F369720

General Info

Members Datasets Scaffolds Average Seq Length
260 208 520 181

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0056950|Ga0436365_0056950_13_615
Length 200
Sequence VQTTRDEIETPSDHRRSDVGAVLVHEFMSLDGVIDAPTWTAEFGFDPKMGQAIAGVIQRSRGILLGRTTFEMFAQSWPTRTAEDDPGAPFFNDTTKYVVSSTLTNPTWQNTTTLGAYEADAIRNLKDEVDGDLYTSGSAQLVQAMLTDRLVDELHLFLYPVTRGAGPRLFSADATPGKLTLATTETYENGVVYLAYKPQA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.08
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0056950 3300039437 Bacteria 1422
2 JGI24735J21928_10097969 3300002067 Bacteria 842
3 JGI25407J50210_10004489 3300003373 Bacteria 3394
4 JGI25407J50210_10028890 3300003373 Bacteria 1437
5 JGI25407J50210_10031500 3300003373 Bacteria 1373
6 Ga0070658_10007545 3300005327 Bacteria 8777
7 Ga0070676_10108062 3300005328 Bacteria 1728
8 Ga0070683_100001276 3300005329 Bacteria 19154
9 Ga0068869_100187120 3300005334 Bacteria 1626
10 Ga0068869_100394345 3300005334 Bacteria 1137
11 Ga0068868_100242515 3300005338 Bacteria 1515
12 Ga0070689_100434596 3300005340 Bacteria 1114
13 Ga0070687_100055972 3300005343 Bacteria 2062
14 Ga0070692_10132083 3300005345 Bacteria 1404
15 Ga0070668_100324204 3300005347 Bacteria 1297
16 Ga0070669_100265696 3300005353 Bacteria 1370
17 Ga0070675_100413017 3300005354 Bacteria 1206
18 Ga0070674_100176771 3300005356 Bacteria 1632
19 Ga0070673_100256688 3300005364 Bacteria 1526
20 Ga0070688_100054933 3300005365 Bacteria 2496
21 Ga0070659_100030316 3300005366 Bacteria 4186
22 Ga0070701_10104141 3300005438 Bacteria 1576
23 Ga0070705_100196375 3300005440 Bacteria 1380
24 Ga0070700_100000674 3300005441 Bacteria 16892
25 Ga0070678_100542968 3300005456 Bacteria 1031
26 Ga0070662_100394608 3300005457 Bacteria 1141
27 Ga0070685_10053567 3300005466 Bacteria 2338
28 Ga0070699_100365884 3300005518 Bacteria 1300
29 Ga0070679_100180699 3300005530 Bacteria 2082
30 Ga0070684_100005763 3300005535 Bacteria 9523
31 Ga0070684_100335929 3300005535 Bacteria 1389
32 Ga0068853_100346008 3300005539 Bacteria 1382
33 Ga0070672_100029513 3300005543 Bacteria 4113
34 Ga0070686_100000565 3300005544 Bacteria 22138
35 Ga0070704_100241143 3300005549 Bacteria 1479
36 Ga0068855_101446166 3300005563 Bacteria 707
37 Ga0070664_100824804 3300005564 Bacteria 868
38 Ga0068857_100018392 3300005577 Bacteria 6131
39 Ga0068854_100486182 3300005578 Bacteria 1037
40 Ga0068856_101059011 3300005614 Bacteria 829
41 Ga0068852_100125174 3300005616 Bacteria 2359
42 Ga0068859_100663072 3300005617 Bacteria 1135
43 Ga0068864_100112000 3300005618 Bacteria 2432
44 Ga0068866_10010270 3300005718 Bacteria 4009
45 Ga0068861_100231353 3300005719 Bacteria 1568
46 Ga0068860_100081479 3300005843 Bacteria 3077
47 Ga0068860_100137162 3300005843 Bacteria 2350
48 Ga0081538_10000034 3300005981 Bacteria 120557
49 Ga0081538_10000037 3300005981 Bacteria 119828
50 Ga0081538_10002272 3300005981 Bacteria 19002
51 Ga0081538_10004319 3300005981 Bacteria 13136
52 Ga0081538_10032423 3300005981 Bacteria 3501
53 Ga0081538_10079812 3300005981 Bacteria 1749
54 Ga0081538_10138011 3300005981 Bacteria 1131
55 Ga0081539_10017064 3300005985 Bacteria 5127
56 Ga0081539_10125264 3300005985 Bacteria 1270
57 Ga0070717_10004498 3300006028 Bacteria 10075
58 Ga0070717_11013631 3300006028 Bacteria 756
59 Ga0097621_100073111 3300006237 Bacteria 2838
60 Ga0068871_100463078 3300006358 Bacteria 1138
61 Ga0075428_101146052 3300006844 Bacteria 820
62 Ga0075431_100119812 3300006847 Bacteria 2715
63 Ga0075431_100162505 3300006847 Bacteria 2296
64 Ga0075433_10528188 3300006852 Bacteria 1038
65 Ga0075434_100092984 3300006871 Bacteria 3018
66 Ga0075434_100196235 3300006871 Bacteria 2038
67 Ga0075434_100356817 3300006871 Bacteria 1483
68 Ga0068865_100028868 3300006881 Bacteria 3675
69 Ga0068865_100116981 3300006881 Bacteria 1975
70 Ga0075436_100013760 3300006914 Bacteria 5541
71 Ga0097620_100663085 3300006931 Bacteria 1135
72 Ga0075435_100093262 3300007076 Bacteria 2487
73 Ga0111539_10161158 3300009094 Bacteria 2623
74 Ga0105245_10006300 3300009098 Bacteria 10445
75 Ga0105245_10842490 3300009098 Bacteria 957
76 Ga0105247_10491182 3300009101 Bacteria 893
77 Ga0114129_10098721 3300009147 Bacteria 4042
78 Ga0114129_10128516 3300009147 Bacteria 3482
79 Ga0114129_10875233 3300009147 Bacteria 1140
80 Ga0105243_10187228 3300009148 Bacteria 1805
81 Ga0105243_10195924 3300009148 Bacteria 1768
82 Ga0105242_10416698 3300009176 Bacteria 1257
83 Ga0105248_10189250 3300009177 Bacteria 2319
84 Ga0105237_10232260 3300009545 Bacteria 1845
85 Ga0105249_10129625 3300009553 Bacteria 2406
86 Ga0105249_10234057 3300009553 Bacteria 1813
87 Ga0105239_10004204 3300010375 Bacteria 17287
88 Ga0105246_10001468 3300011119 Bacteria 14003
89 Ga0105246_10122713 3300011119 Bacteria 1928
90 Ga0157371_10356430 3300013102 Bacteria 1065
91 Ga0157369_10070233 3300013105 Bacteria 3763
92 Ga0157378_10779761 3300013297 Bacteria 980
93 Ga0163162_10087613 3300013306 Bacteria 3192
94 Ga0157372_10002605 3300013307 Bacteria 19511
95 Ga0157375_10053936 3300013308 Bacteria 3958
96 Ga0157380_10562165 3300014326 Bacteria 1121
97 Ga0157380_11131701 3300014326 Bacteria 823
98 Ga0182008_10149349 3300014497 Bacteria 1172
99 Ga0163161_10270742 3300017792 Bacteria 1329
100 Ga0213874_10167598 3300021377 Bacteria 775
101 Ga0213876_10008742 3300021384 Bacteria 5472
102 Ga0207642_10278800 3300025899 Bacteria 961
103 Ga0207688_10012790 3300025901 Bacteria 4562
104 Ga0207647_10072502 3300025904 Bacteria 2076
105 Ga0207645_10044642 3300025907 Bacteria 2836
106 Ga0207671_10371716 3300025914 Bacteria 1135
107 Ga0207693_10029180 3300025915 Bacteria 4360
108 Ga0207663_10402622 3300025916 Bacteria 1047
109 Ga0207662_10038850 3300025918 Bacteria 2790
110 Ga0207662_10095064 3300025918 Bacteria 1839
111 Ga0207652_10359902 3300025921 Bacteria 1313
112 Ga0207681_10332419 3300025923 Bacteria 1211
113 Ga0207687_10111515 3300025927 Bacteria 2031
114 Ga0207690_10056377 3300025932 Bacteria 2650
115 Ga0207686_10295189 3300025934 Bacteria 1202
116 Ga0207709_10241652 3300025935 Bacteria 1314
117 Ga0207709_10571760 3300025935 Bacteria 891
118 Ga0207670_10449907 3300025936 Bacteria 1038
119 Ga0207691_10006350 3300025940 Bacteria 11416
120 Ga0207711_10431620 3300025941 Bacteria 1226
121 Ga0207689_10114166 3300025942 Bacteria 2220
122 Ga0207661_10156326 3300025944 Bacteria 1975
123 Ga0207679_10951497 3300025945 Bacteria 787
124 Ga0207712_10722230 3300025961 Bacteria 871
125 Ga0207668_10015577 3300025972 Bacteria 4726
126 Ga0207640_10271587 3300025981 Bacteria 1327
127 Ga0207658_10211149 3300025986 Bacteria 1627
128 Ga0207677_10297182 3300026023 Bacteria 1333
129 Ga0207639_10351862 3300026041 Bacteria 1316
130 Ga0207678_10272998 3300026067 Bacteria 1450
131 Ga0207708_10001133 3300026075 Bacteria 20048
132 Ga0207702_10131225 3300026078 Bacteria 2255
133 Ga0207648_10030981 3300026089 Bacteria 4731
134 Ga0207676_10094868 3300026095 Bacteria 2459
135 Ga0207674_10002987 3300026116 Bacteria 20973
136 Ga0207675_100155671 3300026118 Bacteria 2178
137 Ga0207698_10097906 3300026142 Bacteria 2422
138 Ga0207698_11510191 3300026142 Bacteria 687
139 Ga0268266_10646034 3300028379 Bacteria 1018
140 Ga0268265_10936925 3300028380 Bacteria 852
141 Ga0268264_10107266 3300028381 Bacteria 2440
142 Ga0268264_10111022 3300028381 Bacteria 2401
143 Ga0265319_1032464 3300028563 Bacteria 1810
144 Ga0265318_10072050 3300028577 Bacteria 1280
145 Ga0265320_10114173 3300031240 Bacteria 1235
146 Ga0373936_0212998 3300035113 Bacteria 855
147 Ga0373945_0028608 3300035116 Bacteria 1953
148 Ga0373943_0003722 3300035170 Bacteria 6935
149 Ga0373946_0010294 3300035171 Bacteria 3459
150 Ga0373935_0022767 3300035692 Bacteria 3846
151 Ga0373927_0096580 3300035695 Bacteria 1921
152 Ga0373947_0000652 3300035725 Bacteria 20593
153 Ga0373925_0117031 3300037068 Bacteria 2065
154 Ga0395899_0125316 3300037312 Bacteria 1837
155 Ga0395900_0039819 3300037418 Bacteria 4843
156 Ga0395898_0004846 3300037466 Bacteria 14623
157 Ga0395905_0010951 3300037471 Bacteria 8778
158 Ga0395901_0013724 3300038443 Bacteria 8233
159 Ga0436365_0262179 3300039437 Bacteria 16663
160 Ga0436363_0671848 3300039450 Bacteria 1329
161 Ga0436363_0971037 3300039450 Bacteria 1080
162 Ga0436362_0156342 3300039453 Bacteria 1536
163 Ga0466969_0022850 3300044656 Bacteria 3225
164 Ga0466963_0371872 3300044694 Bacteria 1007
165 Ga0466971_0050270 3300044719 Bacteria 1876
166 Ga0466970_0251043 3300044765 Bacteria 991
167 Ga0466959_0082512 3300045049 Bacteria 2316
168 Ga0466959_0326245 3300045049 Unclassified 1049
169 Ga0451576_0007862 3300045051 Bacteria 12639
170 Ga0451576_0584253 3300045051 Bacteria 1174
171 Ga0466958_0288730 3300045836 Bacteria 1052
172 Ga0466967_0065851 3300045976 Bacteria 3227
173 Ga0466967_0186907 3300045976 Bacteria 1956
174 Ga0466967_0426001 3300045976 Bacteria 1294
175 Ga0495603_0149174 3300046455 Bacteria 1359
176 Ga0495641_0000626 3300046461 Bacteria 29773
177 Ga0495653_0003414 3300046463 Bacteria 12774
178 Ga0495653_0021248 3300046463 Bacteria 5258
179 Ga0495582_0001691 3300046473 Bacteria 12453
180 Ga0495639_0000390 3300046475 Bacteria 20704
181 Ga0495662_0014586 3300046476 Bacteria 3820
182 Ga0495594_0092998 3300046499 Bacteria 1691
183 Ga0495608_0014600 3300046511 Bacteria 5449
184 Ga0495618_0092333 3300046514 Bacteria 1936
185 Ga0495628_0330937 3300046516 Bacteria 1123
186 Ga0495628_0511843 3300046516 Bacteria 866
187 Ga0495630_0581521 3300046517 Bacteria 858
188 Ga0495630_1108637 3300046517 Bacteria 600
189 Ga0495666_0123197 3300046526 Bacteria 1213
190 Ga0495665_0010382 3300046531 Bacteria 5039
191 Ga0495640_0024250 3300046533 Bacteria 4414
192 Ga0495645_0227999 3300046543 Bacteria 1249
193 Ga0495667_0045635 3300046559 Bacteria 2900
194 Ga0495634_0138622 3300046642 Bacteria 1546
195 Ga0495635_0017385 3300046663 Bacteria 5024
196 Ga0495635_0026760 3300046663 Bacteria 4011
197 Ga0495657_0147945 3300046675 Bacteria 1460
198 Ga0495647_0011909 3300046681 Bacteria 2986
199 Ga0495658_0006223 3300046683 Bacteria 5864
200 Ga0495613_0019288 3300046689 Bacteria 5084
201 Ga0495613_0413742 3300046689 Bacteria 918
202 Ga0495624_0029685 3300046690 Bacteria 3566
203 Ga0495600_0022986 3300046809 Bacteria 4009
204 Ga0495581_0002030 3300047315 Bacteria 11385
205 Ga0495604_0058586 3300047317 Bacteria 2957
206 Ga0495604_0742185 3300047317 Bacteria 621
207 Ga0495676_0008655 3300047321 Bacteria 9316
208 Ga0495680_0015695 3300047322 Bacteria 6522
209 Ga0495684_0011815 3300047471 Bacteria 6737
210 Ga0495593_0008600 3300047673 Bacteria 5936
211 Ga0496100_0117015 3300048903 Bacteria 1860
212 Ga0496101_0086458 3300048904 Bacteria 2325
213 Ga0496101_0183171 3300048904 Bacteria 1613
214 Ga0496102_0019846 3300048905 Bacteria 5926
215 Ga0496103_0124969 3300048906 Bacteria 1640
216 Ga0496103_0187599 3300048906 Bacteria 1329
217 Ga0496105_0889541 3300048908 Bacteria 672
218 Ga0496107_0221126 3300048910 Bacteria 1409
219 Ga0496108_0130840 3300048911 Bacteria 2157
220 Ga0496109_0051450 3300048912 Bacteria 3752
221 Ga0496109_0068266 3300048912 Bacteria 3259
222 Ga0496109_0361901 3300048912 Bacteria 1370
223 Ga0496110_0002455 3300048913 Bacteria 13880
224 Ga0496111_0003092 3300048914 Bacteria 10230
225 Ga0496111_0109363 3300048914 Bacteria 2035
226 Ga0496111_0377332 3300048914 Bacteria 1049
227 Ga0496112_0803994 3300048915 Bacteria 865
228 Ga0496114_0042408 3300048917 Bacteria 3772
229 Ga0496114_0098643 3300048917 Bacteria 2491
230 Ga0496114_0144540 3300048917 Bacteria 2061
231 Ga0496114_0199690 3300048917 Bacteria 1751
232 Ga0501032_0211942 3300049569 Bacteria 1263
233 Ga0501036_1190731 3300049572 Bacteria 621
234 Ga0501037_0030577 3300049573 Bacteria 3979
235 Ga0501038_0085501 3300049574 Bacteria 2652
236 Ga0501046_0038696 3300049580 Bacteria 3825
237 Ga0501046_0262110 3300049580 Bacteria 1270
238 Ga0501047_0139051 3300049581 Bacteria 2308
239 Ga0501069_0012815 3300049585 Bacteria 4464
240 Ga0501070_0012703 3300049586 Bacteria 7102
241 Ga0501071_0243270 3300049587 Bacteria 1357
242 Ga0501072_0279127 3300049588 Bacteria 1329
243 Ga0501083_0012174 3300049744 Bacteria 6023
244 Ga0501044_0049864 3300049823 Bacteria 4321
245 Ga0501045_0151746 3300049824 Bacteria 1724
246 nmdc:mga05p37_191637_c1 3300050507 Bacteria 2482
247 nmdc:mga05p37_224990_c1 3300050507 Bacteria 2263
248 nmdc:mga09592_49935_c1 3300050508 Bacteria 3528
249 nmdc:mga06r32_130853_c1 3300050510 Bacteria 2482
250 nmdc:mga0n895_199420_c1 3300050512 Bacteria 2033
251 nmdc:mga0rr50_157636_c1 3300050513 Bacteria 1840
252 nmdc:mga08x19_31096_c1 3300050514 Bacteria 3356
253 nmdc:mga0a205_91970_c1 3300050515 Bacteria 2931
254 Ga0495595_0013243 3300053084 Bacteria 3482
255 Ga0495619_0027652 3300053085 Bacteria 3655
256 Ga0501084_0263282 3300054114 Bacteria 1456
257 Ga0501082_0045168 3300060353 Bacteria 3799
258 Ga0501082_0822648 3300060353 Bacteria 812
259 Ga0530510_0076111 3300061734 Unclassified 2438
260 2744955955 2744054611 Bacteria 5611514
261 Ga0436365_0056950
262 JGI24735J21928_10097969
263 JGI25407J50210_10004489
264 JGI25407J50210_10028890
265 JGI25407J50210_10031500
266 Ga0070658_10007545
267 Ga0070676_10108062
268 Ga0070683_100001276
269 Ga0068869_100187120
270 Ga0068869_100394345
271 Ga0068868_100242515
272 Ga0070689_100434596
273 Ga0070687_100055972
274 Ga0070692_10132083
275 Ga0070668_100324204
276 Ga0070669_100265696
277 Ga0070675_100413017
278 Ga0070674_100176771
279 Ga0070673_100256688
280 Ga0070688_100054933
281 Ga0070659_100030316
282 Ga0070701_10104141
283 Ga0070705_100196375
284 Ga0070700_100000674
285 Ga0070678_100542968
286 Ga0070662_100394608
287 Ga0070685_10053567
288 Ga0070699_100365884
289 Ga0070679_100180699
290 Ga0070684_100005763
291 Ga0070684_100335929
292 Ga0068853_100346008
293 Ga0070672_100029513
294 Ga0070686_100000565
295 Ga0070704_100241143
296 Ga0068855_101446166
297 Ga0070664_100824804
298 Ga0068857_100018392
299 Ga0068854_100486182
300 Ga0068856_101059011
301 Ga0068852_100125174
302 Ga0068859_100663072
303 Ga0068864_100112000
304 Ga0068866_10010270
305 Ga0068861_100231353
306 Ga0068860_100081479
307 Ga0068860_100137162
308 Ga0081538_10000034
309 Ga0081538_10000037
310 Ga0081538_10002272
311 Ga0081538_10004319
312 Ga0081538_10032423
313 Ga0081538_10079812
314 Ga0081538_10138011
315 Ga0081539_10017064
316 Ga0081539_10125264
317 Ga0070717_10004498
318 Ga0070717_11013631
319 Ga0097621_100073111
320 Ga0068871_100463078
321 Ga0075428_101146052
322 Ga0075431_100119812
323 Ga0075431_100162505
324 Ga0075433_10528188
325 Ga0075434_100092984
326 Ga0075434_100196235
327 Ga0075434_100356817
328 Ga0068865_100028868
329 Ga0068865_100116981
330 Ga0075436_100013760
331 Ga0097620_100663085
332 Ga0075435_100093262
333 Ga0111539_10161158
334 Ga0105245_10006300
335 Ga0105245_10842490
336 Ga0105247_10491182
337 Ga0114129_10098721
338 Ga0114129_10128516
339 Ga0114129_10875233
340 Ga0105243_10187228
341 Ga0105243_10195924
342 Ga0105242_10416698
343 Ga0105248_10189250
344 Ga0105237_10232260
345 Ga0105249_10129625
346 Ga0105249_10234057
347 Ga0105239_10004204
348 Ga0105246_10001468
349 Ga0105246_10122713
350 Ga0157371_10356430
351 Ga0157369_10070233
352 Ga0157378_10779761
353 Ga0163162_10087613
354 Ga0157372_10002605
355 Ga0157375_10053936
356 Ga0157380_10562165
357 Ga0157380_11131701
358 Ga0182008_10149349
359 Ga0163161_10270742
360 Ga0213874_10167598
361 Ga0213876_10008742
362 Ga0207642_10278800
363 Ga0207688_10012790
364 Ga0207647_10072502
365 Ga0207645_10044642
366 Ga0207671_10371716
367 Ga0207693_10029180
368 Ga0207663_10402622
369 Ga0207662_10038850
370 Ga0207662_10095064
371 Ga0207652_10359902
372 Ga0207681_10332419
373 Ga0207687_10111515
374 Ga0207690_10056377
375 Ga0207686_10295189
376 Ga0207709_10241652
377 Ga0207709_10571760
378 Ga0207670_10449907
379 Ga0207691_10006350
380 Ga0207711_10431620
381 Ga0207689_10114166
382 Ga0207661_10156326
383 Ga0207679_10951497
384 Ga0207712_10722230
385 Ga0207668_10015577
386 Ga0207640_10271587
387 Ga0207658_10211149
388 Ga0207677_10297182
389 Ga0207639_10351862
390 Ga0207678_10272998
391 Ga0207708_10001133
392 Ga0207702_10131225
393 Ga0207648_10030981
394 Ga0207676_10094868
395 Ga0207674_10002987
396 Ga0207675_100155671
397 Ga0207698_10097906
398 Ga0207698_11510191
399 Ga0268266_10646034
400 Ga0268265_10936925
401 Ga0268264_10107266
402 Ga0268264_10111022
403 Ga0265319_1032464
404 Ga0265318_10072050
405 Ga0265320_10114173
406 Ga0373936_0212998
407 Ga0373945_0028608
408 Ga0373943_0003722
409 Ga0373946_0010294
410 Ga0373935_0022767
411 Ga0373927_0096580
412 Ga0373947_0000652
413 Ga0373925_0117031
414 Ga0395899_0125316
415 Ga0395900_0039819
416 Ga0395898_0004846
417 Ga0395905_0010951
418 Ga0395901_0013724
419 Ga0436365_0262179
420 Ga0436363_0671848
421 Ga0436363_0971037
422 Ga0436362_0156342
423 Ga0466969_0022850
424 Ga0466963_0371872
425 Ga0466971_0050270
426 Ga0466970_0251043
427 Ga0466959_0082512
428 Ga0466959_0326245
429 Ga0451576_0007862
430 Ga0451576_0584253
431 Ga0466958_0288730
432 Ga0466967_0065851
433 Ga0466967_0186907
434 Ga0466967_0426001
435 Ga0495603_0149174
436 Ga0495641_0000626
437 Ga0495653_0003414
438 Ga0495653_0021248
439 Ga0495582_0001691
440 Ga0495639_0000390
441 Ga0495662_0014586
442 Ga0495594_0092998
443 Ga0495608_0014600
444 Ga0495618_0092333
445 Ga0495628_0330937
446 Ga0495628_0511843
447 Ga0495630_0581521
448 Ga0495630_1108637
449 Ga0495666_0123197
450 Ga0495665_0010382
451 Ga0495640_0024250
452 Ga0495645_0227999
453 Ga0495667_0045635
454 Ga0495634_0138622
455 Ga0495635_0017385
456 Ga0495635_0026760
457 Ga0495657_0147945
458 Ga0495647_0011909
459 Ga0495658_0006223
460 Ga0495613_0019288
461 Ga0495613_0413742
462 Ga0495624_0029685
463 Ga0495600_0022986
464 Ga0495581_0002030
465 Ga0495604_0058586
466 Ga0495604_0742185
467 Ga0495676_0008655
468 Ga0495680_0015695
469 Ga0495684_0011815
470 Ga0495593_0008600
471 Ga0496100_0117015
472 Ga0496101_0086458
473 Ga0496101_0183171
474 Ga0496102_0019846
475 Ga0496103_0124969
476 Ga0496103_0187599
477 Ga0496105_0889541
478 Ga0496107_0221126
479 Ga0496108_0130840
480 Ga0496109_0051450
481 Ga0496109_0068266
482 Ga0496109_0361901
483 Ga0496110_0002455
484 Ga0496111_0003092
485 Ga0496111_0109363
486 Ga0496111_0377332
487 Ga0496112_0803994
488 Ga0496114_0042408
489 Ga0496114_0098643
490 Ga0496114_0144540
491 Ga0496114_0199690
492 Ga0501032_0211942
493 Ga0501036_1190731
494 Ga0501037_0030577
495 Ga0501038_0085501
496 Ga0501046_0038696
497 Ga0501046_0262110
498 Ga0501047_0139051
499 Ga0501069_0012815
500 Ga0501070_0012703
501 Ga0501071_0243270
502 Ga0501072_0279127
503 Ga0501083_0012174
504 Ga0501044_0049864
505 Ga0501045_0151746
506 nmdc:mga05p37_191637_c1
507 nmdc:mga05p37_224990_c1
508 nmdc:mga09592_49935_c1
509 nmdc:mga06r32_130853_c1
510 nmdc:mga0n895_199420_c1
511 nmdc:mga0rr50_157636_c1
512 nmdc:mga08x19_31096_c1
513 nmdc:mga0a205_91970_c1
514 Ga0495595_0013243
515 Ga0495619_0027652
516 Ga0501084_0263282
517 Ga0501082_0045168
518 Ga0501082_0822648
519 Ga0530510_0076111
520 2744955955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

21

193

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8284 3 180
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8197 3 180
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.813 1 179
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8088 1 179
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.802 1 179
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8131 1 179 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8087 1 179 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7905 3 177 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7902 2 180 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7821 3 177 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1H2ZNN3-F1-model_v4 Dihydrofolate reductase 0.9749 1 180 GO:0008703
GO:0009231
AF-A0A1H2ZNN3-F1-model_v4 Dihydrofolate reductase 0.9696 1 180 GO:0008703
GO:0009231
AF-D0LA92-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9653 25 180 GO:0008703
GO:0009231
AF-A0A535DYC0-F1-model_v4 Deaminase 0.9601 3 180 GO:0008703
GO:0009231
AF-A0A7R7HWB0-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9541 16 179 GO:0008703
GO:0009231

Map