F369517

General Info

Members Datasets Scaffolds Average Seq Length
260 160 520 163

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10401607|Ga0114129_104016074
Length 180
Sequence LRKEESIMSMTEMLIQELEQEAHTTRRVLERVPADRLGWKPHDRSWSLGQLALHIATIPGAIAEIATQSPFPLPKFSQPSPGSASELIPTLQESVGKAKAILRGMDDAALGKTWRAVDGDREVMAIPVGAVLRSIMLNHWYHHRGQLSVYLRQVGVPVPSIYGPSADENPFVAEAFAQSS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
145 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 4.23
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 21.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10401607 3300009147 Unclassified 1806
2 LJNas_1008121 3300000546 Bacteria 1129
3 Ga0065712_10002604 3300005290 Bacteria 4504
4 Ga0065715_10115213 3300005293 Unclassified 2422
5 Ga0065715_10122228 3300005293 Bacteria 2208
6 Ga0070683_100025832 3300005329 Bacteria 5282
7 Ga0070670_100053437 3300005331 Bacteria 3469
8 Ga0070670_100460359 3300005331 Bacteria 1128
9 Ga0070670_100480161 3300005331 Unclassified 1104
10 Ga0070670_100525111 3300005331 Bacteria 1054
11 Ga0070670_100821667 3300005331 Bacteria 840
12 Ga0070666_10042001 3300005335 Bacteria 3057
13 Ga0070689_100074566 3300005340 Bacteria 2655
14 Ga0070661_100052657 3300005344 Bacteria 2979
15 Ga0070692_10384802 3300005345 Bacteria 881
16 Ga0070692_10775999 3300005345 Unclassified 652
17 Ga0070668_100229731 3300005347 Bacteria 1533
18 Ga0070668_100730751 3300005347 Unclassified 875
19 Ga0070669_100097328 3300005353 Bacteria 2215
20 Ga0070669_100345238 3300005353 Bacteria 1207
21 Ga0070669_101006675 3300005353 Bacteria 715
22 Ga0070671_100123650 3300005355 Unclassified 2178
23 Ga0070674_100051067 3300005356 Bacteria 2848
24 Ga0070674_100141544 3300005356 Bacteria 1805
25 Ga0070674_100346676 3300005356 Bacteria 1198
26 Ga0070674_100641081 3300005356 Bacteria 902
27 Ga0070674_100650977 3300005356 Unclassified 896
28 Ga0070673_100684254 3300005364 Unclassified 941
29 Ga0070688_100775195 3300005365 Bacteria 748
30 Ga0070713_100359746 3300005436 Bacteria 1352
31 Ga0070701_10729642 3300005438 Bacteria 669
32 Ga0070705_100056032 3300005440 Bacteria 2320
33 Ga0070694_100179609 3300005444 Bacteria 1564
34 Ga0070694_100839692 3300005444 Unclassified 755
35 Ga0070708_100000134 3300005445 Bacteria 50831
36 Ga0070678_100516482 3300005456 Unclassified 1056
37 Ga0070678_100857122 3300005456 Bacteria 828
38 Ga0070662_100693225 3300005457 Bacteria 861
39 Ga0070706_100003117 3300005467 Bacteria 16415
40 Ga0070706_100024983 3300005467 Bacteria 5500
41 Ga0070707_100134712 3300005468 Bacteria 2403
42 Ga0070707_100253060 3300005468 Bacteria 1714
43 Ga0070707_100342363 3300005468 Bacteria 1453
44 Ga0070698_100000807 3300005471 Bacteria 34196
45 Ga0070698_100016206 3300005471 Bacteria 7867
46 Ga0070698_100034840 3300005471 Bacteria 5208
47 Ga0070698_100213592 3300005471 Bacteria 1863
48 Ga0070698_100435792 3300005471 Bacteria 1246
49 Ga0070699_100002914 3300005518 Bacteria 15230
50 Ga0070699_100151545 3300005518 Bacteria 2051
51 Ga0070699_100373566 3300005518 Bacteria 1286
52 Ga0070699_100486808 3300005518 Bacteria 1120
53 Ga0070684_100004004 3300005535 Bacteria 11150
54 Ga0070697_100008515 3300005536 Bacteria 8007
55 Ga0070697_100009269 3300005536 Bacteria 7693
56 Ga0070697_100009281 3300005536 Bacteria 7688
57 Ga0070697_100080427 3300005536 Bacteria 2685
58 Ga0070672_100083416 3300005543 Unclassified 2565
59 Ga0070672_100508013 3300005543 Unclassified 1043
60 Ga0070672_100778485 3300005543 Bacteria 841
61 Ga0070672_101451767 3300005543 Unclassified 614
62 Ga0070695_100131138 3300005545 Bacteria 1728
63 Ga0070696_100004742 3300005546 Bacteria 9089
64 Ga0070696_100079222 3300005546 Bacteria 2324
65 Ga0070704_100059226 3300005549 Bacteria 2731
66 Ga0070664_100000515 3300005564 Bacteria 29394
67 Ga0068857_100107739 3300005577 Unclassified 2503
68 Ga0068856_100043283 3300005614 Bacteria 4430
69 Ga0070702_100181979 3300005615 Unclassified 1376
70 Ga0068859_100052338 3300005617 Bacteria 4105
71 Ga0068864_100063038 3300005618 Bacteria 3213
72 Ga0068864_100243427 3300005618 Bacteria 1667
73 Ga0068858_100334784 3300005842 Bacteria 1448
74 Ga0068860_101243743 3300005843 Bacteria 765
75 Ga0075432_10203263 3300006058 Bacteria 784
76 Ga0070716_100034680 3300006173 Bacteria 2769
77 Ga0075428_100007784 3300006844 Bacteria 11873
78 Ga0075428_100051230 3300006844 Unclassified 4527
79 Ga0075428_100358423 3300006844 Bacteria 1565
80 Ga0075428_100370286 3300006844 Bacteria 1536
81 Ga0075428_100754858 3300006844 Bacteria 1035
82 Ga0075430_100004193 3300006846 Bacteria 12165
83 Ga0075430_100016288 3300006846 Bacteria 6332
84 Ga0075430_100023525 3300006846 Bacteria 5244
85 Ga0075431_100114603 3300006847 Bacteria 2782
86 Ga0075431_100169555 3300006847 Unclassified 2243
87 Ga0075431_100260621 3300006847 Bacteria 1759
88 Ga0075431_100558053 3300006847 Unclassified 1132
89 Ga0075433_10094365 3300006852 Bacteria 2648
90 Ga0075433_10704195 3300006852 Bacteria 884
91 Ga0075434_100010578 3300006871 Bacteria 8657
92 Ga0075434_100387252 3300006871 Bacteria 1419
93 Ga0075434_100595618 3300006871 Unclassified 1124
94 Ga0075429_100001561 3300006880 Bacteria 18829
95 Ga0075429_100021910 3300006880 Bacteria 5539
96 Ga0075429_100067219 3300006880 Bacteria 3119
97 Ga0068865_100044207 3300006881 Bacteria 3048
98 Ga0068865_100411664 3300006881 Bacteria 1110
99 Ga0097620_100052338 3300006931 Bacteria 4105
100 Ga0075435_100064015 3300007076 Bacteria 2987
101 Ga0099794_10055599 3300007265 Bacteria 1913
102 Ga0111539_10012461 3300009094 Bacteria 10658
103 Ga0111539_10013448 3300009094 Bacteria 10230
104 Ga0111539_10037404 3300009094 Bacteria 5862
105 Ga0111539_10343053 3300009094 Unclassified 1739
106 Ga0105247_10085948 3300009101 Bacteria 1990
107 Ga0105247_10469430 3300009101 Unclassified 911
108 Ga0114129_10023995 3300009147 Bacteria 8643
109 Ga0114129_10027054 3300009147 Bacteria 8121
110 Ga0114129_10098209 3300009147 Bacteria 4053
111 Ga0114129_10144102 3300009147 Bacteria 3264
112 Ga0114129_10510081 3300009147 Bacteria 1569
113 Ga0114129_11251186 3300009147 Unclassified 922
114 Ga0105241_11029157 3300009174 Bacteria 772
115 Ga0105248_10066155 3300009177 Bacteria 4058
116 Ga0105246_10104843 3300011119 Bacteria 2065
117 Ga0157371_10142640 3300013102 Bacteria 1706
118 Ga0157374_10397274 3300013296 Unclassified 1375
119 Ga0157374_10618540 3300013296 Unclassified 1094
120 Ga0157378_10863568 3300013297 Bacteria 934
121 Ga0163162_10109790 3300013306 Bacteria 2855
122 Ga0163162_10585082 3300013306 Unclassified 1243
123 Ga0157372_10054565 3300013307 Bacteria 4459
124 Ga0157372_10700102 3300013307 Bacteria 1179
125 Ga0157375_10245925 3300013308 Bacteria 1949
126 Ga0157375_10687829 3300013308 Unclassified 1177
127 Ga0163163_10014999 3300014325 Bacteria 7143
128 Ga0163163_10797912 3300014325 Bacteria 1007
129 Ga0163163_11392207 3300014325 Bacteria 763
130 Ga0157380_10397728 3300014326 Bacteria 1306
131 Ga0157379_10092342 3300014968 Bacteria 2715
132 Ga0157379_10198281 3300014968 Bacteria 1815
133 Ga0157376_11095239 3300014969 Unclassified 822
134 Ga0207697_10050614 3300025315 Bacteria 1715
135 Ga0207697_10426793 3300025315 Unclassified 588
136 Ga0207688_10038096 3300025901 Bacteria 2668
137 Ga0207688_10119805 3300025901 Bacteria 1535
138 Ga0207680_10032870 3300025903 Unclassified 2953
139 Ga0207699_10512804 3300025906 Bacteria 866
140 Ga0207684_10003809 3300025910 Bacteria 14546
141 Ga0207684_10026019 3300025910 Bacteria 4987
142 Ga0207654_10903529 3300025911 Bacteria 640
143 Ga0207649_10096752 3300025920 Bacteria 1945
144 Ga0207646_10185256 3300025922 Bacteria 1880
145 Ga0207681_10354539 3300025923 Bacteria 1175
146 Ga0207681_10388577 3300025923 Bacteria 1125
147 Ga0207650_10070577 3300025925 Unclassified 2626
148 Ga0207650_10433053 3300025925 Bacteria 1093
149 Ga0207659_10229853 3300025926 Bacteria 1495
150 Ga0207700_10399394 3300025928 Bacteria 1204
151 Ga0207670_10649689 3300025936 Unclassified 870
152 Ga0207669_10251556 3300025937 Bacteria 1316
153 Ga0207669_11272709 3300025937 Unclassified 624
154 Ga0207704_10129233 3300025938 Unclassified 1746
155 Ga0207704_10560946 3300025938 Bacteria 929
156 Ga0207711_10144880 3300025941 Bacteria 2140
157 Ga0207689_11051217 3300025942 Bacteria 687
158 Ga0207661_10007782 3300025944 Bacteria 7630
159 Ga0207679_10233602 3300025945 Unclassified 1554
160 Ga0207668_10886592 3300025972 Bacteria 793
161 Ga0207677_11682447 3300026023 Bacteria 588
162 Ga0207678_10066505 3300026067 Bacteria 3095
163 Ga0207676_10059804 3300026095 Bacteria 3011
164 Ga0207674_10453484 3300026116 Bacteria 1239
165 Ga0207675_100994468 3300026118 Bacteria 857
166 Ga0207683_10589181 3300026121 Bacteria 1029
167 Ga0207683_10769328 3300026121 Bacteria 893
168 Ga0209588_1097232 3300027671 Bacteria 948
169 Ga0207428_10006575 3300027907 Bacteria 10714
170 Ga0207428_10013346 3300027907 Bacteria 7182
171 Ga0207428_10017377 3300027907 Bacteria 6175
172 Ga0207428_10112817 3300027907 Bacteria 2090
173 Ga0307515_10000380 3300028794 Bacteria 108537
174 Ga0265331_10089364 3300031250 Unclassified 1425
175 Ga0307408_100007135 3300031548 Bacteria 7395
176 Ga0307413_10179917 3300031824 Bacteria 1506
177 Ga0307409_100019049 3300031995 Bacteria 4636
178 Ga0307409_100367502 3300031995 Bacteria 1363
179 Ga0307416_100456643 3300032002 Bacteria 1331
180 Ga0307411_10010723 3300032005 Bacteria 4902
181 Ga0307411_10534074 3300032005 Bacteria 998
182 Ga0307415_100248906 3300032126 Bacteria 1443
183 Ga0307415_101145845 3300032126 Bacteria 730
184 Ga0373945_0514690 3300035116 Bacteria 534
185 Ga0373933_0280624 3300035724 Bacteria 1076
186 Ga0395898_1381393 3300037466 Unclassified 632
187 Ga0436360_0929607 3300039438 Bacteria 1283
188 Ga0436362_0385149 3300039453 Unclassified 644
189 Ga0451802_1266120 3300041460 Unclassified 782
190 Ga0439441_129960 3300042001 Bacteria 583
191 Ga0439464_0000029 3300042439 Bacteria 18202
192 Ga0439460_0035116 3300042461 Bacteria 1449
193 Ga0451576_0158159 3300045051 Bacteria 2364
194 Ga0495584_0297050 3300046491 Bacteria 820
195 Ga0495630_0541941 3300046517 Bacteria 892
196 Ga0495643_0000597 3300046522 Bacteria 43811
197 Ga0495642_0232872 3300046528 Bacteria 804
198 Ga0495609_0087130 3300046538 Bacteria 1360
199 Ga0495621_0025767 3300046539 Bacteria 1978
200 Ga0495625_0087031 3300046660 Bacteria 2166
201 Ga0495659_0037583 3300046664 Bacteria 1716
202 Ga0495659_0077953 3300046664 Unclassified 1252
203 Ga0495623_0310359 3300046679 Unclassified 869
204 Ga0495669_0317476 3300046684 Bacteria 752
205 Ga0495636_0039282 3300047318 Bacteria 1959
206 Ga0496100_0257536 3300048903 Unclassified 1293
207 Ga0496102_0365660 3300048905 Unclassified 1358
208 Ga0496105_0140368 3300048908 Bacteria 1989
209 Ga0496106_0102104 3300048909 Bacteria 2225
210 Ga0496107_0187837 3300048910 Unclassified 1535
211 Ga0496107_0434641 3300048910 Unclassified 976
212 Ga0496108_0010413 3300048911 Bacteria 7551
213 Ga0496109_0002670 3300048912 Bacteria 14965
214 Ga0496110_0669295 3300048913 Bacteria 938
215 Ga0496112_0006107 3300048915 Bacteria 10530
216 Ga0501291_065831 3300049514 Bacteria 692
217 Ga0501034_1205556 3300049571 Unclassified 636
218 Ga0501036_0108321 3300049572 Unclassified 2349
219 Ga0501038_0536944 3300049574 Bacteria 891
220 Ga0501041_0152117 3300049577 Unclassified 1445
221 Ga0501048_0045047 3300049582 Bacteria 3152
222 Ga0501071_0309929 3300049587 Bacteria 1197
223 Ga0501072_0256585 3300049588 Unclassified 1392
224 Ga0501076_0096800 3300049592 Bacteria 2377
225 Ga0501233_085799 3300049668 Bacteria 816
226 Ga0501242_037963 3300049674 Unclassified 673
227 Ga0501221_039762 3300049704 Bacteria 1021
228 Ga0501225_0035613 3300049705 Bacteria 1371
229 Ga0501080_0511864 3300049742 Bacteria 1072
230 Ga0501045_0021546 3300049824 Bacteria 4611
231 nmdc:mga05p37_175105_c1 3300050507 Bacteria 2614
232 nmdc:mga05p37_262343_c1 3300050507 Bacteria 2067
233 nmdc:mga05p37_323431_c1 3300050507 Bacteria 1825
234 nmdc:mga05p37_325390_c1 3300050507 Bacteria 1818
235 nmdc:mga05p37_3923_c1 3300050507 Bacteria 17425
236 nmdc:mga05p37_49846_c1 3300050507 Bacteria 5150
237 nmdc:mga09592_15599_c1 3300050508 Bacteria 6207
238 nmdc:mga09592_17709_c1 3300050508 Bacteria 5839
239 nmdc:mga09592_24099_c1 3300050508 Bacteria 5031
240 nmdc:mga09592_52303_c1 3300050508 Bacteria 3448
241 nmdc:mga0qj67_109924_c1 3300050509 Unclassified 2225
242 nmdc:mga0qj67_412981_c1 3300050509 Unclassified 1089
243 nmdc:mga06r32_105086_c1 3300050510 Bacteria 2774
244 nmdc:mga06r32_51320_c1 3300050510 Unclassified 3947
245 nmdc:mga08y16_18945_c1 3300050511 Bacteria 7248
246 nmdc:mga08y16_23853_c1 3300050511 Bacteria 6461
247 nmdc:mga08y16_360025_c1 3300050511 Bacteria 1494
248 nmdc:mga08y16_570071_c1 3300050511 Unclassified 1144
249 nmdc:mga0n895_129136_c1 3300050512 Bacteria 2552
250 nmdc:mga0n895_280940_c1 3300050512 Bacteria 1688
251 nmdc:mga0n895_611269_c1 3300050512 Bacteria 1092
252 nmdc:mga0rr50_164559_c1 3300050513 Bacteria 1803
253 nmdc:mga0rr50_419139_c1 3300050513 Bacteria 1132
254 nmdc:mga0a205_165377_c1 3300050515 Unclassified 2108
255 nmdc:mga0a205_187468_c1 3300050515 Archaea 1961
256 nmdc:mga0a205_196228_c1 3300050515 Bacteria 1910
257 nmdc:mga0a205_78886_c1 3300050515 Bacteria 3181
258 Ga0500622_0163185 3300053156 Bacteria 1043
259 Ga0501084_0082510 3300054114 Unclassified 2698
260 Ga0501082_0025686 3300060353 Bacteria 5076
261 Ga0114129_10401607
262 LJNas_1008121
263 Ga0065712_10002604
264 Ga0065715_10115213
265 Ga0065715_10122228
266 Ga0070683_100025832
267 Ga0070670_100053437
268 Ga0070670_100460359
269 Ga0070670_100480161
270 Ga0070670_100525111
271 Ga0070670_100821667
272 Ga0070666_10042001
273 Ga0070689_100074566
274 Ga0070661_100052657
275 Ga0070692_10384802
276 Ga0070692_10775999
277 Ga0070668_100229731
278 Ga0070668_100730751
279 Ga0070669_100097328
280 Ga0070669_100345238
281 Ga0070669_101006675
282 Ga0070671_100123650
283 Ga0070674_100051067
284 Ga0070674_100141544
285 Ga0070674_100346676
286 Ga0070674_100641081
287 Ga0070674_100650977
288 Ga0070673_100684254
289 Ga0070688_100775195
290 Ga0070713_100359746
291 Ga0070701_10729642
292 Ga0070705_100056032
293 Ga0070694_100179609
294 Ga0070694_100839692
295 Ga0070708_100000134
296 Ga0070678_100516482
297 Ga0070678_100857122
298 Ga0070662_100693225
299 Ga0070706_100003117
300 Ga0070706_100024983
301 Ga0070707_100134712
302 Ga0070707_100253060
303 Ga0070707_100342363
304 Ga0070698_100000807
305 Ga0070698_100016206
306 Ga0070698_100034840
307 Ga0070698_100213592
308 Ga0070698_100435792
309 Ga0070699_100002914
310 Ga0070699_100151545
311 Ga0070699_100373566
312 Ga0070699_100486808
313 Ga0070684_100004004
314 Ga0070697_100008515
315 Ga0070697_100009269
316 Ga0070697_100009281
317 Ga0070697_100080427
318 Ga0070672_100083416
319 Ga0070672_100508013
320 Ga0070672_100778485
321 Ga0070672_101451767
322 Ga0070695_100131138
323 Ga0070696_100004742
324 Ga0070696_100079222
325 Ga0070704_100059226
326 Ga0070664_100000515
327 Ga0068857_100107739
328 Ga0068856_100043283
329 Ga0070702_100181979
330 Ga0068859_100052338
331 Ga0068864_100063038
332 Ga0068864_100243427
333 Ga0068858_100334784
334 Ga0068860_101243743
335 Ga0075432_10203263
336 Ga0070716_100034680
337 Ga0075428_100007784
338 Ga0075428_100051230
339 Ga0075428_100358423
340 Ga0075428_100370286
341 Ga0075428_100754858
342 Ga0075430_100004193
343 Ga0075430_100016288
344 Ga0075430_100023525
345 Ga0075431_100114603
346 Ga0075431_100169555
347 Ga0075431_100260621
348 Ga0075431_100558053
349 Ga0075433_10094365
350 Ga0075433_10704195
351 Ga0075434_100010578
352 Ga0075434_100387252
353 Ga0075434_100595618
354 Ga0075429_100001561
355 Ga0075429_100021910
356 Ga0075429_100067219
357 Ga0068865_100044207
358 Ga0068865_100411664
359 Ga0097620_100052338
360 Ga0075435_100064015
361 Ga0099794_10055599
362 Ga0111539_10012461
363 Ga0111539_10013448
364 Ga0111539_10037404
365 Ga0111539_10343053
366 Ga0105247_10085948
367 Ga0105247_10469430
368 Ga0114129_10023995
369 Ga0114129_10027054
370 Ga0114129_10098209
371 Ga0114129_10144102
372 Ga0114129_10510081
373 Ga0114129_11251186
374 Ga0105241_11029157
375 Ga0105248_10066155
376 Ga0105246_10104843
377 Ga0157371_10142640
378 Ga0157374_10397274
379 Ga0157374_10618540
380 Ga0157378_10863568
381 Ga0163162_10109790
382 Ga0163162_10585082
383 Ga0157372_10054565
384 Ga0157372_10700102
385 Ga0157375_10245925
386 Ga0157375_10687829
387 Ga0163163_10014999
388 Ga0163163_10797912
389 Ga0163163_11392207
390 Ga0157380_10397728
391 Ga0157379_10092342
392 Ga0157379_10198281
393 Ga0157376_11095239
394 Ga0207697_10050614
395 Ga0207697_10426793
396 Ga0207688_10038096
397 Ga0207688_10119805
398 Ga0207680_10032870
399 Ga0207699_10512804
400 Ga0207684_10003809
401 Ga0207684_10026019
402 Ga0207654_10903529
403 Ga0207649_10096752
404 Ga0207646_10185256
405 Ga0207681_10354539
406 Ga0207681_10388577
407 Ga0207650_10070577
408 Ga0207650_10433053
409 Ga0207659_10229853
410 Ga0207700_10399394
411 Ga0207670_10649689
412 Ga0207669_10251556
413 Ga0207669_11272709
414 Ga0207704_10129233
415 Ga0207704_10560946
416 Ga0207711_10144880
417 Ga0207689_11051217
418 Ga0207661_10007782
419 Ga0207679_10233602
420 Ga0207668_10886592
421 Ga0207677_11682447
422 Ga0207678_10066505
423 Ga0207676_10059804
424 Ga0207674_10453484
425 Ga0207675_100994468
426 Ga0207683_10589181
427 Ga0207683_10769328
428 Ga0209588_1097232
429 Ga0207428_10006575
430 Ga0207428_10013346
431 Ga0207428_10017377
432 Ga0207428_10112817
433 Ga0307515_10000380
434 Ga0265331_10089364
435 Ga0307408_100007135
436 Ga0307413_10179917
437 Ga0307409_100019049
438 Ga0307409_100367502
439 Ga0307416_100456643
440 Ga0307411_10010723
441 Ga0307411_10534074
442 Ga0307415_100248906
443 Ga0307415_101145845
444 Ga0373945_0514690
445 Ga0373933_0280624
446 Ga0395898_1381393
447 Ga0436360_0929607
448 Ga0436362_0385149
449 Ga0451802_1266120
450 Ga0439441_129960
451 Ga0439464_0000029
452 Ga0439460_0035116
453 Ga0451576_0158159
454 Ga0495584_0297050
455 Ga0495630_0541941
456 Ga0495643_0000597
457 Ga0495642_0232872
458 Ga0495609_0087130
459 Ga0495621_0025767
460 Ga0495625_0087031
461 Ga0495659_0037583
462 Ga0495659_0077953
463 Ga0495623_0310359
464 Ga0495669_0317476
465 Ga0495636_0039282
466 Ga0496100_0257536
467 Ga0496102_0365660
468 Ga0496105_0140368
469 Ga0496106_0102104
470 Ga0496107_0187837
471 Ga0496107_0434641
472 Ga0496108_0010413
473 Ga0496109_0002670
474 Ga0496110_0669295
475 Ga0496112_0006107
476 Ga0501291_065831
477 Ga0501034_1205556
478 Ga0501036_0108321
479 Ga0501038_0536944
480 Ga0501041_0152117
481 Ga0501048_0045047
482 Ga0501071_0309929
483 Ga0501072_0256585
484 Ga0501076_0096800
485 Ga0501233_085799
486 Ga0501242_037963
487 Ga0501221_039762
488 Ga0501225_0035613
489 Ga0501080_0511864
490 Ga0501045_0021546
491 nmdc:mga05p37_175105_c1
492 nmdc:mga05p37_262343_c1
493 nmdc:mga05p37_323431_c1
494 nmdc:mga05p37_325390_c1
495 nmdc:mga05p37_3923_c1
496 nmdc:mga05p37_49846_c1
497 nmdc:mga09592_15599_c1
498 nmdc:mga09592_17709_c1
499 nmdc:mga09592_24099_c1
500 nmdc:mga09592_52303_c1
501 nmdc:mga0qj67_109924_c1
502 nmdc:mga0qj67_412981_c1
503 nmdc:mga06r32_105086_c1
504 nmdc:mga06r32_51320_c1
505 nmdc:mga08y16_18945_c1
506 nmdc:mga08y16_23853_c1
507 nmdc:mga08y16_360025_c1
508 nmdc:mga08y16_570071_c1
509 nmdc:mga0n895_129136_c1
510 nmdc:mga0n895_280940_c1
511 nmdc:mga0n895_611269_c1
512 nmdc:mga0rr50_164559_c1
513 nmdc:mga0rr50_419139_c1
514 nmdc:mga0a205_165377_c1
515 nmdc:mga0a205_187468_c1
516 nmdc:mga0a205_196228_c1
517 nmdc:mga0a205_78886_c1
518 Ga0500622_0163185
519 Ga0501084_0082510
520 Ga0501082_0025686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

17

147

0.92

PF05163

DinB

DinB family

8

170

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8235 2 156
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8037 2 156
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7992 6 155
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.792 4 155
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7841 6 155
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8015 2 156 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7868 2 156 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7857 6 147 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.764 6 147 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7257 4 147 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7Y2JQS3-F1-model_v4 DinB family protein 0.9707 8 140
AF-A0A2V8M1Y3-F1-model_v4 DinB-like domain-containing protein 0.9611 1 131
AF-A0A2V5K5T0-F1-model_v4 Damage-inducible protein DinB 0.9597 1 162
AF-A0A5M8SQ75-F1-model_v4 DinB family protein 0.9562 2 164
AF-A0A2V5K5T0-F1-model_v4 Damage-inducible protein DinB 0.9539 1 162

Map