F369489

General Info

Members Datasets Scaffolds Average Seq Length
260 201 520 261

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10042479|Ga0105251_100424792
Length 272
Sequence MEIELSTLLALALIALLAGFFDAIAGGGGLLTLPALFISGVDPLAAMATNKLQASSASVSAVWAFARKRMIRWRDGLPMAALSFAGGVGGALSISLLDKAILQACAPVLLIAVAGYFALSPKLDEQERKRKVSTACFAATVVPLIGFYDGIFGPGTGSFFMIAFTLLMGQNILQAVSNSKLLNAACNLGALSVFALSGSVIWPLALSMAACAIIGAQAGARCALYFGPRLIKPLLISVCGLMAIKLLLDDGNPIGEWLQQNWVMYSNYWQVN

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
22 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
36 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
52 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
53 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
54 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
55 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
56 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
57 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
58 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
59 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
60 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
63 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
64 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
78 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
82 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
111 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
112 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
113 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
114 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
115 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
121 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
122 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
126 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
127 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
128 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
129 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
130 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
131 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
132 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
133 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
134 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
135 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
136 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
137 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
138 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
139 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
140 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
141 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
142 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
143 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
144 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
145 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
146 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
147 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
148 2643221599 Rhizobium sp. Root708 Isolate Unclassified
149 2643221607 Rhizobium sp. Root73 Isolate Unclassified
150 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
151 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
152 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
153 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
154 2643221688 Rhizobium sp. Root482 Isolate Unclassified
155 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
156 2643221719 Rhizobium sp. Root274 Isolate Unclassified
157 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
158 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
159 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
160 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
161 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
162 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
163 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
164 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
165 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
166 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
167 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
168 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
169 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
170 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
171 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
172 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
173 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
174 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
175 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
176 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
177 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
178 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
179 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
180 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
181 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
182 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
183 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
184 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
185 2996887358 Rhizobium sp. R711 Isolate Nodule
186 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
187 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
188 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
189 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
190 8005258706 Rhizobium sp. R693 Isolate Nodule
191 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
192 8005321885 Rhizobium sp. R72 Isolate Nodule
193 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
194 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
195 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
196 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
197 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
198 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
199 8052494512 Pseudomonas putida LD6 Isolate Unclassified
200 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
201 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.77
Metatranscriptomes 0
Isolates 29.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.69
Nodule 10
Rhizoplane 2.69
Rhizosphere 40.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10042479 3300009011 Bacteria 2206
2 SwRhRL2b_contig_3837701 2162886007 Bacteria 1349
3 JGI25152J39213_1008136 3300002773 Bacteria 2632
4 rootH2_10110541 3300003320 Bacteria 1466
5 Ga0055524_1020105 3300003775 Bacteria 2261
6 Ga0055536_1000910 3300003781 Bacteria 19125
7 Ga0055528_1000646 3300003790 Bacteria 25480
8 Ga0055528_1010265 3300003790 Bacteria 3825
9 Ga0055530_10013058 3300003791 Bacteria 2856
10 Ga0055540_1026230 3300003792 Bacteria 1413
11 Ga0055531_10001529 3300003794 Bacteria 16949
12 Ga0058692_1006370 3300003856 Bacteria 3255
13 Ga0065704_10002524 3300005289 Bacteria 5073
14 Ga0075368_10035347 3300006042 Bacteria 1949
15 Ga0075368_10132812 3300006042 Bacteria 1035
16 Ga0075364_10008051 3300006051 Bacteria 6286
17 Ga0075362_10134821 3300006177 Bacteria 1177
18 Ga0099823_1000360 3300006944 Bacteria 28884
19 Ga0099823_1047219 3300006944 Bacteria 2792
20 Ga0105251_10045563 3300009011 Bacteria 2114
21 Ga0105251_10180284 3300009011 Bacteria 952
22 Ga0105244_10002147 3300009036 Bacteria 15133
23 Ga0105244_10012311 3300009036 Bacteria 5057
24 Ga0105244_10036050 3300009036 Bacteria 2594
25 Ga0105244_10050378 3300009036 Bacteria 2124
26 Ga0105250_10010167 3300009092 Bacteria 3928
27 Ga0105247_10250359 3300009101 Bacteria 1211
28 Ga0157372_10142287 3300013307 Bacteria 2765
29 Ga0209129_1000161 3300025258 Bacteria 102017
30 Ga0209673_1000010 3300025273 Bacteria 596656
31 Ga0209130_1004153 3300025284 Bacteria 5674
32 Ga0209676_1000392 3300025292 Bacteria 79950
33 Ga0209025_1000094 3300025294 Bacteria 241080
34 Ga0209025_1003074 3300025294 Bacteria 16384
35 Ga0209564_1005895 3300025295 Bacteria 6793
36 Ga0209050_1001959 3300025298 Bacteria 19483
37 Ga0209256_1001954 3300025299 Bacteria 18688
38 Ga0209256_1004852 3300025299 Bacteria 8124
39 Ga0209051_1007263 3300025303 Bacteria 6089
40 Ga0209051_1019587 3300025303 Bacteria 2946
41 Ga0209257_1000616 3300025304 Bacteria 57900
42 Ga0207696_1000118 3300025711 Bacteria 147902
43 Ga0207696_1015545 3300025711 Bacteria 2576
44 Ga0207655_1000921 3300025728 Bacteria 30542
45 Ga0207655_1017371 3300025728 Bacteria 3883
46 Ga0207713_1001827 3300025735 Bacteria 16260
47 Ga0207713_1008085 3300025735 Bacteria 6102
48 Ga0207713_1012112 3300025735 Bacteria 4636
49 Ga0207713_1036761 3300025735 Bacteria 2096
50 Ga0207668_10194348 3300025972 Bacteria 1611
51 Ga0209389_1000020 3300027296 Bacteria 172003
52 Ga0209389_1053840 3300027296 Bacteria 2693
53 Ga0209371_1000021 3300027312 Bacteria 555864
54 Ga0209371_1000302 3300027312 Bacteria 55126
55 Ga0209813_10088513 3300027866 Bacteria 1035
56 Ga0307515_10000023 3300028794 Bacteria 400846
57 Ga0307515_10033971 3300028794 Bacteria 8372
58 Ga0307515_10068971 3300028794 Bacteria 4845
59 Ga0268256_1000020 3300030500 Bacteria 557873
60 Ga0268256_1000669 3300030500 Bacteria 26000
61 Ga0307513_10017501 3300031456 Bacteria 8594
62 Ga0307411_10452364 3300032005 Bacteria 1075
63 Ga0373946_0118244 3300035171 Bacteria 1207
64 Ga0373927_0000556 3300035695 Bacteria 28426
65 Ga0373947_0275665 3300035725 Bacteria 1117
66 Ga0373925_0002597 3300037068 Bacteria 14361
67 Ga0395899_0000151 3300037312 Bacteria 105368
68 Ga0395900_0000020 3300037418 Bacteria 353500
69 Ga0395898_0000104 3300037466 Bacteria 223462
70 Ga0395905_0000019 3300037471 Bacteria 353500
71 Ga0395905_0001194 3300037471 Bacteria 32486
72 Ga0395905_0029783 3300037471 Bacteria 5144
73 Ga0395901_0000016 3300038443 Bacteria 354008
74 Ga0400488_16040 3300038741 Bacteria 1159
75 Ga0439438_002027 3300041405 Bacteria 8820
76 Ga0439465_0053713 3300041413 Bacteria 1324
77 Ga0451787_622746 3300041441 Bacteria 1558
78 Ga0451791_0714337 3300041451 Bacteria 2120
79 Ga0451833_0172875 3300041491 Bacteria 4251
80 Ga0451839_0647874 3300041496 Bacteria 4246
81 Ga0451851_0364785 3300041507 Bacteria 3595
82 Ga0451843_1632596 3300041509 Bacteria 1783
83 Ga0451855_0798787 3300041511 Bacteria 1851
84 Ga0451853_2654531 3300041512 Bacteria 5679
85 Ga0439432_001292 3300042006 Bacteria 9470
86 Ga0450900_002557 3300042136 Bacteria 1942
87 Ga0450905_000544 3300042142 Bacteria 4653
88 Ga0495638_0000638 3300046460 Bacteria 38456
89 Ga0495638_0019501 3300046460 Bacteria 4487
90 Ga0495605_0011032 3300046474 Bacteria 5048
91 Ga0495607_0000249 3300046501 Bacteria 57898
92 Ga0495607_0007805 3300046501 Bacteria 7367
93 Ga0495606_0007913 3300046507 Bacteria 9373
94 Ga0495606_0082440 3300046507 Bacteria 1996
95 Ga0495616_0048269 3300046513 Bacteria 2140
96 Ga0495620_0017883 3300046515 Bacteria 3522
97 Ga0495631_0002125 3300046518 Bacteria 11474
98 Ga0495632_0004409 3300046519 Bacteria 9566
99 Ga0495632_0004862 3300046519 Bacteria 9014
100 Ga0495632_0048769 3300046519 Bacteria 2095
101 Ga0495643_0009583 3300046522 Bacteria 6009
102 Ga0495643_0027613 3300046522 Bacteria 3188
103 Ga0495643_0055628 3300046522 Bacteria 2114
104 Ga0495597_0020028 3300046542 Bacteria 3122
105 Ga0495668_0004529 3300046616 Bacteria 9813
106 Ga0495625_0001863 3300046660 Bacteria 23982
107 Ga0495671_0037846 3300046692 Bacteria 2439
108 Ga0495660_0020342 3300046810 Bacteria 3803
109 Ga0495660_0054733 3300046810 Bacteria 2161
110 Ga0495636_0001864 3300047318 Bacteria 8057
111 Ga0495672_0041641 3300047320 Bacteria 2776
112 Ga0495687_010735 3300047443 Bacteria 4995
113 Ga0495685_039110 3300047447 Bacteria 1624
114 Ga0495686_0006004 3300047472 Bacteria 9442
115 Ga0495626_0154769 3300048091 Bacteria 964
116 Ga0496106_0100754 3300048909 Bacteria 2240
117 Ga0496107_0174771 3300048910 Bacteria 1594
118 Ga0496110_0091393 3300048913 Bacteria 2723
119 Ga0496114_0006009 3300048917 Bacteria 9551
120 Ga0496116_0045518 3300048919 Bacteria 2969
121 Ga0496117_0003907 3300048920 Bacteria 16881
122 Ga0496117_0040407 3300048920 Bacteria 3430
123 Ga0496117_0053253 3300048920 Bacteria 2844
124 Ga0496118_0003760 3300048921 Bacteria 18753
125 Ga0496118_0004272 3300048921 Bacteria 17091
126 Ga0496118_0024454 3300048921 Bacteria 5210
127 Ga0496121_0049538 3300048924 Bacteria 3561
128 Ga0496121_0099826 3300048924 Bacteria 2242
129 Ga0496121_0107440 3300048924 Bacteria 2137
130 Ga0496121_0153522 3300048924 Bacteria 1691
131 Ga0496122_0002929 3300048925 Bacteria 23272
132 Ga0496122_0139568 3300048925 Bacteria 1519
133 Ga0496123_0003514 3300048926 Bacteria 17459
134 Ga0496123_0058813 3300048926 Bacteria 2490
135 Ga0496123_0068205 3300048926 Bacteria 2241
136 Ga0496124_0000112 3300048927 Bacteria 166282
137 Ga0496124_0004244 3300048927 Bacteria 16864
138 Ga0496124_0004692 3300048927 Bacteria 15793
139 Ga0496124_0033068 3300048927 Bacteria 4554
140 Ga0496124_0051603 3300048927 Bacteria 3498
141 Ga0496124_0056006 3300048927 Bacteria 3328
142 Ga0496124_0069035 3300048927 Bacteria 2935
143 Ga0496125_0000001 3300048928 Bacteria 1766138
144 Ga0496125_0004780 3300048928 Bacteria 15422
145 Ga0496125_0024368 3300048928 Bacteria 5566
146 Ga0496125_0035232 3300048928 Bacteria 4396
147 Ga0496126_0018460 3300048929 Bacteria 6911
148 Ga0496126_0032771 3300048929 Bacteria 4892
149 Ga0496126_0113907 3300048929 Bacteria 2353
150 Ga0496126_0240576 3300048929 Bacteria 1512
151 Ga0495678_010175 3300049459 Bacteria 4585
152 Ga0495682_0012754 3300049460 Bacteria 3215
153 Ga0501033_0000167 3300049570 Bacteria 63051
154 Ga0501033_0265011 3300049570 Bacteria 1215
155 Ga0501034_0088815 3300049571 Bacteria 3088
156 Ga0501036_0085620 3300049572 Bacteria 2664
157 Ga0501036_0150660 3300049572 Bacteria 1962
158 Ga0501037_0121624 3300049573 Bacteria 1876
159 Ga0501037_0186896 3300049573 Bacteria 1468
160 Ga0501038_0322958 3300049574 Bacteria 1207
161 Ga0501039_0049226 3300049575 Bacteria 3258
162 Ga0501073_0250396 3300049589 Bacteria 1223
163 Ga0501080_0388066 3300049742 Bacteria 1257
164 Ga0501280_000672 3300049776 Bacteria 7593
165 nmdc:mga06z11_80712_c1 3300050494 Bacteria 1744
166 Ga0500578_0128827 3300053086 Bacteria 1587
167 Ga0500646_0025606 3300053090 Bacteria 1595
168 Ga0500557_007602 3300053105 Bacteria 2540
169 Ga0500569_001435 3300053109 Bacteria 4494
170 Ga0500569_002151 3300053109 Bacteria 3836
171 Ga0500594_0004602 3300053118 Bacteria 3043
172 Ga0500618_028530 3300053125 Bacteria 1321
173 Ga0500652_043826 3300053131 Bacteria 1810
174 Ga0500658_0000720 3300053134 Bacteria 13662
175 Ga0500659_0002191 3300053135 Bacteria 11865
176 Ga0500659_0080542 3300053135 Bacteria 1712
177 Ga0500568_0010659 3300053139 Bacteria 4293
178 Ga0500573_0002818 3300053140 Bacteria 8815
179 Ga0500573_0084762 3300053140 Bacteria 1797
180 Ga0500577_0085656 3300053142 Bacteria 1265
181 Ga0500588_0008176 3300053146 Bacteria 2434
182 Ga0500616_0001219 3300053153 Bacteria 25876
183 Ga0500622_0003000 3300053156 Bacteria 11685
184 Ga0500627_0136972 3300053158 Bacteria 1106
185 2513594717 2513237088 Bacteria 6927906
186 2513926040 2513237146 Bacteria 7166346
187 2513997038 2513237159 Bacteria 6810126
188 2514038271 2513237164 Bacteria 7563725
189 2523470781 2523231067 Bacteria 5230452
190 2535516632 2534681796 Bacteria 7146037
191 2585166163 2582581283 Bacteria 6030556
192 2585222668 2582581298 Bacteria 7315509
193 2585267632 2582581306 Bacteria 6450535
194 2585270976 2582581307 Bacteria 6597605
195 2585386691 2582581865 Bacteria 6644329
196 2585393075 2582581866 Bacteria 6859583
197 2585545251 2585427529 Bacteria 7395659
198 2585558700 2585427531 Bacteria 6992870
199 2585843006 2585427594 Bacteria 6180594
200 2585898065 2585427608 Bacteria 6544331
201 2585904330 2585427609 Bacteria 6667127
202 2587980553 2585428125 Bacteria 6662905
203 2599417516 2599185170 Bacteria 7295545
204 2617385801 2617270742 Bacteria 6808054
205 2643773727 2643221550 Bacteria 4619371
206 2643837472 2643221564 Bacteria 4193379
207 2644003902 2643221599 Bacteria 6292121
208 2644050704 2643221607 Bacteria 6314006
209 2644129118 2643221623 Bacteria 5239945
210 2644205178 2643221636 Bacteria 6583769
211 2644300278 2643221653 Bacteria 4569637
212 2644483622 2643221686 Bacteria 6310811
213 2644491823 2643221688 Bacteria 5260751
214 2644501378 2643221689 Bacteria 6042950
215 2644658504 2643221719 Bacteria 4568197
216 2671111598 2667528174 Bacteria 6435400
217 2739349014 2738543031 Bacteria 5769731
218 2776270775 2775506902 Bacteria 6208009
219 2776280402 2775506904 Bacteria 5954060
220 2776913588 2775507049 Bacteria 6284736
221 2778174139 2775507266 Bacteria 7392367
222 2819242104 2818991272 Bacteria 4622173
223 2819559862 2818991439 Bacteria 6907412
224 2819608985 2818991448 Bacteria 6772224
225 2837653325 2837651117 Bacteria 3772164
226 2838029969 2838029111 Bacteria 6603031
227 2838038271 2838035591 Bacteria 7166484
228 2838661852 2838661181 Bacteria 7385261
229 2840767578 2840764183 Bacteria 6358399
230 2842476746 2842475841 Bacteria 6603183
231 2842484715 2842482326 Bacteria 7212537
232 2842503497 2842502639 Bacteria 6604161
233 2842522720 2842521101 Bacteria 6569494
234 2852390029 2852387548 Bacteria 8025568
235 2891373192 2891373044 Bacteria 5202277
236 2912968504 2912963787 Bacteria 5646108
237 2919411569 2919408235 Bacteria 6149349
238 2929139850 2929138655 Bacteria 5810547
239 2939654576 2939651529 Bacteria 5895393
240 2954016004 2954011201 Bacteria 4762601
241 2989778619 2989776772 Bacteria 4843317
242 2996310583 2996310559 Bacteria 6357320
243 2996341039 2996336353 Bacteria 5511628
244 2996891847 2996887358 Bacteria 5795980
245 3003933814 3003930520 Bacteria 5667563
246 3005414954 3005409236 Bacteria 7188837
247 8002288762 8002285264 Bacteria 6717907
248 8005250881 8005246636 Bacteria 4933972
249 8005263178 8005258706 Bacteria 6184835
250 8005316933 8005314921 Bacteria 7072929
251 8005326374 8005321885 Bacteria 5795980
252 8005485269 8005484373 Bacteria 6297373
253 8005545290 8005542996 Bacteria 7077758
254 8005557540 8005556819 Bacteria 6908598
255 8005649746 8005645114 Bacteria 6950293
256 8005659509 8005658619 Bacteria 4500593
257 8005683062 8005682033 Bacteria 6726518
258 8052499451 8052494512 Bacteria 5765634
259 8054561207 8054558443 Bacteria 5204801
260 8054933545 8054929484 Bacteria 5599761
261 Ga0105251_10042479
262 SwRhRL2b_contig_3837701
263 JGI25152J39213_1008136
264 rootH2_10110541
265 Ga0055524_1020105
266 Ga0055536_1000910
267 Ga0055528_1000646
268 Ga0055528_1010265
269 Ga0055530_10013058
270 Ga0055540_1026230
271 Ga0055531_10001529
272 Ga0058692_1006370
273 Ga0065704_10002524
274 Ga0075368_10035347
275 Ga0075368_10132812
276 Ga0075364_10008051
277 Ga0075362_10134821
278 Ga0099823_1000360
279 Ga0099823_1047219
280 Ga0105251_10045563
281 Ga0105251_10180284
282 Ga0105244_10002147
283 Ga0105244_10012311
284 Ga0105244_10036050
285 Ga0105244_10050378
286 Ga0105250_10010167
287 Ga0105247_10250359
288 Ga0157372_10142287
289 Ga0209129_1000161
290 Ga0209673_1000010
291 Ga0209130_1004153
292 Ga0209676_1000392
293 Ga0209025_1000094
294 Ga0209025_1003074
295 Ga0209564_1005895
296 Ga0209050_1001959
297 Ga0209256_1001954
298 Ga0209256_1004852
299 Ga0209051_1007263
300 Ga0209051_1019587
301 Ga0209257_1000616
302 Ga0207696_1000118
303 Ga0207696_1015545
304 Ga0207655_1000921
305 Ga0207655_1017371
306 Ga0207713_1001827
307 Ga0207713_1008085
308 Ga0207713_1012112
309 Ga0207713_1036761
310 Ga0207668_10194348
311 Ga0209389_1000020
312 Ga0209389_1053840
313 Ga0209371_1000021
314 Ga0209371_1000302
315 Ga0209813_10088513
316 Ga0307515_10000023
317 Ga0307515_10033971
318 Ga0307515_10068971
319 Ga0268256_1000020
320 Ga0268256_1000669
321 Ga0307513_10017501
322 Ga0307411_10452364
323 Ga0373946_0118244
324 Ga0373927_0000556
325 Ga0373947_0275665
326 Ga0373925_0002597
327 Ga0395899_0000151
328 Ga0395900_0000020
329 Ga0395898_0000104
330 Ga0395905_0000019
331 Ga0395905_0001194
332 Ga0395905_0029783
333 Ga0395901_0000016
334 Ga0400488_16040
335 Ga0439438_002027
336 Ga0439465_0053713
337 Ga0451787_622746
338 Ga0451791_0714337
339 Ga0451833_0172875
340 Ga0451839_0647874
341 Ga0451851_0364785
342 Ga0451843_1632596
343 Ga0451855_0798787
344 Ga0451853_2654531
345 Ga0439432_001292
346 Ga0450900_002557
347 Ga0450905_000544
348 Ga0495638_0000638
349 Ga0495638_0019501
350 Ga0495605_0011032
351 Ga0495607_0000249
352 Ga0495607_0007805
353 Ga0495606_0007913
354 Ga0495606_0082440
355 Ga0495616_0048269
356 Ga0495620_0017883
357 Ga0495631_0002125
358 Ga0495632_0004409
359 Ga0495632_0004862
360 Ga0495632_0048769
361 Ga0495643_0009583
362 Ga0495643_0027613
363 Ga0495643_0055628
364 Ga0495597_0020028
365 Ga0495668_0004529
366 Ga0495625_0001863
367 Ga0495671_0037846
368 Ga0495660_0020342
369 Ga0495660_0054733
370 Ga0495636_0001864
371 Ga0495672_0041641
372 Ga0495687_010735
373 Ga0495685_039110
374 Ga0495686_0006004
375 Ga0495626_0154769
376 Ga0496106_0100754
377 Ga0496107_0174771
378 Ga0496110_0091393
379 Ga0496114_0006009
380 Ga0496116_0045518
381 Ga0496117_0003907
382 Ga0496117_0040407
383 Ga0496117_0053253
384 Ga0496118_0003760
385 Ga0496118_0004272
386 Ga0496118_0024454
387 Ga0496121_0049538
388 Ga0496121_0099826
389 Ga0496121_0107440
390 Ga0496121_0153522
391 Ga0496122_0002929
392 Ga0496122_0139568
393 Ga0496123_0003514
394 Ga0496123_0058813
395 Ga0496123_0068205
396 Ga0496124_0000112
397 Ga0496124_0004244
398 Ga0496124_0004692
399 Ga0496124_0033068
400 Ga0496124_0051603
401 Ga0496124_0056006
402 Ga0496124_0069035
403 Ga0496125_0000001
404 Ga0496125_0004780
405 Ga0496125_0024368
406 Ga0496125_0035232
407 Ga0496126_0018460
408 Ga0496126_0032771
409 Ga0496126_0113907
410 Ga0496126_0240576
411 Ga0495678_010175
412 Ga0495682_0012754
413 Ga0501033_0000167
414 Ga0501033_0265011
415 Ga0501034_0088815
416 Ga0501036_0085620
417 Ga0501036_0150660
418 Ga0501037_0121624
419 Ga0501037_0186896
420 Ga0501038_0322958
421 Ga0501039_0049226
422 Ga0501073_0250396
423 Ga0501080_0388066
424 Ga0501280_000672
425 nmdc:mga06z11_80712_c1
426 Ga0500578_0128827
427 Ga0500646_0025606
428 Ga0500557_007602
429 Ga0500569_001435
430 Ga0500569_002151
431 Ga0500594_0004602
432 Ga0500618_028530
433 Ga0500652_043826
434 Ga0500658_0000720
435 Ga0500659_0002191
436 Ga0500659_0080542
437 Ga0500568_0010659
438 Ga0500573_0002818
439 Ga0500573_0084762
440 Ga0500577_0085656
441 Ga0500588_0008176
442 Ga0500616_0001219
443 Ga0500622_0003000
444 Ga0500627_0136972
445 2513594717
446 2513926040
447 2513997038
448 2514038271
449 2523470781
450 2535516632
451 2585166163
452 2585222668
453 2585267632
454 2585270976
455 2585386691
456 2585393075
457 2585545251
458 2585558700
459 2585843006
460 2585898065
461 2585904330
462 2587980553
463 2599417516
464 2617385801
465 2643773727
466 2643837472
467 2644003902
468 2644050704
469 2644129118
470 2644205178
471 2644300278
472 2644483622
473 2644491823
474 2644501378
475 2644658504
476 2671111598
477 2739349014
478 2776270775
479 2776280402
480 2776913588
481 2778174139
482 2819242104
483 2819559862
484 2819608985
485 2837653325
486 2838029969
487 2838038271
488 2838661852
489 2840767578
490 2842476746
491 2842484715
492 2842503497
493 2842522720
494 2852390029
495 2891373192
496 2912968504
497 2919411569
498 2929139850
499 2939654576
500 2954016004
501 2989778619
502 2996310583
503 2996341039
504 2996891847
505 3003933814
506 3005414954
507 8002288762
508 8005250881
509 8005263178
510 8005316933
511 8005326374
512 8005485269
513 8005545290
514 8005557540
515 8005649746
516 8005659509
517 8005683062
518 8052499451
519 8054561207
520 8054933545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

11

246

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.6691 7 246
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.6364 7 246
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6037 7 246
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5501 7 246
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.3909 42 253
ID Description Score Start End Superfamily
af_Q04602_243_516_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4491 30 247 1.20.1250.20
af_Q2G2W1_141_346_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4362 15 249 1.20.1250.20
af_A4HWI5_56_312_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4226 42 246 1.20.1250.20
af_Q2FYJ5_15_251_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4201 12 246 1.20.1250.20
af_A4I8Z5_294_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4099 47 246 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1X9SN19-F1-model_v4 Probable membrane transporter protein 0.9743 1 248 GO:0005886
AF-A0A351WYG9-F1-model_v4 Probable membrane transporter protein 0.9716 2 246 GO:0005886
AF-A0A6M3HSH0-F1-model_v4 Probable membrane transporter protein 0.9646 8 250 GO:0005886
AF-A0A3P3DXB1-F1-model_v4 Probable membrane transporter protein 0.9586 2 247 GO:0005886
AF-A0A7C2LH96-F1-model_v4 Probable membrane transporter protein 0.9581 2 246 GO:0005886

Map