F369900
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 173 | 260 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300049656|Ga0501209_001936|Ga0501209_001936_1175_2410 |
| Length | 411 |
| Sequence | MTTIATPSALGYRMPAEWEPHRGTWLSWPHKEASXXXXFGPVPKIFAAMVRHVADHEEVHINVAGSEMEHDVRRLLADEGAGSGNVFFHYHPTNDAWCRDHGPIFVQRETPDQPQAIIDWDFNAWGGKYPPYDLDDVIPTRIAHELGLPVFNPGIVMEGGSIDVNGRGTLLTTEACLLNSNRNPHLNRDGIEEYLRAYLGVSHILWLGEGIEGDDTDGHVDDLTRFVSSDTVVTVVEDDPTDPNYEPLQNNLERLNRMTDQAGQPLRVVSLPMPRTLHHEGQRLPASYANFYIANGVVLLPTYDPSRDSEACATLQSLFPDREVVGIDCTDLVWGLGAFHCVTQQWPADPPCSAATTSARSPRGPPGALRSCRRQFPLYAADPPFCSPRTGQRPSDMPVRWYPPGTPTCRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 88 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 113 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 114 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 151 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 168 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 171 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 172 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 173 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.77 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 94.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10066770 | 3300005328 | Bacteria | 2149 |
| 2 | Ga0070690_100014581 | 3300005330 | Bacteria | 4665 |
| 3 | Ga0070677_10003260 | 3300005333 | Bacteria | 5227 |
| 4 | Ga0070680_100004850 | 3300005336 | Bacteria | 10127 |
| 5 | Ga0070680_100178153 | 3300005336 | Bacteria | 1790 |
| 6 | Ga0070689_100010879 | 3300005340 | Bacteria | 6502 |
| 7 | Ga0070689_100026937 | 3300005340 | Unclassified | 4331 |
| 8 | Ga0070689_100105842 | 3300005340 | Bacteria | 2231 |
| 9 | Ga0070668_100001641 | 3300005347 | Bacteria | 16221 |
| 10 | Ga0070669_100009416 | 3300005353 | Bacteria | 6954 |
| 11 | Ga0070669_100101317 | 3300005353 | Bacteria | 2173 |
| 12 | Ga0070675_100222788 | 3300005354 | Bacteria | 1643 |
| 13 | Ga0070675_100300211 | 3300005354 | Unclassified | 1415 |
| 14 | Ga0070674_100001154 | 3300005356 | Bacteria | 13918 |
| 15 | Ga0070673_100171220 | 3300005364 | Bacteria | 1854 |
| 16 | Ga0070688_100008589 | 3300005365 | Bacteria | 5556 |
| 17 | Ga0070711_100370164 | 3300005439 | Bacteria | 1156 |
| 18 | Ga0070705_100000614 | 3300005440 | Bacteria | 20625 |
| 19 | Ga0070705_100024971 | 3300005440 | Bacteria | 3233 |
| 20 | Ga0070694_100042433 | 3300005444 | Bacteria | 3038 |
| 21 | Ga0070708_100002791 | 3300005445 | Bacteria | 13573 |
| 22 | Ga0070708_100048845 | 3300005445 | Bacteria | 3743 |
| 23 | Ga0070678_100046536 | 3300005456 | Bacteria | 3111 |
| 24 | Ga0070662_100004666 | 3300005457 | Bacteria | 8691 |
| 25 | Ga0068867_100004996 | 3300005459 | Bacteria | 9349 |
| 26 | Ga0070706_100002873 | 3300005467 | Bacteria | 17160 |
| 27 | Ga0070707_100013735 | 3300005468 | Bacteria | 7583 |
| 28 | Ga0070699_100004839 | 3300005518 | Bacteria | 11879 |
| 29 | Ga0070679_100038328 | 3300005530 | Bacteria | 4764 |
| 30 | Ga0070697_100028520 | 3300005536 | Bacteria | 4470 |
| 31 | Ga0070697_100035944 | 3300005536 | Bacteria | 3999 |
| 32 | Ga0070697_100142644 | 3300005536 | Bacteria | 2015 |
| 33 | Ga0070672_100096678 | 3300005543 | Bacteria | 2390 |
| 34 | Ga0070686_100002954 | 3300005544 | Bacteria | 9327 |
| 35 | Ga0070696_100008024 | 3300005546 | Bacteria | 7053 |
| 36 | Ga0070696_100025301 | 3300005546 | Bacteria | 4034 |
| 37 | Ga0070665_100027066 | 3300005548 | Bacteria | 5775 |
| 38 | Ga0070704_100020577 | 3300005549 | Bacteria | 4257 |
| 39 | Ga0070704_100139568 | 3300005549 | Bacteria | 1890 |
| 40 | Ga0068855_100092050 | 3300005563 | Bacteria | 3497 |
| 41 | Ga0068855_100115758 | 3300005563 | Bacteria | 3073 |
| 42 | Ga0068859_100044071 | 3300005617 | Unclassified | 4484 |
| 43 | Ga0068859_100122796 | 3300005617 | Bacteria | 2664 |
| 44 | Ga0068866_10000672 | 3300005718 | Bacteria | 15505 |
| 45 | Ga0068861_100033474 | 3300005719 | Bacteria | 3791 |
| 46 | Ga0068860_100023982 | 3300005843 | Bacteria | 5897 |
| 47 | Ga0075428_100007653 | 3300006844 | Bacteria | 11975 |
| 48 | Ga0075428_100072833 | 3300006844 | Bacteria | 3752 |
| 49 | Ga0075431_100016382 | 3300006847 | Bacteria | 7521 |
| 50 | Ga0075431_100058624 | 3300006847 | Bacteria | 3974 |
| 51 | Ga0075431_100119848 | 3300006847 | Bacteria | 2715 |
| 52 | Ga0075433_10017655 | 3300006852 | Bacteria | 5918 |
| 53 | Ga0075434_100001798 | 3300006871 | Bacteria | 18527 |
| 54 | Ga0075429_100051741 | 3300006880 | Unclassified | 3573 |
| 55 | Ga0068865_100000264 | 3300006881 | Bacteria | 28723 |
| 56 | Ga0097620_100044072 | 3300006931 | Unclassified | 4484 |
| 57 | Ga0097620_100122803 | 3300006931 | Bacteria | 2664 |
| 58 | Ga0105240_10140122 | 3300009093 | Bacteria | 2892 |
| 59 | Ga0111539_10087613 | 3300009094 | Unclassified | 3657 |
| 60 | Ga0111539_10094701 | 3300009094 | Bacteria | 3509 |
| 61 | Ga0111539_10115140 | 3300009094 | Bacteria | 3153 |
| 62 | Ga0111539_10299376 | 3300009094 | Bacteria | 1872 |
| 63 | Ga0105245_10163521 | 3300009098 | Bacteria | 2113 |
| 64 | Ga0114129_10000471 | 3300009147 | Bacteria | 48410 |
| 65 | Ga0114129_10199460 | 3300009147 | Bacteria | 2711 |
| 66 | Ga0114129_10489974 | 3300009147 | Bacteria | 1607 |
| 67 | Ga0105243_10002943 | 3300009148 | Bacteria | 14082 |
| 68 | Ga0105241_10008224 | 3300009174 | Bacteria | 7681 |
| 69 | Ga0105242_10041886 | 3300009176 | Bacteria | 3695 |
| 70 | Ga0105248_10115325 | 3300009177 | Bacteria | 3030 |
| 71 | Ga0105248_10185760 | 3300009177 | Bacteria | 2342 |
| 72 | Ga0105249_10103863 | 3300009553 | Bacteria | 2677 |
| 73 | Ga0105239_10059237 | 3300010375 | Bacteria | 4203 |
| 74 | Ga0105239_10597799 | 3300010375 | Bacteria | 1258 |
| 75 | Ga0157371_10054408 | 3300013102 | Bacteria | 2843 |
| 76 | Ga0157378_10005877 | 3300013297 | Bacteria | 10749 |
| 77 | Ga0163162_10036455 | 3300013306 | Bacteria | 4902 |
| 78 | Ga0163162_10222507 | 3300013306 | Bacteria | 2017 |
| 79 | Ga0157375_10367330 | 3300013308 | Bacteria | 1605 |
| 80 | Ga0163163_10045914 | 3300014325 | Bacteria | 4289 |
| 81 | Ga0157380_10086738 | 3300014326 | Bacteria | 2573 |
| 82 | Ga0157379_10001200 | 3300014968 | Bacteria | 21089 |
| 83 | Ga0157379_10059983 | 3300014968 | Bacteria | 3401 |
| 84 | Ga0163161_10125781 | 3300017792 | Bacteria | 1930 |
| 85 | Ga0213876_10030768 | 3300021384 | Bacteria | 2832 |
| 86 | Ga0213876_10076050 | 3300021384 | Bacteria | 1773 |
| 87 | Ga0207642_10021677 | 3300025899 | Bacteria | 2534 |
| 88 | Ga0207645_10000536 | 3300025907 | Bacteria | 31571 |
| 89 | Ga0207684_10009643 | 3300025910 | Bacteria | 8515 |
| 90 | Ga0207654_10044785 | 3300025911 | Bacteria | 2515 |
| 91 | Ga0207707_10077193 | 3300025912 | Bacteria | 2907 |
| 92 | Ga0207707_10115354 | 3300025912 | Bacteria | 2347 |
| 93 | Ga0207652_10138283 | 3300025921 | Bacteria | 2176 |
| 94 | Ga0207646_10026722 | 3300025922 | Bacteria | 5265 |
| 95 | Ga0207681_10157094 | 3300025923 | Bacteria | 1710 |
| 96 | Ga0207659_10141536 | 3300025926 | Bacteria | 1868 |
| 97 | Ga0207706_10000038 | 3300025933 | Bacteria | 132725 |
| 98 | Ga0207686_10000481 | 3300025934 | Bacteria | 26333 |
| 99 | Ga0207670_10000896 | 3300025936 | Bacteria | 15698 |
| 100 | Ga0207670_10004343 | 3300025936 | Bacteria | 7619 |
| 101 | Ga0207691_10059350 | 3300025940 | Bacteria | 3479 |
| 102 | Ga0207711_10029091 | 3300025941 | Bacteria | 4657 |
| 103 | Ga0207689_10000945 | 3300025942 | Bacteria | 27917 |
| 104 | Ga0207679_10025186 | 3300025945 | Bacteria | 4089 |
| 105 | Ga0207667_10079740 | 3300025949 | Bacteria | 3393 |
| 106 | Ga0207651_10335934 | 3300025960 | Bacteria | 1268 |
| 107 | Ga0207703_10146943 | 3300026035 | Bacteria | 2051 |
| 108 | Ga0207708_10129285 | 3300026075 | Bacteria | 1974 |
| 109 | Ga0207641_10092779 | 3300026088 | Bacteria | 2645 |
| 110 | Ga0207648_10000036 | 3300026089 | Bacteria | 122209 |
| 111 | Ga0207676_10009545 | 3300026095 | Bacteria | 6908 |
| 112 | Ga0207675_100050955 | 3300026118 | Bacteria | 3863 |
| 113 | Ga0268266_10000353 | 3300028379 | Bacteria | 70990 |
| 114 | Ga0268264_10080355 | 3300028381 | Bacteria | 2784 |
| 115 | Ga0265338_10000471 | 3300028800 | Bacteria | 71881 |
| 116 | Ga0265338_10014520 | 3300028800 | Bacteria | 8754 |
| 117 | Ga0307512_10157821 | 3300030522 | Bacteria | 1338 |
| 118 | Ga0265332_10000044 | 3300031238 | Bacteria | 114444 |
| 119 | Ga0265328_10077161 | 3300031239 | Bacteria | 1226 |
| 120 | Ga0265325_10000151 | 3300031241 | Bacteria | 49073 |
| 121 | Ga0265329_10002951 | 3300031242 | Bacteria | 7569 |
| 122 | Ga0265329_10005817 | 3300031242 | Bacteria | 4949 |
| 123 | Ga0265339_10000181 | 3300031249 | Bacteria | 53469 |
| 124 | Ga0265339_10004898 | 3300031249 | Bacteria | 9030 |
| 125 | Ga0265339_10031038 | 3300031249 | Bacteria | 3022 |
| 126 | Ga0265331_10000076 | 3300031250 | Bacteria | 145884 |
| 127 | Ga0265331_10000166 | 3300031250 | Bacteria | 81796 |
| 128 | Ga0265331_10021155 | 3300031250 | Bacteria | 3332 |
| 129 | Ga0265316_10000006 | 3300031344 | Bacteria | 289686 |
| 130 | Ga0307408_100013430 | 3300031548 | Bacteria | 5435 |
| 131 | Ga0265313_10000750 | 3300031595 | Bacteria | 33181 |
| 132 | Ga0265314_10000056 | 3300031711 | Bacteria | 171647 |
| 133 | Ga0265314_10000290 | 3300031711 | Bacteria | 72189 |
| 134 | Ga0265314_10007990 | 3300031711 | Bacteria | 9123 |
| 135 | Ga0265314_10030759 | 3300031711 | Bacteria | 3971 |
| 136 | Ga0265342_10040771 | 3300031712 | Bacteria | 2814 |
| 137 | Ga0307405_10021807 | 3300031731 | Bacteria | 3608 |
| 138 | Ga0307405_10107097 | 3300031731 | Bacteria | 1886 |
| 139 | Ga0307413_10004983 | 3300031824 | Bacteria | 5858 |
| 140 | Ga0307413_10018306 | 3300031824 | Unclassified | 3672 |
| 141 | Ga0307413_10176779 | 3300031824 | Bacteria | 1517 |
| 142 | Ga0307410_10030065 | 3300031852 | Bacteria | 3467 |
| 143 | Ga0307410_10073873 | 3300031852 | Bacteria | 2372 |
| 144 | Ga0307410_10125851 | 3300031852 | Bacteria | 1876 |
| 145 | Ga0307406_10078716 | 3300031901 | Bacteria | 2184 |
| 146 | Ga0307412_10065185 | 3300031911 | Bacteria | 2464 |
| 147 | Ga0307409_100006205 | 3300031995 | Bacteria | 6994 |
| 148 | Ga0307409_100088093 | 3300031995 | Bacteria | 2533 |
| 149 | Ga0307409_100218179 | 3300031995 | Bacteria | 1720 |
| 150 | Ga0307416_100001477 | 3300032002 | Bacteria | 12800 |
| 151 | Ga0307416_100005147 | 3300032002 | Bacteria | 7988 |
| 152 | Ga0307416_100064448 | 3300032002 | Bacteria | 3006 |
| 153 | Ga0307416_100139756 | 3300032002 | Bacteria | 2199 |
| 154 | Ga0307411_10009060 | 3300032005 | Bacteria | 5207 |
| 155 | Ga0307411_10010998 | 3300032005 | Bacteria | 4857 |
| 156 | Ga0307411_10012258 | 3300032005 | Bacteria | 4668 |
| 157 | Ga0307411_10019008 | 3300032005 | Bacteria | 3958 |
| 158 | Ga0307411_10020253 | 3300032005 | Bacteria | 3864 |
| 159 | Ga0307411_10053350 | 3300032005 | Bacteria | 2648 |
| 160 | Ga0307411_10091965 | 3300032005 | Bacteria | 2121 |
| 161 | Ga0307415_100005743 | 3300032126 | Bacteria | 6617 |
| 162 | Ga0307415_100115954 | 3300032126 | Bacteria | 1997 |
| 163 | Ga0307415_100126061 | 3300032126 | Bacteria | 1930 |
| 164 | Ga0373935_0042043 | 3300035692 | Bacteria | 2873 |
| 165 | Ga0373925_0009615 | 3300037068 | Bacteria | 7046 |
| 166 | Ga0395901_0419072 | 3300038443 | Bacteria | 1373 |
| 167 | Ga0436365_1679983 | 3300039437 | Bacteria | 1743 |
| 168 | Ga0439435_0033144 | 3300042436 | Bacteria | 1413 |
| 169 | Ga0451577_0011905 | 3300042876 | Bacteria | 8203 |
| 170 | Ga0451577_0151428 | 3300042876 | Bacteria | 2087 |
| 171 | Ga0453683_0002424 | 3300044673 | Bacteria | 14497 |
| 172 | Ga0453683_0066955 | 3300044673 | Bacteria | 2245 |
| 173 | Ga0451576_0001626 | 3300045051 | Bacteria | 37654 |
| 174 | Ga0451576_0048737 | 3300045051 | Bacteria | 4448 |
| 175 | Ga0451576_0189244 | 3300045051 | Bacteria | 2149 |
| 176 | Ga0451576_0198598 | 3300045051 | Bacteria | 2095 |
| 177 | Ga0495592_0000137 | 3300046454 | Bacteria | 64327 |
| 178 | Ga0495603_0030029 | 3300046455 | Bacteria | 3275 |
| 179 | Ga0495580_0001598 | 3300046472 | Bacteria | 19894 |
| 180 | Ga0495662_0011848 | 3300046476 | Unclassified | 4261 |
| 181 | Ga0495618_0016194 | 3300046514 | Unclassified | 4557 |
| 182 | Ga0495628_0001043 | 3300046516 | Bacteria | 25365 |
| 183 | Ga0495630_0017838 | 3300046517 | Bacteria | 5206 |
| 184 | Ga0495586_0011562 | 3300046535 | Bacteria | 4695 |
| 185 | Ga0495586_0023292 | 3300046535 | Unclassified | 3306 |
| 186 | Ga0495645_0084329 | 3300046543 | Bacteria | 2275 |
| 187 | Ga0495674_0015641 | 3300047319 | Bacteria | 7084 |
| 188 | Ga0495680_0133695 | 3300047322 | Unclassified | 1820 |
| 189 | Ga0496104_0007861 | 3300048907 | Bacteria | 9454 |
| 190 | Ga0496108_0000224 | 3300048911 | Bacteria | 50600 |
| 191 | Ga0496110_0079093 | 3300048913 | Bacteria | 2927 |
| 192 | Ga0496112_0000156 | 3300048915 | Bacteria | 42945 |
| 193 | Ga0496112_0225831 | 3300048915 | Bacteria | 1828 |
| 194 | Ga0496113_0000224 | 3300048916 | Bacteria | 26509 |
| 195 | Ga0496114_0016464 | 3300048917 | Bacteria | 5959 |
| 196 | Ga0496115_0049348 | 3300048918 | Bacteria | 3369 |
| 197 | Ga0496126_0048954 | 3300048929 | Bacteria | 3860 |
| 198 | Ga0501034_0001775 | 3300049571 | Bacteria | 27580 |
| 199 | Ga0501034_0126063 | 3300049571 | Bacteria | 2546 |
| 200 | Ga0501034_0228942 | 3300049571 | Bacteria | 1808 |
| 201 | Ga0501039_0305770 | 3300049575 | Bacteria | 1250 |
| 202 | Ga0501043_0072459 | 3300049579 | Bacteria | 2706 |
| 203 | Ga0501046_0015377 | 3300049580 | Bacteria | 6433 |
| 204 | Ga0501046_0018055 | 3300049580 | Bacteria | 5877 |
| 205 | Ga0501047_0077832 | 3300049581 | Bacteria | 3189 |
| 206 | Ga0501047_0442524 | 3300049581 | Bacteria | 1129 |
| 207 | Ga0501048_0146664 | 3300049582 | Bacteria | 1669 |
| 208 | Ga0501067_0000266 | 3300049583 | Bacteria | 28520 |
| 209 | Ga0501069_0000254 | 3300049585 | Bacteria | 24126 |
| 210 | Ga0501070_0000849 | 3300049586 | Bacteria | 27734 |
| 211 | Ga0501070_0001664 | 3300049586 | Bacteria | 19688 |
| 212 | Ga0501070_0076853 | 3300049586 | Bacteria | 2764 |
| 213 | Ga0501071_0197287 | 3300049587 | Bacteria | 1511 |
| 214 | Ga0501072_0000338 | 3300049588 | Bacteria | 33400 |
| 215 | Ga0501074_0000589 | 3300049590 | Bacteria | 22567 |
| 216 | Ga0501075_0121131 | 3300049591 | Bacteria | 1991 |
| 217 | Ga0501076_0430319 | 3300049592 | Bacteria | 1086 |
| 218 | Ga0501077_0018620 | 3300049593 | Bacteria | 4391 |
| 219 | Ga0501077_0027547 | 3300049593 | Bacteria | 3608 |
| 220 | Ga0501209_001936 | 3300049656 | Bacteria | 3064 |
| 221 | Ga0501257_034104 | 3300049686 | Bacteria | 1235 |
| 222 | Ga0501079_0005587 | 3300049741 | Bacteria | 9385 |
| 223 | Ga0501079_0119706 | 3300049741 | Bacteria | 2047 |
| 224 | Ga0501080_0001482 | 3300049742 | Bacteria | 19788 |
| 225 | Ga0501080_0067088 | 3300049742 | Bacteria | 3337 |
| 226 | Ga0501080_0284593 | 3300049742 | Bacteria | 1502 |
| 227 | Ga0501080_0292555 | 3300049742 | Bacteria | 1479 |
| 228 | Ga0501081_0015656 | 3300049743 | Bacteria | 5005 |
| 229 | Ga0501081_0035492 | 3300049743 | Bacteria | 3394 |
| 230 | Ga0501081_0102652 | 3300049743 | Bacteria | 2023 |
| 231 | Ga0501083_0000370 | 3300049744 | Bacteria | 28443 |
| 232 | Ga0501272_004417 | 3300049769 | Bacteria | 1461 |
| 233 | Ga0501044_0027130 | 3300049823 | Bacteria | 6058 |
| 234 | Ga0501045_0113638 | 3300049824 | Bacteria | 2008 |
| 235 | nmdc:mga05p37_267769_c1 | 3300050507 | Bacteria | 2042 |
| 236 | nmdc:mga05p37_7556_c1 | 3300050507 | Bacteria | 12818 |
| 237 | nmdc:mga09592_55109_c1 | 3300050508 | Unclassified | 3360 |
| 238 | nmdc:mga09592_59073_c1 | 3300050508 | Bacteria | 3242 |
| 239 | nmdc:mga0qj67_31390_c1 | 3300050509 | Bacteria | 4138 |
| 240 | nmdc:mga06r32_112098_c1 | 3300050510 | Bacteria | 2684 |
| 241 | nmdc:mga06r32_12300_c1 | 3300050510 | Bacteria | 7718 |
| 242 | nmdc:mga06r32_21082_c1 | 3300050510 | Bacteria | 6012 |
| 243 | nmdc:mga06r32_292504_c1 | 3300050510 | Bacteria | 1615 |
| 244 | nmdc:mga08y16_38045_c1 | 3300050511 | Bacteria | 5051 |
| 245 | nmdc:mga08y16_43826_c1 | 3300050511 | Bacteria | 4688 |
| 246 | nmdc:mga0n895_19669_c1 | 3300050512 | Bacteria | 6278 |
| 247 | nmdc:mga0rr50_200899_c1 | 3300050513 | Bacteria | 1638 |
| 248 | Ga0495619_0219921 | 3300053085 | Bacteria | 1316 |
| 249 | Ga0500555_000018 | 3300053103 | Bacteria | 183559 |
| 250 | Ga0500616_0035266 | 3300053153 | Bacteria | 2721 |
| 251 | Ga0501084_0023363 | 3300054114 | Bacteria | 5161 |
| 252 | Ga0501084_0023550 | 3300054114 | Bacteria | 5136 |
| 253 | Ga0501084_0116242 | 3300054114 | Bacteria | 2249 |
| 254 | Ga0590071_001110 | 3300059421 | Bacteria | 7286 |
| 255 | Ga0590071_007573 | 3300059421 | Bacteria | 2570 |
| 256 | Ga0590075_007468 | 3300059424 | Bacteria | 2598 |
| 257 | Ga0590077_007123 | 3300059426 | Bacteria | 2291 |
| 258 | Ga0501082_0000782 | 3300060353 | Bacteria | 27952 |
| 259 | Ga0501082_0114591 | 3300060353 | Bacteria | 2334 |
| 260 | Ga0501082_0121504 | 3300060353 | Bacteria | 2264 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0030029 | Ga0495603_0030029_728_1678 | 301 |
| 2 | 3300047319 | Ga0495674_0015641 | Ga0495674_0015641_84_1001 | 302 |
| 3 | 3300048915 | Ga0496112_0225831 | Ga0496112_0225831_602_1558 | 302 |
| 4 | 3300050508 | nmdc:mga09592_59073_c1 | nmdc:mga09592_59073_c1_2313_3224 | 302 |
| 5 | 3300050509 | nmdc:mga0qj67_31390_c1 | nmdc:mga0qj67_31390_c1_2005_2973 | 302 |
| 6 | 3300050510 | nmdc:mga06r32_12300_c1 | nmdc:mga06r32_12300_c1_6106_7074 | 302 |
| 7 | 3300059426 | Ga0590077_007123 | Ga0590077_007123_866_1783 | 302 |
| 8 | 3300010375 | Ga0105239_10597799 | Ga0105239_105977991 | 305 |
| 9 | 3300009094 | Ga0111539_10094701 | Ga0111539_100947011 | 308 |
| 10 | 3300031250 | Ga0265331_10000166 | Ga0265331_1000016629 | 311 |
| 11 | 3300031595 | Ga0265313_10000750 | Ga0265313_1000075027 | 311 |
| 12 | 3300031711 | Ga0265314_10000290 | Ga0265314_1000029029 | 311 |
| 13 | 3300005548 | Ga0070665_100027066 | Ga0070665_1000270665 | 312 |
| 14 | 3300028379 | Ga0268266_10000353 | Ga0268266_1000035364 | 312 |
| 15 | 3300006847 | Ga0075431_100119848 | Ga0075431_1001198483 | 313 |
| 16 | 3300006871 | Ga0075434_100001798 | Ga0075434_10000179814 | 313 |
| 17 | 3300009093 | Ga0105240_10140122 | Ga0105240_101401222 | 313 |
| 18 | 3300009098 | Ga0105245_10163521 | Ga0105245_101635213 | 313 |
| 19 | 3300009148 | Ga0105243_10002943 | Ga0105243_100029432 | 313 |
| 20 | 3300009174 | Ga0105241_10008224 | Ga0105241_100082246 | 313 |
| 21 | 3300009176 | Ga0105242_10041886 | Ga0105242_100418862 | 313 |
| 22 | 3300009177 | Ga0105248_10185760 | Ga0105248_101857602 | 313 |
| 23 | 3300009553 | Ga0105249_10103863 | Ga0105249_101038632 | 313 |
| 24 | 3300010375 | Ga0105239_10059237 | Ga0105239_100592373 | 313 |
| 25 | 3300013102 | Ga0157371_10054408 | Ga0157371_100544082 | 313 |
| 26 | 3300013297 | Ga0157378_10005877 | Ga0157378_100058775 | 313 |
| 27 | 3300013306 | Ga0163162_10222507 | Ga0163162_102225072 | 313 |
| 28 | 3300014326 | Ga0157380_10086738 | Ga0157380_100867383 | 313 |
| 29 | 3300014968 | Ga0157379_10059983 | Ga0157379_100599833 | 313 |
| 30 | 3300048917 | Ga0496114_0016464 | Ga0496114_0016464_4554_5495 | 313 |
| 31 | 3300053085 | Ga0495619_0219921 | Ga0495619_0219921_45_1040 | 313 |
| 32 | 3300049592 | Ga0501076_0430319 | Ga0501076_0430319_34_1050 | 318 |
| 33 | 3300009147 | Ga0114129_10000471 | Ga0114129_1000047130 | 320 |
| 34 | 3300028800 | Ga0265338_10014520 | Ga0265338_100145207 | 320 |
| 35 | 3300031241 | Ga0265325_10000151 | Ga0265325_1000015130 | 320 |
| 36 | 3300031249 | Ga0265339_10000181 | Ga0265339_1000018122 | 320 |
| 37 | 3300031712 | Ga0265342_10040771 | Ga0265342_100407713 | 320 |
| 38 | 3300032005 | Ga0307411_10091965 | Ga0307411_100919651 | 320 |
| 39 | 3300054114 | Ga0501084_0116242 | Ga0501084_0116242_355_1380 | 320 |
| 40 | 3300005439 | Ga0070711_100370164 | Ga0070711_1003701641 | 321 |
| 41 | 3300026088 | Ga0207641_10092779 | Ga0207641_100927793 | 321 |
| 42 | 3300026095 | Ga0207676_10009545 | Ga0207676_100095452 | 321 |
| 43 | 3300048907 | Ga0496104_0007861 | Ga0496104_0007861_4046_5056 | 321 |
| 44 | 3300048911 | Ga0496108_0000224 | Ga0496108_0000224_34163_35173 | 321 |
| 45 | 3300048913 | Ga0496110_0079093 | Ga0496110_0079093_442_1452 | 321 |
| 46 | 3300048915 | Ga0496112_0000156 | Ga0496112_0000156_14071_15081 | 321 |
| 47 | 3300048916 | Ga0496113_0000224 | Ga0496113_0000224_11414_12424 | 321 |
| 48 | 3300050507 | nmdc:mga05p37_7556_c1 | nmdc:mga05p37_7556_c1_5490_6545 | 321 |
| 49 | 3300050510 | nmdc:mga06r32_112098_c1 | nmdc:mga06r32_112098_c1_228_1283 | 321 |
| 50 | 3300050512 | nmdc:mga0n895_19669_c1 | nmdc:mga0n895_19669_c1_2779_3834 | 321 |
| 51 | 3300050513 | nmdc:mga0rr50_200899_c1 | nmdc:mga0rr50_200899_c1_415_1425 | 321 |
| 52 | 3300060353 | Ga0501082_0121504 | Ga0501082_0121504_1184_2197 | 321 |
| 53 | 3300032005 | Ga0307411_10020253 | Ga0307411_100202532 | 322 |
| 54 | 3300049571 | Ga0501034_0228942 | Ga0501034_0228942_547_1563 | 322 |
| 55 | 3300049580 | Ga0501046_0018055 | Ga0501046_0018055_4250_5266 | 322 |
| 56 | 3300049581 | Ga0501047_0442524 | Ga0501047_0442524_74_1090 | 322 |
| 57 | 3300049823 | Ga0501044_0027130 | Ga0501044_0027130_1574_2590 | 322 |
| 58 | 3300049575 | Ga0501039_0305770 | Ga0501039_0305770_205_1221 | 323 |
| 59 | 3300049587 | Ga0501071_0197287 | Ga0501071_0197287_481_1497 | 323 |
| 60 | 3300049593 | Ga0501077_0018620 | Ga0501077_0018620_173_1189 | 323 |
| 61 | 3300049743 | Ga0501081_0102652 | Ga0501081_0102652_816_1832 | 323 |
| 62 | 3300054114 | Ga0501084_0023550 | Ga0501084_0023550_3177_4193 | 323 |
| 63 | 3300005354 | Ga0070675_100222788 | Ga0070675_1002227882 | 324 |
| 64 | 3300009147 | Ga0114129_10199460 | Ga0114129_101994602 | 324 |
| 65 | 3300047322 | Ga0495680_0133695 | Ga0495680_0133695_571_1593 | 325 |
| 66 | 3300049579 | Ga0501043_0072459 | Ga0501043_0072459_1424_2452 | 325 |
| 67 | 3300049580 | Ga0501046_0015377 | Ga0501046_0015377_4454_5482 | 325 |
| 68 | 3300049581 | Ga0501047_0077832 | Ga0501047_0077832_1100_2128 | 325 |
| 69 | 3300049586 | Ga0501070_0001664 | Ga0501070_0001664_18447_19475 | 325 |
| 70 | 3300059421 | Ga0590071_007573 | Ga0590071_007573_60_1130 | 325 |
| 71 | 3300025945 | Ga0207679_10025186 | Ga0207679_100251863 | 326 |
| 72 | 3300031995 | Ga0307409_100218179 | Ga0307409_1002181792 | 326 |
| 73 | 3300059421 | Ga0590071_001110 | Ga0590071_001110_1337_2449 | 326 |
| 74 | 3300059424 | Ga0590075_007468 | Ga0590075_007468_1185_2297 | 326 |
| 75 | 3300046535 | Ga0495586_0011562 | Ga0495586_0011562_1241_2263 | 327 |
| 76 | 3300048918 | Ga0496115_0049348 | Ga0496115_0049348_1322_2368 | 327 |
| 77 | 3300048929 | Ga0496126_0048954 | Ga0496126_0048954_834_1880 | 327 |
| 78 | 3300032005 | Ga0307411_10019008 | Ga0307411_100190085 | 328 |
| 79 | 3300042876 | Ga0451577_0011905 | Ga0451577_0011905_708_1769 | 328 |
| 80 | 3300049582 | Ga0501048_0146664 | Ga0501048_0146664_108_1172 | 328 |
| 81 | 3300049591 | Ga0501075_0121131 | Ga0501075_0121131_328_1503 | 328 |
| 82 | 3300049593 | Ga0501077_0027547 | Ga0501077_0027547_2372_3547 | 328 |
| 83 | 3300049741 | Ga0501079_0119706 | Ga0501079_0119706_428_1603 | 328 |
| 84 | 3300049742 | Ga0501080_0284593 | Ga0501080_0284593_397_1461 | 328 |
| 85 | 3300049743 | Ga0501081_0015656 | Ga0501081_0015656_1190_2365 | 328 |
| 86 | 3300049824 | Ga0501045_0113638 | Ga0501045_0113638_698_1873 | 328 |
| 87 | 3300054114 | Ga0501084_0023363 | Ga0501084_0023363_557_1732 | 328 |
| 88 | 3300060353 | Ga0501082_0114591 | Ga0501082_0114591_400_1575 | 328 |
| 89 | 3300005347 | Ga0070668_100001641 | Ga0070668_1000016415 | 329 |
| 90 | 3300005543 | Ga0070672_100096678 | Ga0070672_1000966783 | 329 |
| 91 | 3300009177 | Ga0105248_10115325 | Ga0105248_101153253 | 329 |
| 92 | 3300014325 | Ga0163163_10045914 | Ga0163163_100459141 | 329 |
| 93 | 3300031731 | Ga0307405_10021807 | Ga0307405_100218073 | 329 |
| 94 | 3300031731 | Ga0307405_10107097 | Ga0307405_101070971 | 329 |
| 95 | 3300031852 | Ga0307410_10073873 | Ga0307410_100738732 | 329 |
| 96 | 3300031901 | Ga0307406_10078716 | Ga0307406_100787162 | 329 |
| 97 | 3300031911 | Ga0307412_10065185 | Ga0307412_100651852 | 329 |
| 98 | 3300032005 | Ga0307411_10010998 | Ga0307411_100109983 | 329 |
| 99 | 3300032126 | Ga0307415_100115954 | Ga0307415_1001159541 | 329 |
| 100 | 3300049571 | Ga0501034_0001775 | Ga0501034_0001775_15027_16094 | 329 |
| 101 | 3300049571 | Ga0501034_0126063 | Ga0501034_0126063_463_1461 | 329 |
| 102 | 3300049583 | Ga0501067_0000266 | Ga0501067_0000266_12303_13370 | 329 |
| 103 | 3300049585 | Ga0501069_0000254 | Ga0501069_0000254_13653_14720 | 329 |
| 104 | 3300049586 | Ga0501070_0000849 | Ga0501070_0000849_16053_17120 | 329 |
| 105 | 3300049588 | Ga0501072_0000338 | Ga0501072_0000338_16088_17155 | 329 |
| 106 | 3300049590 | Ga0501074_0000589 | Ga0501074_0000589_10617_11684 | 329 |
| 107 | 3300049686 | Ga0501257_034104 | Ga0501257_034104_49_1089 | 329 |
| 108 | 3300049742 | Ga0501080_0001482 | Ga0501080_0001482_12843_13916 | 329 |
| 109 | 3300049744 | Ga0501083_0000370 | Ga0501083_0000370_9433_10500 | 329 |
| 110 | 3300060353 | Ga0501082_0000782 | Ga0501082_0000782_10706_11773 | 329 |
| 111 | 3300005445 | Ga0070708_100002791 | Ga0070708_1000027915 | 330 |
| 112 | 3300005467 | Ga0070706_100002873 | Ga0070706_10000287314 | 330 |
| 113 | 3300005468 | Ga0070707_100013735 | Ga0070707_1000137354 | 330 |
| 114 | 3300005518 | Ga0070699_100004839 | Ga0070699_1000048397 | 330 |
| 115 | 3300005536 | Ga0070697_100142644 | Ga0070697_1001426441 | 330 |
| 116 | 3300005563 | Ga0068855_100092050 | Ga0068855_1000920502 | 330 |
| 117 | 3300005617 | Ga0068859_100122796 | Ga0068859_1001227963 | 330 |
| 118 | 3300006931 | Ga0097620_100122803 | Ga0097620_1001228033 | 330 |
| 119 | 3300025910 | Ga0207684_10009643 | Ga0207684_100096432 | 330 |
| 120 | 3300025912 | Ga0207707_10077193 | Ga0207707_100771932 | 330 |
| 121 | 3300025922 | Ga0207646_10026722 | Ga0207646_100267224 | 330 |
| 122 | 3300005336 | Ga0070680_100004850 | Ga0070680_1000048502 | 331 |
| 123 | 3300005530 | Ga0070679_100038328 | Ga0070679_1000383283 | 331 |
| 124 | 3300025912 | Ga0207707_10115354 | Ga0207707_101153542 | 331 |
| 125 | 3300025921 | Ga0207652_10138283 | Ga0207652_101382832 | 331 |
| 126 | 3300032002 | Ga0307416_100001477 | Ga0307416_1000014774 | 331 |
| 127 | 3300032005 | Ga0307411_10009060 | Ga0307411_100090602 | 331 |
| 128 | 3300032005 | Ga0307411_10053350 | Ga0307411_100533502 | 331 |
| 129 | 3300032126 | Ga0307415_100005743 | Ga0307415_1000057434 | 331 |
| 130 | 3300030522 | Ga0307512_10157821 | Ga0307512_101578212 | 332 |
| 131 | 3300031242 | Ga0265329_10002951 | Ga0265329_100029512 | 332 |
| 132 | 3300031250 | Ga0265331_10021155 | Ga0265331_100211553 | 332 |
| 133 | 3300031711 | Ga0265314_10030759 | Ga0265314_100307592 | 332 |
| 134 | 3300042436 | Ga0439435_0033144 | Ga0439435_0033144_67_1089 | 334 |
| 135 | 3300006847 | Ga0075431_100016382 | Ga0075431_1000163822 | 335 |
| 136 | 3300050510 | nmdc:mga06r32_21082_c1 | nmdc:mga06r32_21082_c1_1942_2961 | 335 |
| 137 | 3300005340 | Ga0070689_100010879 | Ga0070689_1000108794 | 336 |
| 138 | 3300005536 | Ga0070697_100035944 | Ga0070697_1000359443 | 336 |
| 139 | 3300006880 | Ga0075429_100051741 | Ga0075429_1000517413 | 336 |
| 140 | 3300025936 | Ga0207670_10004343 | Ga0207670_100043433 | 336 |
| 141 | 3300031824 | Ga0307413_10018306 | Ga0307413_100183064 | 336 |
| 142 | 3300032002 | Ga0307416_100064448 | Ga0307416_1000644482 | 336 |
| 143 | 3300044673 | Ga0453683_0066955 | Ga0453683_0066955_258_1268 | 336 |
| 144 | 3300050508 | nmdc:mga09592_55109_c1 | nmdc:mga09592_55109_c1_1850_2863 | 336 |
| 145 | 3300021384 | Ga0213876_10030768 | Ga0213876_100307682 | 337 |
| 146 | 3300021384 | Ga0213876_10076050 | Ga0213876_100760501 | 337 |
| 147 | 3300031238 | Ga0265332_10000044 | Ga0265332_1000004428 | 337 |
| 148 | 3300031239 | Ga0265328_10077161 | Ga0265328_100771611 | 337 |
| 149 | 3300031242 | Ga0265329_10005817 | Ga0265329_100058172 | 337 |
| 150 | 3300031249 | Ga0265339_10031038 | Ga0265339_100310382 | 337 |
| 151 | 3300031250 | Ga0265331_10000076 | Ga0265331_1000007693 | 337 |
| 152 | 3300031344 | Ga0265316_10000006 | Ga0265316_10000006153 | 337 |
| 153 | 3300031711 | Ga0265314_10000056 | Ga0265314_1000005657 | 337 |
| 154 | 3300039437 | Ga0436365_1679983 | Ga0436365_1679983_177_1199 | 337 |
| 155 | 3300053103 | Ga0500555_000018 | Ga0500555_000018_107855_108874 | 337 |
| 156 | 3300042876 | Ga0451577_0151428 | Ga0451577_0151428_729_1748 | 338 |
| 157 | 3300045051 | Ga0451576_0189244 | Ga0451576_0189244_457_1476 | 338 |
| 158 | 3300045051 | Ga0451576_0198598 | Ga0451576_0198598_575_1627 | 338 |
| 159 | 3300031548 | Ga0307408_100013430 | Ga0307408_1000134304 | 339 |
| 160 | 3300031824 | Ga0307413_10176779 | Ga0307413_101767792 | 339 |
| 161 | 3300031852 | Ga0307410_10030065 | Ga0307410_100300652 | 339 |
| 162 | 3300031995 | Ga0307409_100088093 | Ga0307409_1000880932 | 339 |
| 163 | 3300032002 | Ga0307416_100005147 | Ga0307416_1000051476 | 339 |
| 164 | 3300032002 | Ga0307416_100139756 | Ga0307416_1001397562 | 339 |
| 165 | 3300009147 | Ga0114129_10489974 | Ga0114129_104899742 | 340 |
| 166 | 3300045051 | Ga0451576_0048737 | Ga0451576_0048737_3348_4373 | 340 |
| 167 | 3300050507 | nmdc:mga05p37_267769_c1 | nmdc:mga05p37_267769_c1_313_1368 | 340 |
| 168 | 3300005354 | Ga0070675_100300211 | Ga0070675_1003002111 | 341 |
| 169 | 3300045051 | Ga0451576_0001626 | Ga0451576_0001626_2730_3764 | 341 |
| 170 | 3300049741 | Ga0501079_0005587 | Ga0501079_0005587_7804_8904 | 341 |
| 171 | 3300049743 | Ga0501081_0035492 | Ga0501081_0035492_209_1309 | 341 |
| 172 | 3300013306 | Ga0163162_10036455 | Ga0163162_100364554 | 342 |
| 173 | 3300013308 | Ga0157375_10367330 | Ga0157375_103673302 | 342 |
| 174 | 3300014968 | Ga0157379_10001200 | Ga0157379_1000120017 | 342 |
| 175 | 3300028381 | Ga0268264_10080355 | Ga0268264_100803552 | 342 |
| 176 | 3300028800 | Ga0265338_10000471 | Ga0265338_1000047130 | 342 |
| 177 | 3300031249 | Ga0265339_10004898 | Ga0265339_100048986 | 342 |
| 178 | 3300031711 | Ga0265314_10007990 | Ga0265314_100079905 | 342 |
| 179 | 3300035692 | Ga0373935_0042043 | Ga0373935_0042043_878_1936 | 342 |
| 180 | 3300037068 | Ga0373925_0009615 | Ga0373925_0009615_1535_2593 | 342 |
| 181 | 3300044673 | Ga0453683_0002424 | Ga0453683_0002424_4257_5333 | 342 |
| 182 | 3300046472 | Ga0495580_0001598 | Ga0495580_0001598_15138_16196 | 342 |
| 183 | 3300005340 | Ga0070689_100105842 | Ga0070689_1001058421 | 344 |
| 184 | 3300049656 | Ga0501209_001936 | Ga0501209_001936_1175_2410 | 344 |
| 185 | 3300049769 | Ga0501272_004417 | Ga0501272_004417_153_1214 | 344 |
| 186 | 3300050511 | nmdc:mga08y16_38045_c1 | nmdc:mga08y16_38045_c1_819_1943 | 344 |
| 187 | 3300005330 | Ga0070690_100014581 | Ga0070690_1000145814 | 345 |
| 188 | 3300005340 | Ga0070689_100026937 | Ga0070689_1000269372 | 345 |
| 189 | 3300005365 | Ga0070688_100008589 | Ga0070688_1000085895 | 345 |
| 190 | 3300005440 | Ga0070705_100024971 | Ga0070705_1000249712 | 345 |
| 191 | 3300005445 | Ga0070708_100048845 | Ga0070708_1000488452 | 345 |
| 192 | 3300005536 | Ga0070697_100028520 | Ga0070697_1000285204 | 345 |
| 193 | 3300005546 | Ga0070696_100025301 | Ga0070696_1000253013 | 345 |
| 194 | 3300005549 | Ga0070704_100139568 | Ga0070704_1001395682 | 345 |
| 195 | 3300005617 | Ga0068859_100044071 | Ga0068859_1000440714 | 345 |
| 196 | 3300006844 | Ga0075428_100007653 | Ga0075428_1000076538 | 345 |
| 197 | 3300006844 | Ga0075428_100072833 | Ga0075428_1000728331 | 345 |
| 198 | 3300006847 | Ga0075431_100058624 | Ga0075431_1000586242 | 345 |
| 199 | 3300006852 | Ga0075433_10017655 | Ga0075433_100176555 | 345 |
| 200 | 3300006931 | Ga0097620_100044072 | Ga0097620_1000440724 | 345 |
| 201 | 3300009094 | Ga0111539_10087613 | Ga0111539_100876133 | 345 |
| 202 | 3300009094 | Ga0111539_10115140 | Ga0111539_101151402 | 345 |
| 203 | 3300009094 | Ga0111539_10299376 | Ga0111539_102993762 | 345 |
| 204 | 3300025936 | Ga0207670_10000896 | Ga0207670_1000089612 | 345 |
| 205 | 3300031995 | Ga0307409_100006205 | Ga0307409_1000062053 | 345 |
| 206 | 3300032126 | Ga0307415_100126061 | Ga0307415_1001260611 | 345 |
| 207 | 3300046454 | Ga0495592_0000137 | Ga0495592_0000137_16737_17849 | 345 |
| 208 | 3300046476 | Ga0495662_0011848 | Ga0495662_0011848_1807_2919 | 345 |
| 209 | 3300046514 | Ga0495618_0016194 | Ga0495618_0016194_1048_2160 | 345 |
| 210 | 3300046516 | Ga0495628_0001043 | Ga0495628_0001043_4959_6005 | 345 |
| 211 | 3300046517 | Ga0495630_0017838 | Ga0495630_0017838_81_1193 | 345 |
| 212 | 3300046535 | Ga0495586_0023292 | Ga0495586_0023292_2012_3124 | 345 |
| 213 | 3300046543 | Ga0495645_0084329 | Ga0495645_0084329_954_2000 | 345 |
| 214 | 3300049586 | Ga0501070_0076853 | Ga0501070_0076853_837_1898 | 345 |
| 215 | 3300049742 | Ga0501080_0067088 | Ga0501080_0067088_1052_2113 | 345 |
| 216 | 3300049742 | Ga0501080_0292555 | Ga0501080_0292555_335_1396 | 345 |
| 217 | 3300050510 | nmdc:mga06r32_292504_c1 | nmdc:mga06r32_292504_c1_337_1395 | 345 |
| 218 | 3300050511 | nmdc:mga08y16_43826_c1 | nmdc:mga08y16_43826_c1_588_1646 | 345 |
| 219 | 3300005544 | Ga0070686_100002954 | Ga0070686_1000029544 | 346 |
| 220 | 3300025926 | Ga0207659_10141536 | Ga0207659_101415362 | 346 |
| 221 | 3300031824 | Ga0307413_10004983 | Ga0307413_100049834 | 346 |
| 222 | 3300031852 | Ga0307410_10125851 | Ga0307410_101258512 | 346 |
| 223 | 3300032005 | Ga0307411_10012258 | Ga0307411_100122583 | 346 |
| 224 | 3300038443 | Ga0395901_0419072 | Ga0395901_0419072_113_1165 | 346 |
| 225 | 3300053153 | Ga0500616_0035266 | Ga0500616_0035266_1299_2369 | 346 |
| 226 | 3300005328 | Ga0070676_10066770 | Ga0070676_100667703 | 350 |
| 227 | 3300005333 | Ga0070677_10003260 | Ga0070677_100032603 | 350 |
| 228 | 3300005336 | Ga0070680_100178153 | Ga0070680_1001781532 | 350 |
| 229 | 3300005353 | Ga0070669_100009416 | Ga0070669_1000094162 | 350 |
| 230 | 3300005353 | Ga0070669_100101317 | Ga0070669_1001013172 | 350 |
| 231 | 3300005356 | Ga0070674_100001154 | Ga0070674_1000011543 | 350 |
| 232 | 3300005364 | Ga0070673_100171220 | Ga0070673_1001712202 | 350 |
| 233 | 3300005440 | Ga0070705_100000614 | Ga0070705_10000061411 | 350 |
| 234 | 3300005444 | Ga0070694_100042433 | Ga0070694_1000424332 | 350 |
| 235 | 3300005456 | Ga0070678_100046536 | Ga0070678_1000465363 | 350 |
| 236 | 3300005457 | Ga0070662_100004666 | Ga0070662_1000046669 | 350 |
| 237 | 3300005459 | Ga0068867_100004996 | Ga0068867_1000049963 | 350 |
| 238 | 3300005546 | Ga0070696_100008024 | Ga0070696_1000080243 | 350 |
| 239 | 3300005549 | Ga0070704_100020577 | Ga0070704_1000205773 | 350 |
| 240 | 3300005563 | Ga0068855_100115758 | Ga0068855_1001157583 | 350 |
| 241 | 3300005718 | Ga0068866_10000672 | Ga0068866_100006721 | 350 |
| 242 | 3300005719 | Ga0068861_100033474 | Ga0068861_1000334742 | 350 |
| 243 | 3300005843 | Ga0068860_100023982 | Ga0068860_1000239823 | 350 |
| 244 | 3300006881 | Ga0068865_100000264 | Ga0068865_10000026414 | 350 |
| 245 | 3300017792 | Ga0163161_10125781 | Ga0163161_101257812 | 350 |
| 246 | 3300025899 | Ga0207642_10021677 | Ga0207642_100216772 | 350 |
| 247 | 3300025907 | Ga0207645_10000536 | Ga0207645_1000053622 | 350 |
| 248 | 3300025911 | Ga0207654_10044785 | Ga0207654_100447853 | 350 |
| 249 | 3300025923 | Ga0207681_10157094 | Ga0207681_101570942 | 350 |
| 250 | 3300025933 | Ga0207706_10000038 | Ga0207706_1000003837 | 350 |
| 251 | 3300025934 | Ga0207686_10000481 | Ga0207686_1000048110 | 350 |
| 252 | 3300025940 | Ga0207691_10059350 | Ga0207691_100593502 | 350 |
| 253 | 3300025941 | Ga0207711_10029091 | Ga0207711_100290911 | 350 |
| 254 | 3300025942 | Ga0207689_10000945 | Ga0207689_100009454 | 350 |
| 255 | 3300025949 | Ga0207667_10079740 | Ga0207667_100797403 | 350 |
| 256 | 3300025960 | Ga0207651_10335934 | Ga0207651_103359341 | 350 |
| 257 | 3300026035 | Ga0207703_10146943 | Ga0207703_101469432 | 350 |
| 258 | 3300026075 | Ga0207708_10129285 | Ga0207708_101292852 | 350 |
| 259 | 3300026089 | Ga0207648_10000036 | Ga0207648_1000003638 | 350 |
| 260 | 3300026118 | Ga0207675_100050955 | Ga0207675_1000509552 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xkn-assembly1.cif.gz_A | crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21 | 0.9781 | 7 | 350 |
| 1xkn-assembly1.cif.gz_A | crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21 | 0.9561 | 7 | 350 |
| 6b2w-assembly2.cif.gz_B | c. jejuni c315s agmatine deiminase with substrate bound | 0.9475 | 8 | 349 |
| 6nic-assembly2.cif.gz_D | crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide | 0.928 | 7 | 350 |
| 2q3u-assembly2.cif.gz_B | ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase | 0.9254 | 2 | 349 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xknA00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.9689 | 7 | 350 | 3.75.10.10 |
| 1xknA00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.9412 | 7 | 350 | 3.75.10.10 |
| 6b10B00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.9241 | 7 | 349 | 3.75.10.10 |
| 1zbrB00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.9181 | 8 | 348 | 3.75.10.10 |
| 3hvmA00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.9175 | 8 | 347 | 3.75.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5S129-F1-model_v4 | Agmatine deiminase | 0.9985 | 131 | 248 |
GO:0004668
GO:0009446 GO:0047632 |
| AF-A0A7Y4UC95-F1-model_v4 | Agmatine deiminase family protein | 0.9957 | 10 | 284 |
GO:0004668
GO:0009446 GO:0047632 |
| AF-A0A2V9LH28-F1-model_v4 | Agmatine deiminase | 0.994 | 178 | 350 |
GO:0004668
GO:0009446 GO:0047632 |
| AF-A0A3L7QMP5-F1-model_v4 | Agmatine deiminase family protein | 0.9934 | 10 | 350 |
GO:0004668
GO:0009446 GO:0047632 |
| AF-A0A7T9GMQ5-F1-model_v4 | deleted | 0.9923 | 10 | 350 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar