F369860

General Info

Members Datasets Scaffolds Average Seq Length
260 197 217 295

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0013245|Ga0496106_0013245_1802_2824
Length 340
Sequence MSIMGDRLPESRARVVQSYILAVFPFRVEFDLRPRNGGSAVKRYDRLKEIRRFDPERDFLEIYRLTATYEFPWDITRALELALYRTYAVPSIGRLLAETAELTDRSQKRYDDTALLLDTVVEHGFDSDPGRTAIRRINQMHRSYDISNDDMRYVLCTFVVVPKRWIDSYGWRRLSDHELRAFAVYYRTLGAHMGIKDVPQTFEEFERTLDTYEDEHFGWDEGGRSVSDATLALMGSWYPGPLAPVVRKASLALLDDALLRAFRYERPGPVARHLTRGALRLRARAVRLLPPRSTAHYARQNPEIKGYPDGYAVGELGTFPTPGVGGCPIPHKRRPGAPVE

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221578 Streptomyces sp. Root63 Isolate Unclassified
5 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
6 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
7 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
8 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
9 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
10 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
11 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
12 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
13 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
14 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
15 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
16 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
17 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
18 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
19 2862574272 Streptomyces sp. AcE210 Isolate Nodule
20 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
21 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
22 2867475112 Streptomyces sp. TM32 Isolate Unclassified
23 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
24 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
25 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
26 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
27 2922554459 Rhodococcus sp. 66b Isolate Unclassified
28 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
29 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
30 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
31 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
32 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
33 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
34 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
35 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
36 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
37 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
193 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
194 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
195 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
196 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
197 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.46
Metatranscriptomes 0
Isolates 16.54

Biome Distribution

Category Percentage (%)
Aerial Root 1.15
Bulb 0
Endosphere 4.23
Nodule 0.77
Rhizoplane 5.38
Rhizosphere 73.46
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10029928 3300003323 Bacteria 5486
2 JGI25160J50197_1004423 3300003354 Bacteria 6081
3 JGI25160J50197_1018645 3300003354 Bacteria 2154
4 Ga0070682_100075748 3300005337 Bacteria 2165
5 Ga0068868_100200946 3300005338 Bacteria 1662
6 Ga0070671_100019493 3300005355 Bacteria 5522
7 Ga0070709_10190101 3300005434 Bacteria 1447
8 Ga0070714_100138595 3300005435 Bacteria 2181
9 Ga0070713_100217986 3300005436 Bacteria 1730
10 Ga0070710_10004890 3300005437 Bacteria 6339
11 Ga0070711_100146867 3300005439 Bacteria 1774
12 Ga0070684_100060716 3300005535 Bacteria 3307
13 Ga0070665_100001291 3300005548 Bacteria 29963
14 Ga0070664_100229275 3300005564 Bacteria 1664
15 Ga0068856_100149966 3300005614 Bacteria 2340
16 Ga0068852_100236438 3300005616 Bacteria 1744
17 Ga0068859_100000308 3300005617 Bacteria 48723
18 Ga0068859_100006167 3300005617 Bacteria 12183
19 Ga0068864_100097135 3300005618 Bacteria 2608
20 Ga0068861_100370779 3300005719 Bacteria 1262
21 Ga0068863_100002702 3300005841 Bacteria 17515
22 Ga0068863_100012771 3300005841 Bacteria 8099
23 Ga0068860_100028192 3300005843 Bacteria 5406
24 Ga0068862_100000046 3300005844 Bacteria 152473
25 Ga0070717_10134606 3300006028 Bacteria 2127
26 Ga0075364_10113430 3300006051 Bacteria 1810
27 Ga0075364_10271286 3300006051 Bacteria 1154
28 Ga0075432_10047981 3300006058 Bacteria 1502
29 Ga0070715_10135840 3300006163 Bacteria 1189
30 Ga0070712_100052417 3300006175 Bacteria 2845
31 Ga0070712_100314089 3300006175 Bacteria 1272
32 Ga0075367_10125490 3300006178 Bacteria 1584
33 Ga0075370_10011630 3300006353 Bacteria 4629
34 Ga0097620_100000308 3300006931 Bacteria 48723
35 Ga0097620_100006167 3300006931 Bacteria 12183
36 Ga0105245_10213557 3300009098 Bacteria 1858
37 Ga0105245_10348043 3300009098 Bacteria 1467
38 Ga0105243_10030136 3300009148 Bacteria 4175
39 Ga0105243_10216747 3300009148 Bacteria 1689
40 Ga0105242_10596638 3300009176 Bacteria 1066
41 Ga0105238_10581539 3300009551 Bacteria 1126
42 Ga0105249_10003269 3300009553 Bacteria 14045
43 Ga0105246_10089004 3300011119 Bacteria 2220
44 Ga0157370_10378811 3300013104 Bacteria 1303
45 Ga0157369_10254515 3300013105 Bacteria 1832
46 Ga0163162_10423397 3300013306 Bacteria 1464
47 Ga0157372_10289678 3300013307 Bacteria 1904
48 Ga0163163_10272931 3300014325 Bacteria 1742
49 Ga0163163_10318015 3300014325 Bacteria 1610
50 Ga0163163_10490244 3300014325 Bacteria 1290
51 Ga0157379_10000019 3300014968 Bacteria 94571
52 Ga0207426_1000533 3300025302 Bacteria 54735
53 Ga0207426_1001037 3300025302 Bacteria 26478
54 Ga0207426_1004995 3300025302 Bacteria 6245
55 Ga0207692_10064542 3300025898 Bacteria 1907
56 Ga0207699_10169365 3300025906 Bacteria 1460
57 Ga0207693_10013655 3300025915 Bacteria 6543
58 Ga0207663_10019412 3300025916 Bacteria 3829
59 Ga0207657_10141818 3300025919 Bacteria 1963
60 Ga0207687_10043368 3300025927 Bacteria 3099
61 Ga0207700_10191383 3300025928 Bacteria 1719
62 Ga0207664_10122175 3300025929 Bacteria 2181
63 Ga0207664_10185507 3300025929 Bacteria 1788
64 Ga0207664_10326181 3300025929 Bacteria 1355
65 Ga0207644_10013068 3300025931 Bacteria 5526
66 Ga0207665_10009526 3300025939 Bacteria 6378
67 Ga0207679_10029622 3300025945 Bacteria 3813
68 Ga0207712_10001211 3300025961 Bacteria 17834
69 Ga0207677_10315430 3300026023 Bacteria 1297
70 Ga0207703_10015151 3300026035 Bacteria 6017
71 Ga0207702_10246878 3300026078 Bacteria 1675
72 Ga0207641_10006209 3300026088 Bacteria 10105
73 Ga0207641_10066324 3300026088 Bacteria 3089
74 Ga0207641_10186715 3300026088 Bacteria 1902
75 Ga0207674_10085312 3300026116 Bacteria 3153
76 Ga0268266_10027742 3300028379 Bacteria 4814
77 Ga0268265_10000039 3300028380 Bacteria 198606
78 Ga0268264_10020178 3300028381 Bacteria 5447
79 Ga0316181_1133468 3300030744 Bacteria 1161
80 Ga0265327_10000001 3300031251 Bacteria 894475
81 Ga0307508_10002111 3300031616 Bacteria 21339
82 Ga0307508_10377653 3300031616 Bacteria 1008
83 Ga0307405_10019459 3300031731 Bacteria 3772
84 Ga0307518_10147505 3300031838 Bacteria 1631
85 Ga0307410_10278592 3300031852 Bacteria 1311
86 Ga0307409_100450572 3300031995 Bacteria 1242
87 Ga0307416_100452609 3300032002 Bacteria 1337
88 Ga0307411_10198975 3300032005 Bacteria 1537
89 Ga0307415_100284027 3300032126 Bacteria 1362
90 Ga0373934_0012955 3300035086 Bacteria 3151
91 Ga0373935_0183610 3300035692 Bacteria 1437
92 Ga0373927_0088622 3300035695 Bacteria 2009
93 Ga0373933_0032293 3300035724 Bacteria 3042
94 Ga0373947_0114180 3300035725 Bacteria 1710
95 Ga0373937_0041524 3300036401 Bacteria 4196
96 Ga0373937_0102051 3300036401 Bacteria 2663
97 Ga0395900_0072520 3300037418 Bacteria 3540
98 Ga0395900_0335531 3300037418 Bacteria 1488
99 Ga0395898_0053317 3300037466 Bacteria 3950
100 Ga0395898_0651919 3300037466 Bacteria 995
101 Ga0436364_0421253 3300037853 Bacteria 2558
102 Ga0436364_0734646 3300037853 Bacteria 3101
103 Ga0395901_0000920 3300038443 Bacteria 32069
104 Ga0451837_1028087 3300041494 Bacteria 1773
105 Ga0466972_0000932 3300044658 Bacteria 14072
106 Ga0466965_0025281 3300044683 Bacteria 2874
107 Ga0466965_0089227 3300044683 Bacteria 1567
108 Ga0466966_0044421 3300044684 Bacteria 2845
109 Ga0466964_0090425 3300044706 Bacteria 1331
110 Ga0466971_0020879 3300044719 Bacteria 2911
111 Ga0466970_0002631 3300044765 Bacteria 8658
112 Ga0466970_0032256 3300044765 Bacteria 2767
113 Ga0466970_0041267 3300044765 Bacteria 2451
114 Ga0466970_0090009 3300044765 Bacteria 1665
115 Ga0466970_0105058 3300044765 Bacteria 1540
116 Ga0466957_0089829 3300044842 Bacteria 1923
117 Ga0466957_0111623 3300044842 Bacteria 1734
118 Ga0466960_0010613 3300044901 Bacteria 3828
119 Ga0466960_0039518 3300044901 Bacteria 2226
120 Ga0466960_0083522 3300044901 Bacteria 1614
121 Ga0466960_0176399 3300044901 Bacteria 1156
122 Ga0466959_0137441 3300045049 Bacteria 1729
123 Ga0466958_0033513 3300045836 Bacteria 3060
124 Ga0466958_0167188 3300045836 Bacteria 1392
125 Ga0466967_0024267 3300045976 Bacteria 4983
126 Ga0466967_0160318 3300045976 Bacteria 2111
127 Ga0466967_0305859 3300045976 Bacteria 1530
128 Ga0466967_0357319 3300045976 Bacteria 1415
129 Ga0466967_0497184 3300045976 Bacteria 1196
130 Ga0495603_0000223 3300046455 Bacteria 29515
131 Ga0495603_0004659 3300046455 Bacteria 8195
132 Ga0495629_0000584 3300046459 Bacteria 29621
133 Ga0495629_0000953 3300046459 Bacteria 23320
134 Ga0495653_0075363 3300046463 Bacteria 2511
135 Ga0495653_0103786 3300046463 Bacteria 2055
136 Ga0495585_0054269 3300046492 Bacteria 2216
137 Ga0495608_0018454 3300046511 Bacteria 4811
138 Ga0495608_0106339 3300046511 Bacteria 1806
139 Ga0495618_0084142 3300046514 Bacteria 2033
140 Ga0495618_0147084 3300046514 Bacteria 1506
141 Ga0495630_0318477 3300046517 Bacteria 1189
142 Ga0495652_0035968 3300046529 Bacteria 4308
143 Ga0495652_0253124 3300046529 Bacteria 1304
144 Ga0495665_0130473 3300046531 Bacteria 1316
145 Ga0495640_0103773 3300046533 Bacteria 1864
146 Ga0495667_0015465 3300046559 Bacteria 5155
147 Ga0495668_0000736 3300046616 Bacteria 39225
148 Ga0495634_0189138 3300046642 Bacteria 1285
149 Ga0495611_0069696 3300046648 Bacteria 1607
150 Ga0495635_0014796 3300046663 Bacteria 5457
151 Ga0495635_0084046 3300046663 Bacteria 2178
152 Ga0495588_0016597 3300046674 Bacteria 3560
153 Ga0495588_0182358 3300046674 Bacteria 1109
154 Ga0495657_0027953 3300046675 Bacteria 3971
155 Ga0495657_0142943 3300046675 Bacteria 1490
156 Ga0495613_0000820 3300046689 Bacteria 24062
157 Ga0495613_0285666 3300046689 Bacteria 1145
158 Ga0495589_0002374 3300046794 Bacteria 10574
159 Ga0495589_0007415 3300046794 Bacteria 5745
160 Ga0495604_0045819 3300047317 Bacteria 3411
161 Ga0495604_0122874 3300047317 Bacteria 1877
162 Ga0495676_0002159 3300047321 Bacteria 17412
163 Ga0495676_0008423 3300047321 Bacteria 9453
164 Ga0495676_0079321 3300047321 Bacteria 2496
165 Ga0495680_0001542 3300047322 Bacteria 24662
166 Ga0495680_0124603 3300047322 Bacteria 1899
167 Ga0495685_004939 3300047447 Bacteria 4333
168 Ga0495684_0030149 3300047471 Bacteria 4164
169 Ga0495684_0230283 3300047471 Bacteria 1355
170 Ga0495593_0081954 3300047673 Bacteria 1668
171 Ga0495593_0123826 3300047673 Bacteria 1315
172 Ga0495602_0153798 3300048088 Bacteria 1804
173 Ga0495614_0001597 3300048089 Bacteria 9836
174 Ga0496101_0006973 3300048904 Bacteria 7295
175 Ga0496102_0000772 3300048905 Bacteria 31172
176 Ga0496102_0079675 3300048905 Bacteria 3016
177 Ga0496103_0000018 3300048906 Bacteria 239585
178 Ga0496104_0052584 3300048907 Bacteria 3848
179 Ga0496105_0013729 3300048908 Bacteria 6432
180 Ga0496106_0013245 3300048909 Bacteria 6088
181 Ga0496108_0040230 3300048911 Bacteria 3896
182 Ga0496108_0136534 3300048911 Bacteria 2111
183 Ga0496109_0193772 3300048912 Bacteria 1910
184 Ga0496109_0322591 3300048912 Bacteria 1458
185 Ga0496109_0421456 3300048912 Bacteria 1261
186 Ga0496114_0187839 3300048917 Bacteria 1807
187 Ga0496114_0254467 3300048917 Bacteria 1545
188 Ga0496116_0000173 3300048919 Bacteria 129928
189 Ga0496116_0000531 3300048919 Bacteria 51345
190 Ga0496117_0000144 3300048920 Bacteria 153831
191 Ga0496117_0037678 3300048920 Bacteria 3598
192 Ga0496118_0000096 3300048921 Bacteria 163988
193 Ga0496118_0006012 3300048921 Bacteria 13527
194 Ga0496119_0001793 3300048922 Bacteria 25009
195 Ga0496120_0011000 3300048923 Bacteria 6253
196 Ga0496123_0012196 3300048926 Bacteria 7355
197 Ga0496124_0012327 3300048927 Bacteria 8443
198 Ga0496126_0000003 3300048929 Bacteria 961576
199 Ga0496126_0000330 3300048929 Bacteria 101064
200 Ga0501034_0025224 3300049571 Bacteria 6051
201 Ga0501036_0006018 3300049572 Bacteria 9838
202 Ga0501037_0140550 3300049573 Bacteria 1728
203 Ga0501039_0328972 3300049575 Bacteria 1201
204 Ga0501042_0017903 3300049578 Bacteria 4896
205 Ga0501043_0007560 3300049579 Bacteria 8617
206 Ga0501046_0123679 3300049580 Bacteria 1967
207 Ga0501047_0000814 3300049581 Bacteria 32451
208 Ga0501048_0004610 3300049582 Bacteria 10486
209 Ga0501067_0071918 3300049583 Bacteria 1916
210 Ga0501074_0001462 3300049590 Bacteria 15849
211 Ga0501044_0004298 3300049823 Bacteria 15975
212 Ga0501044_0031508 3300049823 Bacteria 5580
213 Ga0500641_0005852 3300053096 Bacteria 4353
214 Ga0500616_0001029 3300053153 Bacteria 29567
215 Ga0501082_0292269 3300060353 Bacteria 1419
216 Ga0466962_0006157 3300061719 Bacteria 5766
217 Ga0466962_0156762 3300061719 Bacteria 1106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0305859 Ga0466967_0305859_499_1353 266
2 3300060353 Ga0501082_0292269 Ga0501082_0292269_490_1389 268
3 3300014968 Ga0157379_10000019 Ga0157379_1000001964 271
4 3300005437 Ga0070710_10004890 Ga0070710_100048902 276
5 3300006175 Ga0070712_100052417 Ga0070712_1000524173 276
6 3300044719 Ga0466971_0020879 Ga0466971_0020879_213_1070 276
7 3300044765 Ga0466970_0032256 Ga0466970_0032256_1284_2141 276
8 3300044842 Ga0466957_0089829 Ga0466957_0089829_528_1385 276
9 3300045836 Ga0466958_0033513 Ga0466958_0033513_1670_2527 276
10 3300061719 Ga0466962_0006157 Ga0466962_0006157_1803_2660 276
11 3300025898 Ga0207692_10064542 Ga0207692_100645422 277
12 3300025915 Ga0207693_10013655 Ga0207693_100136556 277
13 3300025916 Ga0207663_10019412 Ga0207663_100194122 277
14 3300025929 Ga0207664_10185507 Ga0207664_101855072 277
15 3300025939 Ga0207665_10009526 Ga0207665_100095262 277
16 3300046689 Ga0495613_0285666 Ga0495613_0285666_25_900 277
17 3300005616 Ga0068852_100236438 Ga0068852_1002364382 278
18 3300026078 Ga0207702_10246878 Ga0207702_102468782 278
19 3300037853 Ga0436364_0734646 Ga0436364_0734646_291_1211 278
20 3300044901 Ga0466960_0176399 Ga0466960_0176399_83_922 278
21 3300048911 Ga0496108_0136534 Ga0496108_0136534_566_1405 278
22 3300053153 Ga0500616_0001029 Ga0500616_0001029_20573_21409 278
23 3300045976 Ga0466967_0357319 Ga0466967_0357319_93_953 279
24 3300045976 Ga0466967_0024267 Ga0466967_0024267_2307_3161 280
25 3300048929 Ga0496126_0000003 Ga0496126_0000003_665738_666604 280
26 iso_pu_bacteria 8025478263 8025483433 280
27 iso_pu_bacteria 2866552031 2866553834 281
28 3300046463 Ga0495653_0075363 Ga0495653_0075363_1549_2439 282
29 3300046511 Ga0495608_0106339 Ga0495608_0106339_153_1043 282
30 3300046514 Ga0495618_0147084 Ga0495618_0147084_363_1253 282
31 3300046529 Ga0495652_0253124 Ga0495652_0253124_117_1007 282
32 3300046533 Ga0495640_0103773 Ga0495640_0103773_378_1268 282
33 3300046642 Ga0495634_0189138 Ga0495634_0189138_98_988 282
34 3300046663 Ga0495635_0084046 Ga0495635_0084046_435_1325 282
35 3300046675 Ga0495657_0142943 Ga0495657_0142943_141_1031 282
36 3300047317 Ga0495604_0122874 Ga0495604_0122874_939_1829 282
37 3300047322 Ga0495680_0124603 Ga0495680_0124603_86_976 282
38 3300047471 Ga0495684_0230283 Ga0495684_0230283_220_1110 282
39 3300049571 Ga0501034_0025224 Ga0501034_0025224_4221_5087 282
40 3300049572 Ga0501036_0006018 Ga0501036_0006018_6041_6907 282
41 3300049573 Ga0501037_0140550 Ga0501037_0140550_804_1670 282
42 3300049575 Ga0501039_0328972 Ga0501039_0328972_298_1164 282
43 3300049578 Ga0501042_0017903 Ga0501042_0017903_3009_3875 282
44 3300049579 Ga0501043_0007560 Ga0501043_0007560_2017_2883 282
45 3300049580 Ga0501046_0123679 Ga0501046_0123679_988_1854 282
46 3300049581 Ga0501047_0000814 Ga0501047_0000814_5382_6248 282
47 3300049582 Ga0501048_0004610 Ga0501048_0004610_1630_2496 282
48 3300049590 Ga0501074_0001462 Ga0501074_0001462_5017_5883 282
49 3300049823 Ga0501044_0031508 Ga0501044_0031508_3108_3974 282
50 iso_pu_bacteria 2775506925 2776375655 282
51 iso_pu_bacteria 2863067949 2863075358 282
52 3300005338 Ga0068868_100200946 Ga0068868_1002009462 283
53 3300005434 Ga0070709_10190101 Ga0070709_101901012 283
54 3300005535 Ga0070684_100060716 Ga0070684_1000607162 283
55 3300005564 Ga0070664_100229275 Ga0070664_1002292752 283
56 3300005614 Ga0068856_100149966 Ga0068856_1001499662 283
57 3300006051 Ga0075364_10271286 Ga0075364_102712862 283
58 3300006163 Ga0070715_10135840 Ga0070715_101358401 283
59 3300014325 Ga0163163_10272931 Ga0163163_102729312 283
60 3300035086 Ga0373934_0012955 Ga0373934_0012955_1825_2682 283
61 3300035724 Ga0373933_0032293 Ga0373933_0032293_156_1013 283
62 3300036401 Ga0373937_0041524 Ga0373937_0041524_2176_3033 283
63 3300046463 Ga0495653_0103786 Ga0495653_0103786_593_1450 283
64 3300046511 Ga0495608_0018454 Ga0495608_0018454_2005_2862 283
65 3300046514 Ga0495618_0084142 Ga0495618_0084142_972_1829 283
66 3300046517 Ga0495630_0318477 Ga0495630_0318477_305_1162 283
67 3300046529 Ga0495652_0035968 Ga0495652_0035968_3042_3899 283
68 3300046531 Ga0495665_0130473 Ga0495665_0130473_201_1058 283
69 3300046559 Ga0495667_0015465 Ga0495667_0015465_3962_4819 283
70 3300046663 Ga0495635_0014796 Ga0495635_0014796_3957_4814 283
71 3300046675 Ga0495657_0027953 Ga0495657_0027953_2267_3124 283
72 3300047322 Ga0495680_0001542 Ga0495680_0001542_484_1341 283
73 3300047471 Ga0495684_0030149 Ga0495684_0030149_2298_3155 283
74 3300047673 Ga0495593_0081954 Ga0495593_0081954_22_879 283
75 3300048912 Ga0496109_0421456 Ga0496109_0421456_228_1103 283
76 3300006175 Ga0070712_100314089 Ga0070712_1003140892 284
77 3300036401 Ga0373937_0102051 Ga0373937_0102051_628_1533 284
78 iso_pu_bacteria 2773857762 2774397040 284
79 iso_pu_bacteria 2808606439 2809198685 284
80 3300005435 Ga0070714_100138595 Ga0070714_1001385952 285
81 3300025929 Ga0207664_10122175 Ga0207664_101221752 285
82 3300031616 Ga0307508_10377653 Ga0307508_103776532 285
83 iso_pu_bacteria 2915358134 2915362418 285
84 iso_pu_bacteria 2984576629 2984578984 285
85 iso_pu_bacteria 2990256926 2990260303 285
86 3300005436 Ga0070713_100217986 Ga0070713_1002179862 286
87 3300006028 Ga0070717_10134606 Ga0070717_101346062 286
88 3300013104 Ga0157370_10378811 Ga0157370_103788112 286
89 3300013105 Ga0157369_10254515 Ga0157369_102545152 286
90 3300025906 Ga0207699_10169365 Ga0207699_101693652 286
91 3300025928 Ga0207700_10191383 Ga0207700_101913832 286
92 3300025929 Ga0207664_10326181 Ga0207664_103261812 286
93 3300037418 Ga0395900_0072520 Ga0395900_0072520_1878_2747 286
94 3300041494 Ga0451837_1028087 Ga0451837_1028087_117_983 286
95 3300045976 Ga0466967_0160318 Ga0466967_0160318_146_1006 286
96 3300049583 Ga0501067_0071918 Ga0501067_0071918_199_1071 286
97 iso_pu_bacteria 2643221961 2645722824 286
98 iso_pu_bacteria 2643221962 2645725788 286
99 3300037418 Ga0395900_0335531 Ga0395900_0335531_91_960 287
100 3300037466 Ga0395898_0053317 Ga0395898_0053317_2243_3112 287
101 3300038443 Ga0395901_0000920 Ga0395901_0000920_29075_29944 287
102 3300045049 Ga0466959_0137441 Ga0466959_0137441_561_1430 287
103 3300048088 Ga0495602_0153798 Ga0495602_0153798_748_1617 287
104 iso_pu_bacteria 2565956761 2566997204 287
105 iso_pu_bacteria 2904535858 2904536317 287
106 iso_pu_bacteria 2922554459 2922558256 287
107 3300005337 Ga0070682_100075748 Ga0070682_1000757482 288
108 3300025919 Ga0207657_10141818 Ga0207657_101418182 288
109 3300044684 Ga0466966_0044421 Ga0466966_0044421_1792_2661 288
110 3300044706 Ga0466964_0090425 Ga0466964_0090425_377_1246 288
111 3300044765 Ga0466970_0002631 Ga0466970_0002631_5661_6530 288
112 3300044765 Ga0466970_0105058 Ga0466970_0105058_444_1313 288
113 3300044901 Ga0466960_0039518 Ga0466960_0039518_1339_2208 288
114 3300005355 Ga0070671_100019493 Ga0070671_1000194935 289
115 3300005548 Ga0070665_100001291 Ga0070665_10000129116 289
116 3300005719 Ga0068861_100370779 Ga0068861_1003707792 289
117 3300005843 Ga0068860_100028192 Ga0068860_1000281922 289
118 3300009098 Ga0105245_10348043 Ga0105245_103480432 289
119 3300009148 Ga0105243_10030136 Ga0105243_100301364 289
120 3300011119 Ga0105246_10089004 Ga0105246_100890042 289
121 3300013307 Ga0157372_10289678 Ga0157372_102896781 289
122 3300025931 Ga0207644_10013068 Ga0207644_100130684 289
123 3300025945 Ga0207679_10029622 Ga0207679_100296223 289
124 3300026023 Ga0207677_10315430 Ga0207677_103154302 289
125 3300026088 Ga0207641_10186715 Ga0207641_101867152 289
126 3300026116 Ga0207674_10085312 Ga0207674_100853122 289
127 3300028379 Ga0268266_10027742 Ga0268266_100277423 289
128 3300028381 Ga0268264_10020178 Ga0268264_100201784 289
129 3300031251 Ga0265327_10000001 Ga0265327_10000001394 289
130 3300044842 Ga0466957_0111623 Ga0466957_0111623_675_1550 289
131 3300044901 Ga0466960_0083522 Ga0466960_0083522_42_917 289
132 3300061719 Ga0466962_0156762 Ga0466962_0156762_113_988 289
133 iso_pu_bacteria 2990088156 2990091496 289
134 3300009551 Ga0105238_10581539 Ga0105238_105815392 290
135 3300035692 Ga0373935_0183610 Ga0373935_0183610_406_1284 290
136 3300035695 Ga0373927_0088622 Ga0373927_0088622_758_1636 290
137 3300035725 Ga0373947_0114180 Ga0373947_0114180_739_1617 290
138 3300044683 Ga0466965_0089227 Ga0466965_0089227_244_1122 290
139 iso_pu_bacteria 8055157932 8055160899 290
140 iso_pu_bacteria 8056060235 8056062186 290
141 3300005439 Ga0070711_100146867 Ga0070711_1001468672 291
142 3300006051 Ga0075364_10113430 Ga0075364_101134302 291
143 3300006058 Ga0075432_10047981 Ga0075432_100479812 291
144 3300006178 Ga0075367_10125490 Ga0075367_101254902 291
145 3300006353 Ga0075370_10011630 Ga0075370_100116306 291
146 3300009098 Ga0105245_10213557 Ga0105245_102135572 291
147 3300009148 Ga0105243_10216747 Ga0105243_102167472 291
148 3300009176 Ga0105242_10596638 Ga0105242_105966381 291
149 3300013306 Ga0163162_10423397 Ga0163162_104233972 291
150 3300014325 Ga0163163_10490244 Ga0163163_104902442 291
151 3300025927 Ga0207687_10043368 Ga0207687_100433682 291
152 3300030744 Ga0316181_1133468 Ga0316181_11334682 291
153 3300037466 Ga0395898_0651919 Ga0395898_0651919_24_947 291
154 3300046616 Ga0495668_0000736 Ga0495668_0000736_12614_13510 291
155 3300048911 Ga0496108_0040230 Ga0496108_0040230_2584_3480 291
156 3300048912 Ga0496109_0322591 Ga0496109_0322591_132_1013 291
157 3300048917 Ga0496114_0254467 Ga0496114_0254467_369_1250 291
158 3300048926 Ga0496123_0012196 Ga0496123_0012196_5762_6643 291
159 3300053096 Ga0500641_0005852 Ga0500641_0005852_3451_4332 291
160 iso_pu_bacteria 2643221681 2644457958 291
161 iso_pu_bacteria 2643221697 2644536792 291
162 iso_pu_bacteria 2811994878 2812352742 291
163 iso_pu_bacteria 2891968417 2891969719 291
164 iso_pu_bacteria 2984592036 2984595523 291
165 3300031838 Ga0307518_10147505 Ga0307518_101475053 292
166 3300037853 Ga0436364_0421253 Ga0436364_0421253_1216_2112 292
167 iso_pu_bacteria 2867475112 2867480784 292
168 iso_pu_bacteria 2997451912 2997452033 292
169 iso_pu_bacteria 8054472261 8054473560 292
170 3300005618 Ga0068864_100097135 Ga0068864_1000971352 293
171 3300005841 Ga0068863_100002702 Ga0068863_10000270210 293
172 3300026088 Ga0207641_10006209 Ga0207641_100062092 293
173 3300044658 Ga0466972_0000932 Ga0466972_0000932_4896_5843 293
174 3300044683 Ga0466965_0025281 Ga0466965_0025281_374_1321 293
175 3300044765 Ga0466970_0041267 Ga0466970_0041267_1013_1960 293
176 3300044901 Ga0466960_0010613 Ga0466960_0010613_650_1597 293
177 3300045836 Ga0466958_0167188 Ga0466958_0167188_46_951 293
178 3300045976 Ga0466967_0497184 Ga0466967_0497184_202_1149 293
179 3300048905 Ga0496102_0000772 Ga0496102_0000772_19219_20112 293
180 3300048906 Ga0496103_0000018 Ga0496103_0000018_13941_14834 293
181 3300048907 Ga0496104_0052584 Ga0496104_0052584_694_1587 293
182 3300048908 Ga0496105_0013729 Ga0496105_0013729_4868_5761 293
183 3300048912 Ga0496109_0193772 Ga0496109_0193772_219_1133 293
184 3300048917 Ga0496114_0187839 Ga0496114_0187839_849_1742 293
185 3300048919 Ga0496116_0000173 Ga0496116_0000173_58567_59460 293
186 3300048920 Ga0496117_0000144 Ga0496117_0000144_104121_105014 293
187 3300048921 Ga0496118_0000096 Ga0496118_0000096_121476_122369 293
188 3300048922 Ga0496119_0001793 Ga0496119_0001793_20839_21732 293
189 3300048923 Ga0496120_0011000 Ga0496120_0011000_1856_2749 293
190 3300048927 Ga0496124_0012327 Ga0496124_0012327_4613_5506 293
191 3300048929 Ga0496126_0000330 Ga0496126_0000330_41614_42507 293
192 iso_pu_bacteria 3006425503 3006429157 293
193 iso_pu_bacteria 8054160619 8054163261 293
194 3300005617 Ga0068859_100000308 Ga0068859_10000030832 294
195 3300005617 Ga0068859_100006167 Ga0068859_10000616713 294
196 3300005841 Ga0068863_100012771 Ga0068863_1000127717 294
197 3300005844 Ga0068862_100000046 Ga0068862_100000046118 294
198 3300006931 Ga0097620_100000308 Ga0097620_10000030820 294
199 3300006931 Ga0097620_100006167 Ga0097620_10000616713 294
200 3300009553 Ga0105249_10003269 Ga0105249_100032698 294
201 3300014325 Ga0163163_10318015 Ga0163163_103180152 294
202 3300025961 Ga0207712_10001211 Ga0207712_100012117 294
203 3300026035 Ga0207703_10015151 Ga0207703_100151512 294
204 3300026088 Ga0207641_10066324 Ga0207641_100663243 294
205 3300028380 Ga0268265_10000039 Ga0268265_10000039159 294
206 3300031731 Ga0307405_10019459 Ga0307405_100194594 294
207 3300031852 Ga0307410_10278592 Ga0307410_102785922 294
208 3300031995 Ga0307409_100450572 Ga0307409_1004505721 294
209 3300032002 Ga0307416_100452609 Ga0307416_1004526091 294
210 3300032005 Ga0307411_10198975 Ga0307411_101989752 294
211 3300032126 Ga0307415_100284027 Ga0307415_1002840271 294
212 3300044765 Ga0466970_0090009 Ga0466970_0090009_639_1559 294
213 3300048904 Ga0496101_0006973 Ga0496101_0006973_2227_3150 294
214 3300048905 Ga0496102_0079675 Ga0496102_0079675_1688_2590 294
215 3300048919 Ga0496116_0000531 Ga0496116_0000531_40669_41571 294
216 3300048920 Ga0496117_0037678 Ga0496117_0037678_650_1552 294
217 3300048921 Ga0496118_0006012 Ga0496118_0006012_10268_11170 294
218 iso_pu_bacteria 2616644941 2616904340 294
219 iso_pu_bacteria 2643221548 2643760739 294
220 iso_pu_bacteria 2643221578 2643900905 294
221 iso_pu_bacteria 2643221673 2644407051 294
222 iso_pu_bacteria 2802429296 2804849222 294
223 iso_pu_bacteria 2808606359 2808847233 294
224 iso_pu_bacteria 2862178590 2862180690 294
225 iso_pu_bacteria 2862281513 2862290069 294
226 iso_pu_bacteria 2862574272 2862576648 294
227 iso_pu_bacteria 2946045630 2946045814 294
228 iso_pu_bacteria 2966598605 2966598965 294
229 iso_pu_bacteria 3006486233 3006490748 294
230 iso_pu_bacteria 3006493962 3006497033 294
231 iso_pu_bacteria 8025413630 8025413845 294
232 3300047317 Ga0495604_0045819 Ga0495604_0045819_1027_1926 295
233 iso_pu_bacteria 2875391855 2875398378 295
234 3300003354 JGI25160J50197_1004423 JGI25160J50197_10044235 296
235 3300003354 JGI25160J50197_1018645 JGI25160J50197_10186452 296
236 3300025302 Ga0207426_1000533 Ga0207426_100053337 296
237 3300025302 Ga0207426_1001037 Ga0207426_100103719 296
238 3300025302 Ga0207426_1004995 Ga0207426_10049956 296
239 iso_pu_bacteria 2818991463 2819695665 297
240 3300003323 rootH1_10029928 rootH1_100299285 298
241 3300031616 Ga0307508_10002111 Ga0307508_1000211118 298
242 3300046455 Ga0495603_0000223 Ga0495603_0000223_8111_9013 298
243 3300046455 Ga0495603_0004659 Ga0495603_0004659_5042_5980 298
244 3300046459 Ga0495629_0000584 Ga0495629_0000584_4263_5165 298
245 3300046459 Ga0495629_0000953 Ga0495629_0000953_184_1086 298
246 3300046492 Ga0495585_0054269 Ga0495585_0054269_529_1467 298
247 3300046648 Ga0495611_0069696 Ga0495611_0069696_230_1168 298
248 3300046674 Ga0495588_0016597 Ga0495588_0016597_918_1820 298
249 3300046674 Ga0495588_0182358 Ga0495588_0182358_185_1096 298
250 3300046689 Ga0495613_0000820 Ga0495613_0000820_13007_13909 298
251 3300046794 Ga0495589_0002374 Ga0495589_0002374_8166_9104 298
252 3300046794 Ga0495589_0007415 Ga0495589_0007415_54_995 298
253 3300047321 Ga0495676_0002159 Ga0495676_0002159_4746_5648 298
254 3300047321 Ga0495676_0008423 Ga0495676_0008423_7271_8209 298
255 3300047321 Ga0495676_0079321 Ga0495676_0079321_1495_2436 298
256 3300047447 Ga0495685_004939 Ga0495685_004939_1204_2142 298
257 3300047673 Ga0495593_0123826 Ga0495593_0123826_193_1095 298
258 3300048089 Ga0495614_0001597 Ga0495614_0001597_4507_5409 298
259 3300048909 Ga0496106_0013245 Ga0496106_0013245_1802_2824 298
260 3300049823 Ga0501044_0004298 Ga0501044_0004298_13696_14670 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09995

MPAB_Lcp_cat

ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain

76

288

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u8u-assembly1.cif.gz_B the crystallographic structure of the giant hemoglobin from glossoscolex paulistus at 3.2 a resolution. 0.7025 19 153
4u8u-assembly1.cif.gz_B the crystallographic structure of the giant hemoglobin from glossoscolex paulistus at 3.2 a resolution. 0.6617 19 153
5o1m-assembly2.cif.gz_B structure of latex clearing protein lcp in the closed state 0.6286 7 264
3pt7-assembly1.cif.gz_B structure of hbii-iii-oxy from lucina pectinata at ph 5.0 0.6008 13 171
3pt7-assembly1.cif.gz_B structure of hbii-iii-oxy from lucina pectinata at ph 5.0 0.5789 13 171
ID Description Score Start End Superfamily
af_Q9GYP4_117_285_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5535 22 157 1.10.490.10
af_Q4V6L1_45_210_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5225 13 174 1.10.490.10
af_Q4V6L1_45_210_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4802 13 174 1.10.490.10
af_Q22663_26_170_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4725 36 169 1.10.490.10
af_Q9GYP4_117_285_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4707 22 157 1.10.490.10
ID Description Score Start End GO Terms
AF-B4VC60-F1-model_v4 deleted 0.9917 1 229
AF-A0A6B3HKJ4-F1-model_v4 DUF2236 domain-containing protein 0.9903 1 181 GO:0016491
AF-A0A838XL29-F1-model_v4 DUF2236 domain-containing protein 0.9902 13 278 GO:0016491
AF-A0A4V1VLJ8-F1-model_v4 DUF2236 domain-containing protein 0.9902 1 246 GO:0016491
AF-A0A6B3B4G7-F1-model_v4 DUF2236 domain-containing protein 0.9896 1 252 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.78 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map