F369826

General Info

Members Datasets Scaffolds Average Seq Length
260 174 520 104

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0247700|Ga0495645_0247700_558_923
Length 121
Sequence VRFLGPNPASRVGRVEPTEEMTLYDLRVTVERIEGRSVCGLEVGDYFELTESSRVRIPAGRHFCLYALQSVLPLLPAKQRSLPASDWLEQDSLVACPDPDERVIMRIERTARRTMATGDLT

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
104 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.77
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 15
Rhizosphere 81.92
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0247700 3300046543 Bacteria 1186
2 JGI24740J21852_10125057 3300001979 Bacteria 643
3 Ga0070658_10375696 3300005327 Bacteria 1219
4 Ga0070658_10648647 3300005327 Bacteria 916
5 Ga0070683_100053065 3300005329 Bacteria 3757
6 Ga0070683_100287105 3300005329 Bacteria 1565
7 Ga0070683_101104511 3300005329 Unclassified 762
8 Ga0070683_101976903 3300005329 Unclassified 560
9 Ga0070680_100340240 3300005336 Bacteria 1275
10 Ga0070675_100395484 3300005354 Unclassified 1232
11 Ga0070674_100154494 3300005356 Bacteria 1735
12 Ga0070674_100502748 3300005356 Bacteria 1010
13 Ga0070709_10819651 3300005434 Unclassified 731
14 Ga0070663_100741500 3300005455 Bacteria 838
15 Ga0070678_100776918 3300005456 Bacteria 868
16 Ga0070681_10073724 3300005458 Bacteria 3375
17 Ga0068867_100431698 3300005459 Bacteria 1118
18 Ga0070707_100119384 3300005468 Bacteria 2560
19 Ga0070699_100451380 3300005518 Bacteria 1166
20 Ga0070679_100288419 3300005530 Bacteria 1593
21 Ga0070684_100065369 3300005535 Bacteria 3192
22 Ga0070684_100149855 3300005535 Bacteria 2112
23 Ga0070684_100255855 3300005535 Bacteria 1601
24 Ga0070684_100773736 3300005535 Unclassified 897
25 Ga0070684_101885730 3300005535 Bacteria 564
26 Ga0068853_101159936 3300005539 Bacteria 746
27 Ga0070672_100850425 3300005543 Bacteria 804
28 Ga0068855_101216344 3300005563 Bacteria 783
29 Ga0070664_102341896 3300005564 Bacteria 506
30 Ga0070702_100313594 3300005615 Bacteria 1090
31 Ga0068864_100414697 3300005618 Bacteria 1282
32 Ga0068861_102598066 3300005719 Bacteria 510
33 Ga0070717_10333332 3300006028 Bacteria 1354
34 Ga0070717_11078216 3300006028 Bacteria 732
35 Ga0075368_10531036 3300006042 Unclassified 527
36 Ga0075363_100325057 3300006048 Bacteria 895
37 Ga0070715_10656049 3300006163 Bacteria 622
38 Ga0070716_101158076 3300006173 Bacteria 619
39 Ga0070712_100694281 3300006175 Bacteria 867
40 Ga0097621_100561016 3300006237 Bacteria 1040
41 Ga0075428_100551563 3300006844 Bacteria 1232
42 Ga0068865_101112852 3300006881 Bacteria 696
43 Ga0111539_10681364 3300009094 Bacteria 1197
44 Ga0111539_10723103 3300009094 Bacteria 1159
45 Ga0105245_10320272 3300009098 Bacteria 1527
46 Ga0105247_10779584 3300009101 Bacteria 727
47 Ga0105243_11289766 3300009148 Bacteria 747
48 Ga0157313_1045234 3300012503 Bacteria 554
49 Ga0157374_11498963 3300013296 Bacteria 698
50 Ga0163163_11719064 3300014325 Bacteria 688
51 Ga0163163_12229830 3300014325 Bacteria 607
52 Ga0157377_10824468 3300014745 Bacteria 686
53 Ga0163161_11873688 3300017792 Unclassified 534
54 Ga0206356_11750826 3300020070 Bacteria 591
55 Ga0206353_10303373 3300020082 Bacteria 1048
56 Ga0207647_10072951 3300025904 Bacteria 2069
57 Ga0207699_10662079 3300025906 Bacteria 763
58 Ga0207705_10257924 3300025909 Bacteria 1331
59 Ga0207705_10559598 3300025909 Bacteria 889
60 Ga0207707_10010433 3300025912 Bacteria 8060
61 Ga0207693_11047155 3300025915 Bacteria 621
62 Ga0207663_11147408 3300025916 Bacteria 625
63 Ga0207660_11559800 3300025917 Unclassified 533
64 Ga0207657_11474119 3300025919 Bacteria 509
65 Ga0207652_10795000 3300025921 Unclassified 840
66 Ga0207659_10346890 3300025926 Unclassified 1231
67 Ga0207687_10349401 3300025927 Bacteria 1204
68 Ga0207664_10601010 3300025929 Bacteria 988
69 Ga0207690_10528446 3300025932 Bacteria 957
70 Ga0207686_10153254 3300025934 Bacteria 1607
71 Ga0207686_11837450 3300025934 Unclassified 502
72 Ga0207669_10556343 3300025937 Bacteria 926
73 Ga0207691_10748463 3300025940 Bacteria 823
74 Ga0207661_10101345 3300025944 Bacteria 2419
75 Ga0207661_10670927 3300025944 Bacteria 953
76 Ga0207667_10475274 3300025949 Bacteria 1269
77 Ga0207712_11249180 3300025961 Unclassified 663
78 Ga0207668_10604188 3300025972 Bacteria 956
79 Ga0207639_12244277 3300026041 Bacteria 507
80 Ga0207678_10789540 3300026067 Bacteria 838
81 Ga0207648_10494542 3300026089 Bacteria 1118
82 Ga0207683_11262361 3300026121 Bacteria 684
83 Ga0207698_11417753 3300026142 Bacteria 710
84 Ga0207698_12212795 3300026142 Bacteria 562
85 Ga0207428_10494846 3300027907 Unclassified 888
86 Ga0268266_11532225 3300028379 Bacteria 642
87 Ga0265337_1155166 3300028556 Bacteria 620
88 Ga0265319_1136947 3300028563 Bacteria 760
89 Ga0265323_10270939 3300028653 Bacteria 527
90 Ga0265338_10063616 3300028800 Bacteria 3215
91 Ga0307511_10223540 3300030521 Bacteria 942
92 Ga0265328_10056162 3300031239 Bacteria 1445
93 Ga0265340_10033887 3300031247 Bacteria 2541
94 Ga0307408_100259775 3300031548 Bacteria 1437
95 Ga0265342_10276441 3300031712 Unclassified 890
96 Ga0265342_10497642 3300031712 Bacteria 622
97 Ga0307412_10765201 3300031911 Bacteria 835
98 Ga0307409_100007518 3300031995 Bacteria 6528
99 Ga0307409_100517712 3300031995 Bacteria 1165
100 Ga0307415_101023480 3300032126 Bacteria 769
101 Ga0307415_101145831 3300032126 Bacteria 730
102 Ga0373931_0142987 3300035691 Bacteria 1388
103 Ga0373927_0880259 3300035695 Bacteria 591
104 Ga0373933_0100678 3300035724 Bacteria 1793
105 Ga0373933_1174170 3300035724 Bacteria 506
106 Ga0373937_1212291 3300036401 Bacteria 703
107 Ga0395899_0172008 3300037312 Unclassified 1525
108 Ga0395899_0246322 3300037312 Bacteria 1228
109 Ga0395900_0015827 3300037418 Bacteria 7687
110 Ga0395900_0048497 3300037418 Bacteria 4375
111 Ga0395900_0050881 3300037418 Bacteria 4267
112 Ga0395900_0153254 3300037418 Bacteria 2354
113 Ga0395900_1478608 3300037418 Bacteria 592
114 Ga0395898_0015494 3300037466 Bacteria 7818
115 Ga0395898_0163246 3300037466 Bacteria 2131
116 Ga0395898_0189810 3300037466 Bacteria 1963
117 Ga0395898_0358619 3300037466 Unclassified 1390
118 Ga0395898_1013200 3300037466 Bacteria 766
119 Ga0395905_0059707 3300037471 Bacteria 3565
120 Ga0395905_1049454 3300037471 Bacteria 718
121 Ga0395905_1876804 3300037471 Unclassified 505
122 Ga0436364_0942564 3300037853 Bacteria 3416
123 Ga0395901_0014565 3300038443 Bacteria 7995
124 Ga0395901_0403951 3300038443 Bacteria 1403
125 Ga0395901_0439593 3300038443 Bacteria 1335
126 Ga0395901_0486896 3300038443 Bacteria 1257
127 Ga0395901_1363849 3300038443 Bacteria 669
128 Ga0436365_0347611 3300039437 Unclassified 2165
129 Ga0436360_0433976 3300039438 Bacteria 2838
130 Ga0436362_1185558 3300039453 Unclassified 573
131 Ga0439453_0064065 3300041408 Bacteria 766
132 Ga0451789_1194698 3300041443 Bacteria 637
133 Ga0451804_0801837 3300041463 Bacteria 746
134 Ga0451807_0536477 3300041486 Bacteria 1381
135 Ga0451847_0977240 3300041503 Bacteria 691
136 Ga0451853_3623692 3300041512 Bacteria 1031
137 Ga0439448_0069628 3300042005 Unclassified 1171
138 Ga0439451_016787 3300042009 Bacteria 1474
139 Ga0439456_060943 3300042013 Bacteria 829
140 Ga0466961_0152256 3300044693 Bacteria 1444
141 Ga0466961_0154340 3300044693 Bacteria 1433
142 Ga0466963_0001886 3300044694 Bacteria 11442
143 Ga0466963_0036500 3300044694 Bacteria 3206
144 Ga0466963_0256543 3300044694 Bacteria 1227
145 Ga0466963_0701364 3300044694 Unclassified 714
146 Ga0466963_1264472 3300044694 Bacteria 518
147 Ga0466964_0038884 3300044706 Unclassified 1915
148 Ga0466964_0122902 3300044706 Bacteria 1172
149 Ga0466964_0178176 3300044706 Unclassified 1006
150 Ga0466964_0481917 3300044706 Bacteria 663
151 Ga0466971_0080873 3300044719 Bacteria 1481
152 Ga0466968_0002836 3300044735 Bacteria 6405
153 Ga0466968_0028309 3300044735 Bacteria 2310
154 Ga0466968_0165100 3300044735 Bacteria 1023
155 Ga0466970_0783397 3300044765 Bacteria 558
156 Ga0466957_0050123 3300044842 Bacteria 2540
157 Ga0466957_0420356 3300044842 Bacteria 917
158 Ga0466960_0058433 3300044901 Bacteria 1884
159 Ga0466960_0086711 3300044901 Bacteria 1588
160 Ga0466959_0172919 3300045049 Bacteria 1514
161 Ga0466959_0180245 3300045049 Bacteria 1478
162 Ga0451576_0624217 3300045051 Bacteria 1133
163 Ga0466958_0102425 3300045836 Bacteria 1781
164 Ga0466958_0202000 3300045836 Bacteria 1265
165 Ga0466967_0002247 3300045976 Bacteria 11893
166 Ga0466967_0057023 3300045976 Bacteria 3446
167 Ga0466967_0187132 3300045976 Bacteria 1955
168 Ga0466967_0192709 3300045976 Unclassified 1927
169 Ga0466967_0272271 3300045976 Bacteria 1623
170 Ga0466967_1123587 3300045976 Unclassified 783
171 Ga0466967_1521840 3300045976 Bacteria 666
172 Ga0466967_1723008 3300045976 Unclassified 624
173 Ga0495592_0793737 3300046454 Bacteria 563
174 Ga0495603_0171176 3300046455 Bacteria 1258
175 Ga0495641_0518413 3300046461 Bacteria 544
176 Ga0495582_0796072 3300046473 Bacteria 547
177 Ga0495639_0437484 3300046475 Bacteria 663
178 Ga0495662_0092832 3300046476 Bacteria 1473
179 Ga0495664_0204781 3300046477 Bacteria 1195
180 Ga0495664_0261066 3300046477 Bacteria 1047
181 Ga0495618_0088430 3300046514 Bacteria 1981
182 Ga0495620_0051791 3300046515 Bacteria 1746
183 Ga0495628_0228050 3300046516 Bacteria 1397
184 Ga0495628_0338799 3300046516 Bacteria 1107
185 Ga0495652_0312343 3300046529 Bacteria 1138
186 Ga0495652_0943988 3300046529 Bacteria 567
187 Ga0495640_0604471 3300046533 Bacteria 662
188 Ga0495667_0919879 3300046559 Bacteria 536
189 Ga0495634_0498674 3300046642 Bacteria 714
190 Ga0495635_0109782 3300046663 Bacteria 1884
191 Ga0495646_0500008 3300046680 Bacteria 624
192 Ga0495624_0458358 3300046690 Bacteria 764
193 Ga0495600_0913595 3300046809 Bacteria 517
194 Ga0495604_0164169 3300047317 Bacteria 1567
195 Ga0495674_0384319 3300047319 Bacteria 1135
196 Ga0495674_0796373 3300047319 Bacteria 735
197 Ga0495674_1026025 3300047319 Bacteria 631
198 Ga0495680_0826881 3300047322 Bacteria 603
199 Ga0495684_0287864 3300047471 Bacteria 1184
200 Ga0496100_0291288 3300048903 Bacteria 1220
201 Ga0496100_0400711 3300048903 Unclassified 1045
202 Ga0496100_1246006 3300048903 Bacteria 587
203 Ga0496100_1598856 3300048903 Bacteria 515
204 Ga0496104_0028369 3300048907 Bacteria 5188
205 Ga0496104_0121641 3300048907 Bacteria 2506
206 Ga0496104_0598525 3300048907 Bacteria 1013
207 Ga0496104_0700663 3300048907 Bacteria 920
208 Ga0496104_0980036 3300048907 Bacteria 750
209 Ga0496104_1737956 3300048907 Bacteria 526
210 Ga0496105_0052399 3300048908 Bacteria 3371
211 Ga0496105_0449224 3300048908 Bacteria 1018
212 Ga0496106_1306385 3300048909 Bacteria 563
213 Ga0496107_0726541 3300048910 Bacteria 730
214 Ga0496108_0017279 3300048911 Bacteria 5901
215 Ga0496108_0314567 3300048911 Bacteria 1365
216 Ga0496108_1610316 3300048911 Bacteria 537
217 Ga0496109_0044841 3300048912 Bacteria 4012
218 Ga0496109_0063750 3300048912 Bacteria 3371
219 Ga0496109_0358339 3300048912 Unclassified 1378
220 Ga0496110_0007983 3300048913 Bacteria 8480
221 Ga0496110_0098834 3300048913 Bacteria 2616
222 Ga0496111_0085570 3300048914 Bacteria 2305
223 Ga0496112_0003938 3300048915 Bacteria 12433
224 Ga0496113_0036332 3300048916 Bacteria 3609
225 Ga0496113_0250813 3300048916 Bacteria 1413
226 Ga0496113_0658149 3300048916 Bacteria 837
227 Ga0496113_0731385 3300048916 Bacteria 789
228 Ga0496113_0928877 3300048916 Bacteria 687
229 Ga0496113_0952900 3300048916 Bacteria 677
230 Ga0496114_0183497 3300048917 Bacteria 1828
231 Ga0496114_0262406 3300048917 Bacteria 1521
232 Ga0496114_0359091 3300048917 Unclassified 1289
233 Ga0496115_0495691 3300048918 Bacteria 982
234 Ga0496115_1029507 3300048918 Unclassified 628
235 Ga0496115_1419144 3300048918 Bacteria 512
236 Ga0501034_0099011 3300049571 Bacteria 2911
237 Ga0501040_0600249 3300049576 Unclassified 795
238 Ga0501046_0285922 3300049580 Bacteria 1207
239 Ga0501047_0136469 3300049581 Bacteria 2333
240 Ga0501067_0146401 3300049583 Bacteria 1316
241 Ga0501068_0396937 3300049584 Bacteria 889
242 Ga0501070_0070606 3300049586 Bacteria 2892
243 Ga0501074_0226495 3300049590 Bacteria 1331
244 Ga0501075_0662769 3300049591 Bacteria 795
245 Ga0501077_0613213 3300049593 Unclassified 699
246 Ga0501222_064873 3300049662 Bacteria 559
247 Ga0501079_1608211 3300049741 Bacteria 511
248 Ga0501080_0918463 3300049742 Bacteria 762
249 Ga0501080_0961078 3300049742 Bacteria 742
250 Ga0501083_0278356 3300049744 Bacteria 1088
251 Ga0501044_0653096 3300049823 Bacteria 941
252 nmdc:mga05p37_206311_c1 3300050507 Bacteria 2377
253 nmdc:mga09592_458443_c1 3300050508 Bacteria 1099
254 nmdc:mga08y16_639054_c1 3300050511 Bacteria 1069
255 nmdc:mga0rr50_339637_c1 3300050513 Bacteria 1262
256 Ga0495601_0150579 3300053077 Bacteria 1519
257 Ga0495601_0406718 3300053077 Bacteria 882
258 Ga0495655_0076781 3300053083 Bacteria 946
259 Ga0466962_0159708 3300061719 Bacteria 1095
260 8003858856 8003856774 Bacteria 7675274
261 Ga0495645_0247700
262 JGI24740J21852_10125057
263 Ga0070658_10375696
264 Ga0070658_10648647
265 Ga0070683_100053065
266 Ga0070683_100287105
267 Ga0070683_101104511
268 Ga0070683_101976903
269 Ga0070680_100340240
270 Ga0070675_100395484
271 Ga0070674_100154494
272 Ga0070674_100502748
273 Ga0070709_10819651
274 Ga0070663_100741500
275 Ga0070678_100776918
276 Ga0070681_10073724
277 Ga0068867_100431698
278 Ga0070707_100119384
279 Ga0070699_100451380
280 Ga0070679_100288419
281 Ga0070684_100065369
282 Ga0070684_100149855
283 Ga0070684_100255855
284 Ga0070684_100773736
285 Ga0070684_101885730
286 Ga0068853_101159936
287 Ga0070672_100850425
288 Ga0068855_101216344
289 Ga0070664_102341896
290 Ga0070702_100313594
291 Ga0068864_100414697
292 Ga0068861_102598066
293 Ga0070717_10333332
294 Ga0070717_11078216
295 Ga0075368_10531036
296 Ga0075363_100325057
297 Ga0070715_10656049
298 Ga0070716_101158076
299 Ga0070712_100694281
300 Ga0097621_100561016
301 Ga0075428_100551563
302 Ga0068865_101112852
303 Ga0111539_10681364
304 Ga0111539_10723103
305 Ga0105245_10320272
306 Ga0105247_10779584
307 Ga0105243_11289766
308 Ga0157313_1045234
309 Ga0157374_11498963
310 Ga0163163_11719064
311 Ga0163163_12229830
312 Ga0157377_10824468
313 Ga0163161_11873688
314 Ga0206356_11750826
315 Ga0206353_10303373
316 Ga0207647_10072951
317 Ga0207699_10662079
318 Ga0207705_10257924
319 Ga0207705_10559598
320 Ga0207707_10010433
321 Ga0207693_11047155
322 Ga0207663_11147408
323 Ga0207660_11559800
324 Ga0207657_11474119
325 Ga0207652_10795000
326 Ga0207659_10346890
327 Ga0207687_10349401
328 Ga0207664_10601010
329 Ga0207690_10528446
330 Ga0207686_10153254
331 Ga0207686_11837450
332 Ga0207669_10556343
333 Ga0207691_10748463
334 Ga0207661_10101345
335 Ga0207661_10670927
336 Ga0207667_10475274
337 Ga0207712_11249180
338 Ga0207668_10604188
339 Ga0207639_12244277
340 Ga0207678_10789540
341 Ga0207648_10494542
342 Ga0207683_11262361
343 Ga0207698_11417753
344 Ga0207698_12212795
345 Ga0207428_10494846
346 Ga0268266_11532225
347 Ga0265337_1155166
348 Ga0265319_1136947
349 Ga0265323_10270939
350 Ga0265338_10063616
351 Ga0307511_10223540
352 Ga0265328_10056162
353 Ga0265340_10033887
354 Ga0307408_100259775
355 Ga0265342_10276441
356 Ga0265342_10497642
357 Ga0307412_10765201
358 Ga0307409_100007518
359 Ga0307409_100517712
360 Ga0307415_101023480
361 Ga0307415_101145831
362 Ga0373931_0142987
363 Ga0373927_0880259
364 Ga0373933_0100678
365 Ga0373933_1174170
366 Ga0373937_1212291
367 Ga0395899_0172008
368 Ga0395899_0246322
369 Ga0395900_0015827
370 Ga0395900_0048497
371 Ga0395900_0050881
372 Ga0395900_0153254
373 Ga0395900_1478608
374 Ga0395898_0015494
375 Ga0395898_0163246
376 Ga0395898_0189810
377 Ga0395898_0358619
378 Ga0395898_1013200
379 Ga0395905_0059707
380 Ga0395905_1049454
381 Ga0395905_1876804
382 Ga0436364_0942564
383 Ga0395901_0014565
384 Ga0395901_0403951
385 Ga0395901_0439593
386 Ga0395901_0486896
387 Ga0395901_1363849
388 Ga0436365_0347611
389 Ga0436360_0433976
390 Ga0436362_1185558
391 Ga0439453_0064065
392 Ga0451789_1194698
393 Ga0451804_0801837
394 Ga0451807_0536477
395 Ga0451847_0977240
396 Ga0451853_3623692
397 Ga0439448_0069628
398 Ga0439451_016787
399 Ga0439456_060943
400 Ga0466961_0152256
401 Ga0466961_0154340
402 Ga0466963_0001886
403 Ga0466963_0036500
404 Ga0466963_0256543
405 Ga0466963_0701364
406 Ga0466963_1264472
407 Ga0466964_0038884
408 Ga0466964_0122902
409 Ga0466964_0178176
410 Ga0466964_0481917
411 Ga0466971_0080873
412 Ga0466968_0002836
413 Ga0466968_0028309
414 Ga0466968_0165100
415 Ga0466970_0783397
416 Ga0466957_0050123
417 Ga0466957_0420356
418 Ga0466960_0058433
419 Ga0466960_0086711
420 Ga0466959_0172919
421 Ga0466959_0180245
422 Ga0451576_0624217
423 Ga0466958_0102425
424 Ga0466958_0202000
425 Ga0466967_0002247
426 Ga0466967_0057023
427 Ga0466967_0187132
428 Ga0466967_0192709
429 Ga0466967_0272271
430 Ga0466967_1123587
431 Ga0466967_1521840
432 Ga0466967_1723008
433 Ga0495592_0793737
434 Ga0495603_0171176
435 Ga0495641_0518413
436 Ga0495582_0796072
437 Ga0495639_0437484
438 Ga0495662_0092832
439 Ga0495664_0204781
440 Ga0495664_0261066
441 Ga0495618_0088430
442 Ga0495620_0051791
443 Ga0495628_0228050
444 Ga0495628_0338799
445 Ga0495652_0312343
446 Ga0495652_0943988
447 Ga0495640_0604471
448 Ga0495667_0919879
449 Ga0495634_0498674
450 Ga0495635_0109782
451 Ga0495646_0500008
452 Ga0495624_0458358
453 Ga0495600_0913595
454 Ga0495604_0164169
455 Ga0495674_0384319
456 Ga0495674_0796373
457 Ga0495674_1026025
458 Ga0495680_0826881
459 Ga0495684_0287864
460 Ga0496100_0291288
461 Ga0496100_0400711
462 Ga0496100_1246006
463 Ga0496100_1598856
464 Ga0496104_0028369
465 Ga0496104_0121641
466 Ga0496104_0598525
467 Ga0496104_0700663
468 Ga0496104_0980036
469 Ga0496104_1737956
470 Ga0496105_0052399
471 Ga0496105_0449224
472 Ga0496106_1306385
473 Ga0496107_0726541
474 Ga0496108_0017279
475 Ga0496108_0314567
476 Ga0496108_1610316
477 Ga0496109_0044841
478 Ga0496109_0063750
479 Ga0496109_0358339
480 Ga0496110_0007983
481 Ga0496110_0098834
482 Ga0496111_0085570
483 Ga0496112_0003938
484 Ga0496113_0036332
485 Ga0496113_0250813
486 Ga0496113_0658149
487 Ga0496113_0731385
488 Ga0496113_0928877
489 Ga0496113_0952900
490 Ga0496114_0183497
491 Ga0496114_0262406
492 Ga0496114_0359091
493 Ga0496115_0495691
494 Ga0496115_1029507
495 Ga0496115_1419144
496 Ga0501034_0099011
497 Ga0501040_0600249
498 Ga0501046_0285922
499 Ga0501047_0136469
500 Ga0501067_0146401
501 Ga0501068_0396937
502 Ga0501070_0070606
503 Ga0501074_0226495
504 Ga0501075_0662769
505 Ga0501077_0613213
506 Ga0501222_064873
507 Ga0501079_1608211
508 Ga0501080_0918463
509 Ga0501080_0961078
510 Ga0501083_0278356
511 Ga0501044_0653096
512 nmdc:mga05p37_206311_c1
513 nmdc:mga09592_458443_c1
514 nmdc:mga08y16_639054_c1
515 nmdc:mga0rr50_339637_c1
516 Ga0495601_0150579
517 Ga0495601_0406718
518 Ga0495655_0076781
519 Ga0466962_0159708
520 8003858856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2we8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.649 8 93
2we7-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.645 8 93
3on5-assembly1.cif.gz_B crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.6066 6 94
3on5-assembly1.cif.gz_A crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.5137 7 94
2we7-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.5089 5 93
ID Description Score Start End Superfamily
af_A0A0R4ID71_40_104_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.433 8 44 1.20.58.60
af_A4I186_165_449_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4205 5 100 2.130.10.10
af_D4A646_802_864_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.417 9 44 2.30.30.40
4odpA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.409 1 103 3.10.50.40
af_A0A0B4KI34_80_160_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.405 9 40 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A7V9FXZ7-F1-model_v4 TIGR04076 family protein 0.9906 4 104
AF-A0A542R2U8-F1-model_v4 deleted 0.985 2 104
AF-A0A7X0M8V8-F1-model_v4 Putative repeat protein (TIGR04076 family) 0.9811 4 104
AF-A0A7V9FXZ7-F1-model_v4 TIGR04076 family protein 0.981 4 104
AF-A0A372G329-F1-model_v4 TIGR04076 family protein 0.9802 3 104

Map