0265316_10000006 Ga0265316_10000006153 337
153 3300031711 Ga0265314_10000056 Ga0265314_1000005657 337
154 3300039437 Ga0436365_1679983 Ga0436365_1679983_177_1199 337
155 3300053103 Ga0500555_000018 Ga0500555_000018_107855_108874 337
156 3300042876 Ga0451577_0151428 Ga0451577_0151428_729_1748 338
157 3300045051 Ga0451576_0189244 Ga0451576_0189244_457_1476 338
158 3300045051 Ga0451576_0198598 Ga0451576_0198598_575_1627 338
159 3300031548 Ga0307408_100013430 Ga0307408_1000134304 339
160 3300031824 Ga0307413_10176779 Ga0307413_101767792 339
161 3300031852 Ga0307410_10030065 Ga0307410_100300652 339
162 3300031995 Ga0307409_100088093 Ga0307409_1000880932 339
163 3300032002 Ga0307416_100005147 Ga0307416_1000051476 339
164 3300032002 Ga0307416_100139756 Ga0307416_1001397562 339
165 3300009147 Ga0114129_10489974 Ga0114129_104899742 340
166 3300045051 Ga0451576_0048737 Ga0451576_0048737_3348_4373 340
167 3300050507 nmdc:mga05p37_267769_c1 nmdc:mga05p37_267769_c1_313_1368 340
168 3300005354 Ga0070675_100300211 Ga0070675_1003002111 341
169 3300045051 Ga0451576_0001626 Ga0451576_0001626_2730_3764 341
170 3300049741 Ga0501079_0005587 Ga0501079_0005587_7804_8904 341
171 3300049743 Ga0501081_0035492 Ga0501081_0035492_209_1309 341
172 3300013306 Ga0163162_10036455 Ga0163162_100364554 342
173 3300013308 Ga0157375_10367330 Ga0157375_103673302 342
174 3300014968 Ga0157379_10001200 Ga0157379_1000120017 342
175 3300028381 Ga0268264_10080355 Ga0268264_100803552 342
176 3300028800 Ga0265338_10000471 Ga0265338_1000047130 342
177 3300031249 Ga0265339_10004898 Ga0265339_100048986 342
178 3300031711 Ga0265314_10007990 Ga0265314_100079905 342
179 3300035692 Ga0373935_0042043 Ga0373935_0042043_878_1936 342
180 3300037068 Ga0373925_0009615 Ga0373925_0009615_1535_2593 342
181 3300044673 Ga0453683_0002424 Ga0453683_0002424_4257_5333 342
182 3300046472 Ga0495580_0001598 Ga0495580_0001598_15138_16196 342
183 3300005340 Ga0070689_100105842 Ga0070689_1001058421 344
184 3300049656 Ga0501209_001936 Ga0501209_001936_1175_2410 344
185 3300049769 Ga0501272_004417 Ga0501272_004417_153_1214 344
186 3300050511 nmdc:mga08y16_38045_c1 nmdc:mga08y16_38045_c1_819_1943 344
187 3300005330 Ga0070690_100014581 Ga0070690_1000145814 345
188 3300005340 Ga0070689_100026937 Ga0070689_1000269372 345
189 3300005365 Ga0070688_100008589 Ga0070688_1000085895 345
190 3300005440 Ga0070705_100024971 Ga0070705_1000249712 345
191 3300005445 Ga0070708_100048845 Ga0070708_1000488452 345
192 3300005536 Ga0070697_100028520 Ga0070697_1000285204 345
193 3300005546 Ga0070696_100025301 Ga0070696_1000253013 345
194 3300005549 Ga0070704_100139568 Ga0070704_1001395682 345
195 3300005617 Ga0068859_100044071 Ga0068859_1000440714 345
196 3300006844 Ga0075428_100007653 Ga0075428_1000076538 345
197 3300006844 Ga0075428_100072833 Ga0075428_1000728331 345
198 3300006847 Ga0075431_100058624 Ga0075431_1000586242 345
199 3300006852 Ga0075433_10017655 Ga0075433_100176555 345
200 3300006931 Ga0097620_100044072 Ga0097620_1000440724 345
201 3300009094 Ga0111539_10087613 Ga0111539_100876133 345
202 3300009094 Ga0111539_10115140 Ga0111539_101151402 345
203 3300009094 Ga0111539_10299376 Ga0111539_102993762 345
204 3300025936 Ga0207670_10000896 Ga0207670_1000089612 345
205 3300031995 Ga0307409_100006205 Ga0307409_1000062053 345
206 3300032126 Ga0307415_100126061 Ga0307415_1001260611 345
207 3300046454 Ga0495592_0000137 Ga0495592_0000137_16737_17849 345
208 3300046476 Ga0495662_0011848 Ga0495662_0011848_1807_2919 345
209 3300046514 Ga0495618_0016194 Ga0495618_0016194_1048_2160 345
210 3300046516 Ga0495628_0001043 Ga0495628_0001043_4959_6005 345
211 3300046517 Ga0495630_0017838 Ga0495630_0017838_81_1193 345
212 3300046535 Ga0495586_0023292 Ga0495586_0023292_2012_3124 345
213 3300046543 Ga0495645_0084329 Ga0495645_0084329_954_2000 345
214 3300049586 Ga0501070_0076853 Ga0501070_0076853_837_1898 345
215 3300049742 Ga0501080_0067088 Ga0501080_0067088_1052_2113 345
216 3300049742 Ga0501080_0292555 Ga0501080_0292555_335_1396 345
217 3300050510 nmdc:mga06r32_292504_c1 nmdc:mga06r32_292504_c1_337_1395 345
218 3300050511 nmdc:mga08y16_43826_c1 nmdc:mga08y16_43826_c1_588_1646 345
219 3300005544 Ga0070686_100002954 Ga0070686_1000029544 346
220 3300025926 Ga0207659_10141536 Ga0207659_101415362 346
221 3300031824 Ga0307413_10004983 Ga0307413_100049834 346
222 3300031852 Ga0307410_10125851 Ga0307410_101258512 346
223 3300032005 Ga0307411_10012258 Ga0307411_100122583 346
224 3300038443 Ga0395901_0419072 Ga0395901_0419072_113_1165 346
225 3300053153 Ga0500616_0035266 Ga0500616_0035266_1299_2369 346
226 3300005328 Ga0070676_10066770 Ga0070676_100667703 350
227 3300005333 Ga0070677_10003260 Ga0070677_100032603 350
228 3300005336 Ga0070680_100178153 Ga0070680_1001781532 350
229 3300005353 Ga0070669_100009416 Ga0070669_1000094162 350
230 3300005353 Ga0070669_100101317 Ga0070669_1001013172 350
231 3300005356 Ga0070674_100001154 Ga0070674_1000011543 350
232 3300005364 Ga0070673_100171220 Ga0070673_1001712202 350
233 3300005440 Ga0070705_100000614 Ga0070705_10000061411 350
234 3300005444 Ga0070694_100042433 Ga0070694_1000424332 350
235 3300005456 Ga0070678_100046536 Ga0070678_1000465363 350
236 3300005457 Ga0070662_100004666 Ga0070662_1000046669 350
237 3300005459 Ga0068867_100004996 Ga0068867_1000049963 350
238 3300005546 Ga0070696_100008024 Ga0070696_1000080243 350
239 3300005549 Ga0070704_100020577 Ga0070704_1000205773 350
240 3300005563 Ga0068855_100115758 Ga0068855_1001157583 350
241 3300005718 Ga0068866_10000672 Ga0068866_100006721 350
242 3300005719 Ga0068861_100033474 Ga0068861_1000334742 350
243 3300005843 Ga0068860_100023982 Ga0068860_1000239823 350
244 3300006881 Ga0068865_100000264 Ga0068865_10000026414 350
245 3300017792 Ga0163161_10125781 Ga0163161_101257812 350
246 3300025899 Ga0207642_10021677 Ga0207642_100216772 350
247 3300025907 Ga0207645_10000536 Ga0207645_1000053622 350
248 3300025911 Ga0207654_10044785 Ga0207654_100447853 350
249 3300025923 Ga0207681_10157094 Ga0207681_101570942 350
250 3300025933 Ga0207706_10000038 Ga0207706_1000003837 350
251 3300025934 Ga0207686_10000481 Ga0207686_1000048110 350
252 3300025940 Ga0207691_10059350 Ga0207691_100593502 350
253 3300025941 Ga0207711_10029091 Ga0207711_100290911 350
254 3300025942 Ga0207689_10000945 Ga0207689_100009454 350
255 3300025949 Ga0207667_10079740 Ga0207667_100797403 350
256 3300025960 Ga0207651_10335934 Ga0207651_103359341 350
257 3300026035 Ga0207703_10146943 Ga0207703_101469432 350
258 3300026075 Ga0207708_10129285 Ga0207708_101292852 350
259 3300026089 Ga0207648_10000036 Ga0207648_1000003638 350
260 3300026118 Ga0207675_100050955 Ga0207675_1000509552 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04371

PAD_porph

Porphyromonas-type peptidyl-arginine deiminase

13

347

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xkn-assembly1.cif.gz_A crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21 0.9781 7 350
1xkn-assembly1.cif.gz_A crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21 0.9561 7 350
6b2w-assembly2.cif.gz_B c. jejuni c315s agmatine deiminase with substrate bound 0.9475 8 349
6nic-assembly2.cif.gz_D crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.928 7 350
2q3u-assembly2.cif.gz_B ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase 0.9254 2 349
ID Description Score Start End Superfamily
1xknA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9689 7 350 3.75.10.10
1xknA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9412 7 350 3.75.10.10
6b10B00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9241 7 349 3.75.10.10
1zbrB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9181 8 348 3.75.10.10
3hvmA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9175 8 347 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A2V5S129-F1-model_v4 Agmatine deiminase 0.9985 131 248 GO:0004668
GO:0009446
GO:0047632
AF-A0A7Y4UC95-F1-model_v4 Agmatine deiminase family protein 0.9957 10 284 GO:0004668
GO:0009446
GO:0047632
AF-A0A2V9LH28-F1-model_v4 Agmatine deiminase 0.994 178 350 GO:0004668
GO:0009446
GO:0047632
AF-A0A3L7QMP5-F1-model_v4 Agmatine deiminase family protein 0.9934 10 350 GO:0004668
GO:0009446
GO:0047632
AF-A0A7T9GMQ5-F1-model_v4 deleted 0.9923 10 350

Feature Viewer

pLDDT pTM Quality
95.72 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map