F369866

General Info

Members Datasets Scaffolds Average Seq Length
260 174 520 137

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0000188|Ga0496115_0000188_26698_27162
Length 154
Sequence MKRTAVLTLAFAPMPAPFVHELRVRYGECDPQGIVFNANYLLYFDVVFTELWRAAVGPWQEMVKRGVDAVVADANLSFRAPARFDDELELRARIAKLGRTSLSTEIDVVRDGQVLVCGTLRHVCVSTETWGKTELPEWVRSGLEPFVSASAGAG

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 13.08
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 14.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0000188 3300048918 Bacteria 57530
2 Ga0070658_10246620 3300005327 Unclassified 1515
3 Ga0070680_100013610 3300005336 Bacteria 6340
4 Ga0068868_100178676 3300005338 Bacteria 1760
5 Ga0068868_101442093 3300005338 Bacteria 643
6 Ga0070660_100269439 3300005339 Unclassified 1392
7 Ga0070661_100020053 3300005344 Bacteria 4766
8 Ga0070668_102188481 3300005347 Bacteria 511
9 Ga0070659_100002687 3300005366 Bacteria 12638
10 Ga0070659_100235366 3300005366 Bacteria 1514
11 Ga0070709_10160226 3300005434 Bacteria 1564
12 Ga0070709_11017898 3300005434 Bacteria 659
13 Ga0070711_100083130 3300005439 Bacteria 2287
14 Ga0070663_101871065 3300005455 Unclassified 539
15 Ga0070662_100608910 3300005457 Unclassified 919
16 Ga0070681_10011771 3300005458 Bacteria 8670
17 Ga0070679_100017209 3300005530 Bacteria 6992
18 Ga0070684_100014867 3300005535 Bacteria 6317
19 Ga0070684_100732221 3300005535 Bacteria 923
20 Ga0070684_100750602 3300005535 Unclassified 911
21 Ga0070696_100414199 3300005546 Bacteria 1057
22 Ga0068855_102590718 3300005563 Bacteria 503
23 Ga0070664_100120044 3300005564 Bacteria 2301
24 Ga0070664_101518993 3300005564 Unclassified 634
25 Ga0068857_100263158 3300005577 Unclassified 1583
26 Ga0068854_101830747 3300005578 Unclassified 557
27 Ga0068856_100010798 3300005614 Bacteria 8869
28 Ga0068856_100153088 3300005614 Bacteria 2315
29 Ga0068856_100658700 3300005614 Unclassified 1067
30 Ga0068852_101567245 3300005616 Bacteria 681
31 Ga0068862_100498050 3300005844 Bacteria 1156
32 Ga0081455_10007913 3300005937 Bacteria 11126
33 Ga0081455_10053202 3300005937 Bacteria 3460
34 Ga0081455_10132244 3300005937 Bacteria 1949
35 Ga0081540_1001811 3300005983 Bacteria 17938
36 Ga0081540_1006009 3300005983 Bacteria 8941
37 Ga0081540_1048001 3300005983 Bacteria 2142
38 Ga0075363_100619310 3300006048 Bacteria 649
39 Ga0075364_10027351 3300006051 Bacteria 3643
40 Ga0070716_100280364 3300006173 Bacteria 1150
41 Ga0070712_100084345 3300006175 Bacteria 2310
42 Ga0070712_100845643 3300006175 Bacteria 787
43 Ga0075435_101272481 3300007076 Bacteria 644
44 Ga0105240_10062878 3300009093 Bacteria 4620
45 Ga0105240_11439100 3300009093 Bacteria 724
46 Ga0111539_10163137 3300009094 Bacteria 2606
47 Ga0105245_10340854 3300009098 Bacteria 1482
48 Ga0105245_10783740 3300009098 Bacteria 991
49 Ga0105237_10024147 3300009545 Bacteria 6219
50 Ga0105237_10127032 3300009545 Bacteria 2544
51 Ga0105237_12087983 3300009545 Bacteria 576
52 Ga0105238_10171788 3300009551 Bacteria 2144
53 Ga0105249_10719683 3300009553 Bacteria 1059
54 Ga0105239_10316162 3300010375 Bacteria 1760
55 Ga0105239_10998501 3300010375 Bacteria 962
56 Ga0105239_11123758 3300010375 Bacteria 905
57 Ga0157371_10104885 3300013102 Bacteria 2006
58 Ga0157370_10006404 3300013104 Bacteria 12985
59 Ga0157369_10012705 3300013105 Bacteria 9551
60 Ga0157372_10047056 3300013307 Bacteria 4791
61 Ga0157375_11065278 3300013308 Bacteria 945
62 Ga0157379_10277510 3300014968 Bacteria 1525
63 Ga0157376_12917933 3300014969 Bacteria 518
64 Ga0207692_10228290 3300025898 Bacteria 1107
65 Ga0207688_10371786 3300025901 Bacteria 883
66 Ga0207695_10116663 3300025913 Bacteria 2643
67 Ga0207695_10884298 3300025913 Bacteria 773
68 Ga0207671_10014852 3300025914 Bacteria 6129
69 Ga0207693_10098630 3300025915 Bacteria 2291
70 Ga0207663_10204915 3300025916 Bacteria 1425
71 Ga0207660_10212557 3300025917 Unclassified 1515
72 Ga0207649_10049259 3300025920 Bacteria 2601
73 Ga0207652_10018420 3300025921 Bacteria 5726
74 Ga0207652_10523593 3300025921 Bacteria 1067
75 Ga0207694_10069789 3300025924 Bacteria 2745
76 Ga0207687_10457038 3300025927 Bacteria 1060
77 Ga0207687_10499892 3300025927 Bacteria 1015
78 Ga0207687_10875571 3300025927 Bacteria 768
79 Ga0207700_10501720 3300025928 Bacteria 1074
80 Ga0207690_10325999 3300025932 Unclassified 1208
81 Ga0207704_11606565 3300025938 Bacteria 558
82 Ga0207665_10146478 3300025939 Bacteria 1688
83 Ga0207661_10001819 3300025944 Bacteria 14579
84 Ga0207679_10132880 3300025945 Bacteria 1999
85 Ga0207712_10561082 3300025961 Bacteria 983
86 Ga0207640_10677771 3300025981 Unclassified 881
87 Ga0207640_10711475 3300025981 Bacteria 862
88 Ga0207677_10462503 3300026023 Unclassified 1089
89 Ga0207702_11008056 3300026078 Unclassified 826
90 Ga0207702_11350189 3300026078 Bacteria 707
91 Ga0207674_10293807 3300026116 Unclassified 1573
92 Ga0207698_10630073 3300026142 Bacteria 1060
93 Ga0268265_10695367 3300028380 Bacteria 982
94 Ga0265337_1029774 3300028556 Bacteria 1631
95 Ga0265319_1000580 3300028563 Bacteria 24559
96 Ga0265318_10016352 3300028577 Bacteria 3066
97 Ga0265318_10085123 3300028577 Bacteria 1166
98 Ga0265322_10002856 3300028654 Bacteria 5277
99 Ga0265338_10019284 3300028800 Bacteria 7250
100 Ga0265330_10045838 3300031235 Bacteria 1928
101 Ga0265332_10061972 3300031238 Bacteria 1599
102 Ga0265325_10042444 3300031241 Bacteria 2378
103 Ga0265340_10060671 3300031247 Bacteria 1811
104 Ga0265331_10050170 3300031250 Bacteria 2002
105 Ga0265327_10007700 3300031251 Bacteria 8244
106 Ga0265327_10104650 3300031251 Bacteria 1360
107 Ga0265314_10003770 3300031711 Bacteria 14491
108 Ga0307406_11249297 3300031901 Bacteria 647
109 Ga0307416_101042514 3300032002 Bacteria 922
110 Ga0307415_100075530 3300032126 Bacteria 2385
111 Ga0373945_0479932 3300035116 Bacteria 552
112 Ga0373946_0378147 3300035171 Bacteria 712
113 Ga0373955_1034257 3300035172 Bacteria 506
114 Ga0373935_0549224 3300035692 Unclassified 842
115 Ga0373927_0884221 3300035695 Bacteria 590
116 Ga0373947_0058993 3300035725 Bacteria 2326
117 Ga0373925_0512282 3300037068 Bacteria 985
118 Ga0395900_0214266 3300037418 Bacteria 1944
119 Ga0395900_0575375 3300037418 Bacteria 1069
120 Ga0395898_0127030 3300037466 Bacteria 2443
121 Ga0395898_0157771 3300037466 Bacteria 2170
122 Ga0395898_0623571 3300037466 Bacteria 1021
123 Ga0395898_1159016 3300037466 Bacteria 705
124 Ga0395905_0588447 3300037471 Bacteria 1014
125 Ga0395905_0600289 3300037471 Bacteria 1003
126 Ga0395905_0867063 3300037471 Bacteria 806
127 Ga0395901_0010204 3300038443 Bacteria 9516
128 Ga0395901_0224299 3300038443 Bacteria 1964
129 Ga0395901_0598283 3300038443 Bacteria 1112
130 Ga0395901_0894523 3300038443 Bacteria 870
131 Ga0395901_0978927 3300038443 Bacteria 823
132 Ga0395901_1110000 3300038443 Bacteria 761
133 Ga0436361_0266652 3300039447 Unclassified 676
134 Ga0436363_0795875 3300039450 Unclassified 807
135 Ga0436363_0824428 3300039450 Bacteria 659
136 Ga0451793_0564949 3300041452 Bacteria 506
137 Ga0451853_0627966 3300041512 Bacteria 611
138 Ga0451853_1490076 3300041512 Unclassified 699
139 Ga0451853_3291006 3300041512 Bacteria 940
140 Ga0466966_1017433 3300044684 Bacteria 500
141 Ga0466963_0078945 3300044694 Bacteria 2226
142 Ga0466963_0179710 3300044694 Unclassified 1477
143 Ga0466963_0218782 3300044694 Bacteria 1334
144 Ga0466963_0246480 3300044694 Bacteria 1253
145 Ga0466963_0360870 3300044694 Bacteria 1023
146 Ga0466963_0476415 3300044694 Bacteria 881
147 Ga0466963_0882405 3300044694 Bacteria 630
148 Ga0466963_0923329 3300044694 Bacteria 615
149 Ga0466964_0053062 3300044706 Bacteria 1668
150 Ga0466968_0122688 3300044735 Bacteria 1177
151 Ga0466970_0212462 3300044765 Bacteria 1078
152 Ga0466957_0044832 3300044842 Bacteria 2681
153 Ga0466957_0046251 3300044842 Bacteria 2642
154 Ga0466957_0419759 3300044842 Bacteria 917
155 Ga0466957_0746516 3300044842 Bacteria 693
156 Ga0466960_0045613 3300044901 Bacteria 2095
157 Ga0466959_0416707 3300045049 Bacteria 912
158 Ga0466958_0134474 3300045836 Unclassified 1554
159 Ga0466958_0202768 3300045836 Bacteria 1263
160 Ga0466958_0205884 3300045836 Bacteria 1253
161 Ga0466967_0104034 3300045976 Bacteria 2598
162 Ga0466967_0139179 3300045976 Bacteria 2259
163 Ga0466967_0161320 3300045976 Bacteria 2104
164 Ga0466967_0183230 3300045976 Bacteria 1976
165 Ga0466967_0530376 3300045976 Bacteria 1158
166 Ga0466967_1102882 3300045976 Bacteria 791
167 Ga0466967_1286713 3300045976 Bacteria 728
168 Ga0466967_1705541 3300045976 Unclassified 627
169 Ga0466967_1868041 3300045976 Bacteria 597
170 Ga0495591_071266 3300046458 Bacteria 902
171 Ga0495629_0393436 3300046459 Unclassified 942
172 Ga0495641_0020358 3300046461 Bacteria 3366
173 Ga0495653_0365628 3300046463 Bacteria 925
174 Ga0495582_0183562 3300046473 Bacteria 1192
175 Ga0495605_0084837 3300046474 Bacteria 1476
176 Ga0495584_0013299 3300046491 Bacteria 4202
177 Ga0495596_0307583 3300046500 Unclassified 616
178 Ga0495616_0444483 3300046513 Unclassified 526
179 Ga0495631_0302308 3300046518 Bacteria 681
180 Ga0495637_0191851 3300046520 Unclassified 754
181 Ga0495643_0265781 3300046522 Bacteria 795
182 Ga0495652_0607514 3300046529 Unclassified 745
183 Ga0495652_0985740 3300046529 Bacteria 552
184 Ga0495665_0311557 3300046531 Bacteria 805
185 Ga0495634_0532436 3300046642 Unclassified 686
186 Ga0495657_0162632 3300046675 Unclassified 1380
187 Ga0495658_0078278 3300046683 Bacteria 1935
188 Ga0495624_0124704 3300046690 Bacteria 1581
189 Ga0495660_0355129 3300046810 Unclassified 651
190 Ga0495680_0131711 3300047322 Unclassified 1837
191 Ga0495615_0316313 3300048090 Unclassified 509
192 Ga0496100_0022308 3300048903 Bacteria 3831
193 Ga0496100_0374879 3300048903 Bacteria 1080
194 Ga0496101_0039963 3300048904 Bacteria 3340
195 Ga0496102_0172810 3300048905 Bacteria 2034
196 Ga0496103_0113925 3300048906 Bacteria 1719
197 Ga0496104_0040692 3300048907 Bacteria 4357
198 Ga0496105_0163904 3300048908 Bacteria 1824
199 Ga0496105_0655372 3300048908 Bacteria 810
200 Ga0496105_0757874 3300048908 Bacteria 741
201 Ga0496106_0019326 3300048909 Bacteria 5051
202 Ga0496107_0042437 3300048910 Bacteria 3267
203 Ga0496107_1155404 3300048910 Unclassified 558
204 Ga0496108_0002221 3300048911 Bacteria 15543
205 Ga0496108_0250091 3300048911 Bacteria 1542
206 Ga0496109_0243569 3300048912 Bacteria 1692
207 Ga0496109_0283272 3300048912 Bacteria 1562
208 Ga0496109_0324181 3300048912 Bacteria 1454
209 Ga0496110_0000504 3300048913 Bacteria 26479
210 Ga0496110_0042305 3300048913 Bacteria 3977
211 Ga0496110_0354522 3300048913 Bacteria 1336
212 Ga0496111_0001728 3300048914 Bacteria 12784
213 Ga0496111_0024336 3300048914 Bacteria 4262
214 Ga0496112_0017052 3300048915 Bacteria 6819
215 Ga0496112_0190109 3300048915 Bacteria 2015
216 Ga0496112_0283508 3300048915 Bacteria 1603
217 Ga0496112_0345828 3300048915 Bacteria 1430
218 Ga0496112_0661707 3300048915 Unclassified 974
219 Ga0496113_0030701 3300048916 Bacteria 3892
220 Ga0496113_0281264 3300048916 Unclassified 1330
221 Ga0496114_0104591 3300048917 Bacteria 2421
222 Ga0496115_0000207 3300048918 Bacteria 54341
223 Ga0496115_0332939 3300048918 Bacteria 1240
224 Ga0496122_0142943 3300048925 Bacteria 1493
225 Ga0501031_0014062 3300049568 Bacteria 5209
226 Ga0501032_0007386 3300049569 Bacteria 8026
227 Ga0501033_0075395 3300049570 Bacteria 2475
228 Ga0501036_0347050 3300049572 Bacteria 1239
229 Ga0501037_0381478 3300049573 Bacteria 969
230 Ga0501037_0512633 3300049573 Bacteria 812
231 Ga0501038_0036041 3300049574 Bacteria 4341
232 Ga0501039_0153781 3300049575 Bacteria 1807
233 Ga0501039_0697877 3300049575 Bacteria 794
234 Ga0501042_0090505 3300049578 Bacteria 2196
235 Ga0501042_0101287 3300049578 Bacteria 2071
236 Ga0501042_1297042 3300049578 Unclassified 531
237 Ga0501043_0157427 3300049579 Bacteria 1776
238 Ga0501046_0095996 3300049580 Bacteria 2277
239 Ga0501048_0062926 3300049582 Bacteria 2625
240 Ga0501067_0040675 3300049583 Bacteria 2581
241 Ga0501067_0408233 3300049583 Bacteria 758
242 Ga0501067_0458814 3300049583 Bacteria 712
243 Ga0501068_0140941 3300049584 Bacteria 1511
244 Ga0501069_0136946 3300049585 Bacteria 1403
245 Ga0501070_0116615 3300049586 Bacteria 2205
246 Ga0501072_0327949 3300049588 Bacteria 1216
247 Ga0501073_0236158 3300049589 Bacteria 1262
248 Ga0501074_0017451 3300049590 Bacteria 5209
249 Ga0501080_0021954 3300049742 Bacteria 5912
250 Ga0501083_0004671 3300049744 Bacteria 9679
251 Ga0501035_0071111 3300049822 Bacteria 3081
252 Ga0501044_0086349 3300049823 Bacteria 3169
253 Ga0501045_0065318 3300049824 Bacteria 2672
254 nmdc:mga00v17_52584_c1 3300050491 Bacteria 2479
255 nmdc:mga06r32_1183779_c1 3300050510 Bacteria 711
256 nmdc:mga08y16_207360_c1 3300050511 Bacteria 2030
257 Ga0495595_0580746 3300053084 Unclassified 573
258 Ga0501084_0117051 3300054114 Bacteria 2241
259 Ga0501082_0016867 3300060353 Bacteria 6289
260 Ga0501082_0079022 3300060353 Bacteria 2838
261 Ga0496115_0000188
262 Ga0070658_10246620
263 Ga0070680_100013610
264 Ga0068868_100178676
265 Ga0068868_101442093
266 Ga0070660_100269439
267 Ga0070661_100020053
268 Ga0070668_102188481
269 Ga0070659_100002687
270 Ga0070659_100235366
271 Ga0070709_10160226
272 Ga0070709_11017898
273 Ga0070711_100083130
274 Ga0070663_101871065
275 Ga0070662_100608910
276 Ga0070681_10011771
277 Ga0070679_100017209
278 Ga0070684_100014867
279 Ga0070684_100732221
280 Ga0070684_100750602
281 Ga0070696_100414199
282 Ga0068855_102590718
283 Ga0070664_100120044
284 Ga0070664_101518993
285 Ga0068857_100263158
286 Ga0068854_101830747
287 Ga0068856_100010798
288 Ga0068856_100153088
289 Ga0068856_100658700
290 Ga0068852_101567245
291 Ga0068862_100498050
292 Ga0081455_10007913
293 Ga0081455_10053202
294 Ga0081455_10132244
295 Ga0081540_1001811
296 Ga0081540_1006009
297 Ga0081540_1048001
298 Ga0075363_100619310
299 Ga0075364_10027351
300 Ga0070716_100280364
301 Ga0070712_100084345
302 Ga0070712_100845643
303 Ga0075435_101272481
304 Ga0105240_10062878
305 Ga0105240_11439100
306 Ga0111539_10163137
307 Ga0105245_10340854
308 Ga0105245_10783740
309 Ga0105237_10024147
310 Ga0105237_10127032
311 Ga0105237_12087983
312 Ga0105238_10171788
313 Ga0105249_10719683
314 Ga0105239_10316162
315 Ga0105239_10998501
316 Ga0105239_11123758
317 Ga0157371_10104885
318 Ga0157370_10006404
319 Ga0157369_10012705
320 Ga0157372_10047056
321 Ga0157375_11065278
322 Ga0157379_10277510
323 Ga0157376_12917933
324 Ga0207692_10228290
325 Ga0207688_10371786
326 Ga0207695_10116663
327 Ga0207695_10884298
328 Ga0207671_10014852
329 Ga0207693_10098630
330 Ga0207663_10204915
331 Ga0207660_10212557
332 Ga0207649_10049259
333 Ga0207652_10018420
334 Ga0207652_10523593
335 Ga0207694_10069789
336 Ga0207687_10457038
337 Ga0207687_10499892
338 Ga0207687_10875571
339 Ga0207700_10501720
340 Ga0207690_10325999
341 Ga0207704_11606565
342 Ga0207665_10146478
343 Ga0207661_10001819
344 Ga0207679_10132880
345 Ga0207712_10561082
346 Ga0207640_10677771
347 Ga0207640_10711475
348 Ga0207677_10462503
349 Ga0207702_11008056
350 Ga0207702_11350189
351 Ga0207674_10293807
352 Ga0207698_10630073
353 Ga0268265_10695367
354 Ga0265337_1029774
355 Ga0265319_1000580
356 Ga0265318_10016352
357 Ga0265318_10085123
358 Ga0265322_10002856
359 Ga0265338_10019284
360 Ga0265330_10045838
361 Ga0265332_10061972
362 Ga0265325_10042444
363 Ga0265340_10060671
364 Ga0265331_10050170
365 Ga0265327_10007700
366 Ga0265327_10104650
367 Ga0265314_10003770
368 Ga0307406_11249297
369 Ga0307416_101042514
370 Ga0307415_100075530
371 Ga0373945_0479932
372 Ga0373946_0378147
373 Ga0373955_1034257
374 Ga0373935_0549224
375 Ga0373927_0884221
376 Ga0373947_0058993
377 Ga0373925_0512282
378 Ga0395900_0214266
379 Ga0395900_0575375
380 Ga0395898_0127030
381 Ga0395898_0157771
382 Ga0395898_0623571
383 Ga0395898_1159016
384 Ga0395905_0588447
385 Ga0395905_0600289
386 Ga0395905_0867063
387 Ga0395901_0010204
388 Ga0395901_0224299
389 Ga0395901_0598283
390 Ga0395901_0894523
391 Ga0395901_0978927
392 Ga0395901_1110000
393 Ga0436361_0266652
394 Ga0436363_0795875
395 Ga0436363_0824428
396 Ga0451793_0564949
397 Ga0451853_0627966
398 Ga0451853_1490076
399 Ga0451853_3291006
400 Ga0466966_1017433
401 Ga0466963_0078945
402 Ga0466963_0179710
403 Ga0466963_0218782
404 Ga0466963_0246480
405 Ga0466963_0360870
406 Ga0466963_0476415
407 Ga0466963_0882405
408 Ga0466963_0923329
409 Ga0466964_0053062
410 Ga0466968_0122688
411 Ga0466970_0212462
412 Ga0466957_0044832
413 Ga0466957_0046251
414 Ga0466957_0419759
415 Ga0466957_0746516
416 Ga0466960_0045613
417 Ga0466959_0416707
418 Ga0466958_0134474
419 Ga0466958_0202768
420 Ga0466958_0205884
421 Ga0466967_0104034
422 Ga0466967_0139179
423 Ga0466967_0161320
424 Ga0466967_0183230
425 Ga0466967_0530376
426 Ga0466967_1102882
427 Ga0466967_1286713
428 Ga0466967_1705541
429 Ga0466967_1868041
430 Ga0495591_071266
431 Ga0495629_0393436
432 Ga0495641_0020358
433 Ga0495653_0365628
434 Ga0495582_0183562
435 Ga0495605_0084837
436 Ga0495584_0013299
437 Ga0495596_0307583
438 Ga0495616_0444483
439 Ga0495631_0302308
440 Ga0495637_0191851
441 Ga0495643_0265781
442 Ga0495652_0607514
443 Ga0495652_0985740
444 Ga0495665_0311557
445 Ga0495634_0532436
446 Ga0495657_0162632
447 Ga0495658_0078278
448 Ga0495624_0124704
449 Ga0495660_0355129
450 Ga0495680_0131711
451 Ga0495615_0316313
452 Ga0496100_0022308
453 Ga0496100_0374879
454 Ga0496101_0039963
455 Ga0496102_0172810
456 Ga0496103_0113925
457 Ga0496104_0040692
458 Ga0496105_0163904
459 Ga0496105_0655372
460 Ga0496105_0757874
461 Ga0496106_0019326
462 Ga0496107_0042437
463 Ga0496107_1155404
464 Ga0496108_0002221
465 Ga0496108_0250091
466 Ga0496109_0243569
467 Ga0496109_0283272
468 Ga0496109_0324181
469 Ga0496110_0000504
470 Ga0496110_0042305
471 Ga0496110_0354522
472 Ga0496111_0001728
473 Ga0496111_0024336
474 Ga0496112_0017052
475 Ga0496112_0190109
476 Ga0496112_0283508
477 Ga0496112_0345828
478 Ga0496112_0661707
479 Ga0496113_0030701
480 Ga0496113_0281264
481 Ga0496114_0104591
482 Ga0496115_0000207
483 Ga0496115_0332939
484 Ga0496122_0142943
485 Ga0501031_0014062
486 Ga0501032_0007386
487 Ga0501033_0075395
488 Ga0501036_0347050
489 Ga0501037_0381478
490 Ga0501037_0512633
491 Ga0501038_0036041
492 Ga0501039_0153781
493 Ga0501039_0697877
494 Ga0501042_0090505
495 Ga0501042_0101287
496 Ga0501042_1297042
497 Ga0501043_0157427
498 Ga0501046_0095996
499 Ga0501048_0062926
500 Ga0501067_0040675
501 Ga0501067_0408233
502 Ga0501067_0458814
503 Ga0501068_0140941
504 Ga0501069_0136946
505 Ga0501070_0116615
506 Ga0501072_0327949
507 Ga0501073_0236158
508 Ga0501074_0017451
509 Ga0501080_0021954
510 Ga0501083_0004671
511 Ga0501035_0071111
512 Ga0501044_0086349
513 Ga0501045_0065318
514 nmdc:mga00v17_52584_c1
515 nmdc:mga06r32_1183779_c1
516 nmdc:mga08y16_207360_c1
517 Ga0495595_0580746
518 Ga0501084_0117051
519 Ga0501082_0016867
520 Ga0501082_0079022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

32

117

0.98

PF13279

4HBT_2

Thioesterase-like superfamily

24

143

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9687 5 130
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9678 5 130
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9626 4 130
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.962 5 110
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9619 3 130
ID Description Score Start End Superfamily
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9678 5 130 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.962 5 110 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9571 4 129 3.10.129.10
af_A0A0N7KJH1_95_233_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9507 4 131 3.10.129.10
3ck1B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9365 1 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A846ZA99-F1-model_v4 Acyl-CoA thioesterase 0.9859 1 136 GO:0047617
AF-A0A6L3VKM6-F1-model_v4 Acyl-CoA thioesterase 0.9843 1 137 GO:0047617
AF-A0A4R2J1U3-F1-model_v4 Acyl-CoA thioester hydrolase 0.984 5 130 GO:0047617
AF-A0A7X0FWJ3-F1-model_v4 Acyl-CoA thioester hydrolase (EC 3.1.2.-) 0.9833 1 136 GO:0047617
AF-A0A4R4T7L7-F1-model_v4 Acyl-CoA thioesterase 0.9825 1 136 GO:0047617

Map