F369441

General Info

Members Datasets Scaffolds Average Seq Length
260 164 520 231

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10173061|Ga0081455_101730612
Length 258
Sequence VPGGGRRRRPYARSVGQRILVVDDDPTVSDVVRRYLERAGFDVVLAADGPTALAAYAREQPDLVVLDLMLPGMDGLEVCRRLRANSDGLPIVMLTALGEESDRVLGLQLGADDYVTKPFSPRELVLRVQSVLRRAGAVAASVDPGTTGEVLRDGDLMVDTARRVAMRGDGELALTVREFDLLAYLMSHPGRAFRRSELLEAVWGWTFGDQSTVTVHVRRLREKIEDDPAHPRRIVTVWGVGYRFEAANRTGDEGRLRA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
157 2818991450 Burkholderia sp. 604 Isolate Unclassified
158 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
159 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
160 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
161 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
162 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
163 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
164 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 2.31
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 6.92
Rhizosphere 81.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10173061 3300005937 Bacteria 1642
2 Ga0070658_10017753 3300005327 Bacteria 5691
3 Ga0070658_10037123 3300005327 Bacteria 3926
4 Ga0070683_100014298 3300005329 Bacteria 6940
5 Ga0070683_100110267 3300005329 Bacteria 2596
6 Ga0070683_100119873 3300005329 Bacteria 2485
7 Ga0070683_100187271 3300005329 Bacteria 1965
8 Ga0068869_100015060 3300005334 Bacteria 5177
9 Ga0070680_100006550 3300005336 Bacteria 8857
10 Ga0070682_100056841 3300005337 Bacteria 2462
11 Ga0070682_100091644 3300005337 Bacteria 1990
12 Ga0068868_100013323 3300005338 Bacteria 6027
13 Ga0070660_100032206 3300005339 Bacteria 3944
14 Ga0070660_100061724 3300005339 Bacteria 2910
15 Ga0070691_10236605 3300005341 Bacteria 974
16 Ga0070661_100027046 3300005344 Bacteria 4129
17 Ga0070692_10267900 3300005345 Bacteria 1030
18 Ga0070668_100000248 3300005347 Bacteria 35756
19 Ga0070668_100422106 3300005347 Bacteria 1142
20 Ga0070659_100027497 3300005366 Bacteria 4383
21 Ga0070659_100222272 3300005366 Bacteria 1559
22 Ga0070667_100123231 3300005367 Bacteria 2257
23 Ga0070709_10124233 3300005434 Bacteria 1753
24 Ga0070714_100630793 3300005435 Bacteria 1031
25 Ga0070714_100950019 3300005435 Bacteria 835
26 Ga0070713_100140915 3300005436 Bacteria 2136
27 Ga0070713_100479421 3300005436 Bacteria 1171
28 Ga0070700_100130330 3300005441 Bacteria 1696
29 Ga0070700_100204151 3300005441 Bacteria 1390
30 Ga0070663_100032906 3300005455 Bacteria 3578
31 Ga0070662_100020075 3300005457 Bacteria 4548
32 Ga0070681_10015898 3300005458 Bacteria 7503
33 Ga0070679_100023746 3300005530 Bacteria 6007
34 Ga0070684_100010783 3300005535 Bacteria 7257
35 Ga0070684_100025972 3300005535 Bacteria 4929
36 Ga0070684_100164353 3300005535 Bacteria 2014
37 Ga0070665_100017808 3300005548 Bacteria 7132
38 Ga0068855_100349880 3300005563 Bacteria 1628
39 Ga0070664_100017722 3300005564 Bacteria 5850
40 Ga0068857_100439310 3300005577 Bacteria 1219
41 Ga0068852_100291703 3300005616 Bacteria 1576
42 Ga0068864_100050585 3300005618 Bacteria 3577
43 Ga0068863_100005613 3300005841 Bacteria 12330
44 Ga0068863_100322144 3300005841 Bacteria 1502
45 Ga0068860_100032966 3300005843 Bacteria 4974
46 Ga0068862_100132367 3300005844 Bacteria 2207
47 Ga0068862_100250836 3300005844 Bacteria 1613
48 Ga0081455_10060381 3300005937 Bacteria 3196
49 Ga0081540_1008354 3300005983 Bacteria 7236
50 Ga0081539_10003473 3300005985 Bacteria 19258
51 Ga0081539_10018857 3300005985 Bacteria 4755
52 Ga0075365_10163043 3300006038 Bacteria 1554
53 Ga0111539_10081466 3300009094 Bacteria 3807
54 Ga0105245_10008294 3300009098 Bacteria 9075
55 Ga0114129_10093439 3300009147 Bacteria 4166
56 Ga0114129_10962594 3300009147 Bacteria 1077
57 Ga0105243_10176855 3300009148 Bacteria 1853
58 Ga0105248_10819293 3300009177 Bacteria 1050
59 Ga0105246_10100487 3300011119 Bacteria 2105
60 Ga0157369_10004938 3300013105 Bacteria 15623
61 Ga0157369_10021731 3300013105 Bacteria 7177
62 Ga0157374_10746419 3300013296 Bacteria 993
63 Ga0163162_10152335 3300013306 Bacteria 2430
64 Ga0163162_10301325 3300013306 Bacteria 1735
65 Ga0157372_10440171 3300013307 Bacteria 1519
66 Ga0157372_10838916 3300013307 Bacteria 1067
67 Ga0163163_10388849 3300014325 Bacteria 1453
68 Ga0157377_10007661 3300014745 Bacteria 5228
69 Ga0206356_10799376 3300020070 Bacteria 1529
70 Ga0206356_11707938 3300020070 Bacteria 2261
71 Ga0206354_10068305 3300020081 Bacteria 1600
72 Ga0206353_10056788 3300020082 Bacteria 2040
73 Ga0206353_10564429 3300020082 Bacteria 6651
74 Ga0224712_10012652 3300022467 Bacteria 2662
75 Ga0207680_10179168 3300025903 Bacteria 1432
76 Ga0207643_10160116 3300025908 Bacteria 1354
77 Ga0207705_10045802 3300025909 Bacteria 3143
78 Ga0207705_10077348 3300025909 Bacteria 2420
79 Ga0207707_10008466 3300025912 Bacteria 8918
80 Ga0207707_10103858 3300025912 Bacteria 2484
81 Ga0207663_10068315 3300025916 Bacteria 2282
82 Ga0207660_10059066 3300025917 Bacteria 2752
83 Ga0207660_10099257 3300025917 Bacteria 2172
84 Ga0207662_10039131 3300025918 Bacteria 2781
85 Ga0207657_10026480 3300025919 Bacteria 5328
86 Ga0207657_10141916 3300025919 Bacteria 1962
87 Ga0207649_10121427 3300025920 Bacteria 1762
88 Ga0207649_10158199 3300025920 Bacteria 1567
89 Ga0207652_10123607 3300025921 Bacteria 2304
90 Ga0207659_10027071 3300025926 Bacteria 3877
91 Ga0207687_10052456 3300025927 Bacteria 2846
92 Ga0207700_10162544 3300025928 Bacteria 1855
93 Ga0207700_10253387 3300025928 Bacteria 1504
94 Ga0207664_10481964 3300025929 Bacteria 1110
95 Ga0207664_10492787 3300025929 Bacteria 1097
96 Ga0207664_10514731 3300025929 Bacteria 1072
97 Ga0207690_10173917 3300025932 Bacteria 1615
98 Ga0207690_10180377 3300025932 Bacteria 1589
99 Ga0207706_10077704 3300025933 Bacteria 2919
100 Ga0207689_10024156 3300025942 Bacteria 5099
101 Ga0207689_10551974 3300025942 Bacteria 968
102 Ga0207661_10009803 3300025944 Bacteria 6879
103 Ga0207661_10049904 3300025944 Bacteria 3333
104 Ga0207661_10060791 3300025944 Bacteria 3050
105 Ga0207661_10233999 3300025944 Bacteria 1628
106 Ga0207661_10619858 3300025944 Bacteria 993
107 Ga0207679_10005743 3300025945 Bacteria 7786
108 Ga0207668_10011018 3300025972 Bacteria 5484
109 Ga0207668_10325418 3300025972 Bacteria 1277
110 Ga0207658_10082340 3300025986 Bacteria 2471
111 Ga0207677_10007432 3300026023 Bacteria 6060
112 Ga0207678_10048349 3300026067 Bacteria 3677
113 Ga0207708_10064257 3300026075 Bacteria 2803
114 Ga0207641_10015485 3300026088 Bacteria 6248
115 Ga0207676_10121804 3300026095 Bacteria 2201
116 Ga0207674_10030235 3300026116 Bacteria 5696
117 Ga0207674_10057611 3300026116 Bacteria 3938
118 Ga0207674_10171387 3300026116 Bacteria 2124
119 Ga0207674_10465744 3300026116 Bacteria 1221
120 Ga0207675_100691352 3300026118 Bacteria 1028
121 Ga0207698_10070987 3300026142 Bacteria 2762
122 Ga0207428_10024942 3300027907 Bacteria 5014
123 Ga0268266_10270725 3300028379 Bacteria 1577
124 Ga0268266_10368676 3300028379 Bacteria 1352
125 Ga0268265_10225050 3300028380 Bacteria 1644
126 Ga0268264_10147757 3300028381 Bacteria 2104
127 Ga0307515_10000192 3300028794 Bacteria 149030
128 Ga0307515_10024235 3300028794 Bacteria 10583
129 Ga0307515_10032618 3300028794 Bacteria 8618
130 Ga0307515_10035142 3300028794 Bacteria 8167
131 Ga0265338_10001934 3300028800 Bacteria 32315
132 Ga0307512_10007737 3300030522 Bacteria 10577
133 Ga0307513_10031276 3300031456 Bacteria 6031
134 Ga0307513_10035921 3300031456 Bacteria 5539
135 Ga0307513_10125483 3300031456 Bacteria 2523
136 Ga0307513_10327064 3300031456 Bacteria 1289
137 Ga0307509_10232136 3300031507 Bacteria 1647
138 Ga0307508_10041227 3300031616 Bacteria 4144
139 Ga0307508_10088669 3300031616 Bacteria 2678
140 Ga0316579_10129417 3300031691 Bacteria 1215
141 Ga0316576_10135364 3300031727 Bacteria 1854
142 Ga0307516_10001127 3300031730 Bacteria 37233
143 Ga0307516_10009559 3300031730 Bacteria 10801
144 Ga0307516_10011284 3300031730 Bacteria 9733
145 Ga0307516_10012765 3300031730 Bacteria 9031
146 Ga0307516_10031533 3300031730 Bacteria 5342
147 Ga0307405_10215933 3300031731 Bacteria 1404
148 Ga0307413_10027049 3300031824 Bacteria 3172
149 Ga0307413_10376394 3300031824 Bacteria 1105
150 Ga0307410_10007758 3300031852 Bacteria 5899
151 Ga0307406_10012087 3300031901 Bacteria 4913
152 Ga0307406_10041811 3300031901 Bacteria 2858
153 Ga0307406_10055390 3300031901 Bacteria 2535
154 Ga0307406_10269143 3300031901 Bacteria 1293
155 Ga0307407_10011295 3300031903 Bacteria 4246
156 Ga0307412_10253054 3300031911 Bacteria 1369
157 Ga0307412_10306058 3300031911 Bacteria 1258
158 Ga0307409_100033544 3300031995 Bacteria 3737
159 Ga0307409_100125900 3300031995 Bacteria 2179
160 Ga0307409_100669257 3300031995 Bacteria 1034
161 Ga0307416_100001039 3300032002 Bacteria 14755
162 Ga0307416_100055409 3300032002 Bacteria 3193
163 Ga0307416_100760619 3300032002 Bacteria 1062
164 Ga0307416_101488714 3300032002 Bacteria 783
165 Ga0307415_100000041 3300032126 Bacteria 55710
166 Ga0307415_100050083 3300032126 Bacteria 2828
167 Ga0307415_100433856 3300032126 Bacteria 1131
168 Ga0307415_100563947 3300032126 Bacteria 1007
169 Ga0316583_10010087 3300032133 Bacteria 3403
170 Ga0316585_10008007 3300032137 Bacteria 3056
171 Ga0307507_10023600 3300033179 Bacteria 6743
172 Ga0373962_0001687 3300035242 Bacteria 5248
173 Ga0316574_0002423 3300035398 Bacteria 9359
174 Ga0316574_0161186 3300035398 Bacteria 1444
175 Ga0373935_0003276 3300035692 Bacteria 9362
176 Ga0373925_0000231 3300037068 Bacteria 59007
177 Ga0395899_0021598 3300037312 Bacteria 4881
178 Ga0395899_0045108 3300037312 Bacteria 3284
179 Ga0395900_0003211 3300037418 Bacteria 17702
180 Ga0395900_0028102 3300037418 Bacteria 5759
181 Ga0395900_0051142 3300037418 Bacteria 4257
182 Ga0395900_0061202 3300037418 Bacteria 3871
183 Ga0395900_0734630 3300037418 Bacteria 918
184 Ga0395898_0005286 3300037466 Bacteria 13958
185 Ga0395898_0019507 3300037466 Bacteria 6899
186 Ga0395898_0061935 3300037466 Bacteria 3634
187 Ga0395905_0010970 3300037471 Bacteria 8770
188 Ga0395905_0016463 3300037471 Bacteria 7028
189 Ga0395905_0019666 3300037471 Bacteria 6399
190 Ga0395905_0124199 3300037471 Bacteria 2427
191 Ga0395905_0273139 3300037471 Bacteria 1576
192 Ga0316581_0128420 3300037588 Bacteria 781
193 Ga0395901_0002828 3300038443 Bacteria 17525
194 Ga0395901_0015699 3300038443 Bacteria 7714
195 Ga0395901_0030627 3300038443 Bacteria 5544
196 Ga0395901_0052969 3300038443 Bacteria 4217
197 Ga0395901_0143102 3300038443 Bacteria 2513
198 Ga0395901_0329151 3300038443 Bacteria 1580
199 Ga0395901_1048835 3300038443 Bacteria 788
200 Ga0436365_0196110 3300039437 Bacteria 1818
201 Ga0451795_1217093 3300041456 Bacteria 757
202 Ga0495629_0042911 3300046459 Bacteria 3177
203 Ga0495629_0070831 3300046459 Bacteria 2433
204 Ga0495594_0049882 3300046499 Bacteria 2301
205 Ga0495594_0142133 3300046499 Bacteria 1362
206 Ga0495606_0124752 3300046507 Bacteria 1537
207 Ga0495616_0065438 3300046513 Bacteria 1771
208 Ga0496104_0083745 3300048907 Bacteria 3042
209 Ga0496104_0204428 3300048907 Bacteria 1887
210 Ga0496104_0799265 3300048907 Bacteria 849
211 Ga0496105_0300694 3300048908 Bacteria 1290
212 Ga0496105_0461726 3300048908 Bacteria 1001
213 Ga0496108_0106653 3300048911 Bacteria 2392
214 Ga0496109_0016011 3300048912 Bacteria 6553
215 Ga0496109_0172761 3300048912 Bacteria 2028
216 Ga0496109_0536318 3300048912 Bacteria 1104
217 Ga0496110_0011601 3300048913 Bacteria 7224
218 Ga0496110_0111753 3300048913 Bacteria 2456
219 Ga0496110_0134352 3300048913 Bacteria 2235
220 Ga0496111_0105248 3300048914 Bacteria 2076
221 Ga0496111_0117650 3300048914 Bacteria 1961
222 Ga0496112_0021045 3300048915 Bacteria 6195
223 Ga0496112_0279066 3300048915 Bacteria 1618
224 Ga0496114_0052741 3300048917 Bacteria 3388
225 Ga0496126_0006492 3300048929 Bacteria 13018
226 Ga0501031_0097966 3300049568 Bacteria 1914
227 Ga0501032_0035378 3300049569 Bacteria 3415
228 Ga0501034_0468706 3300049571 Bacteria 1176
229 Ga0501037_0044481 3300049573 Bacteria 3261
230 Ga0501043_0136454 3300049579 Bacteria 1922
231 Ga0501046_0005552 3300049580 Bacteria 11269
232 Ga0501047_0072483 3300049581 Bacteria 3315
233 Ga0501068_0274377 3300049584 Bacteria 1077
234 Ga0501069_0007880 3300049585 Bacteria 5591
235 Ga0501071_0123860 3300049587 Bacteria 1917
236 Ga0501072_0052488 3300049588 Bacteria 3210
237 Ga0501074_0415608 3300049590 Bacteria 954
238 Ga0501035_0223292 3300049822 Bacteria 1608
239 Ga0501044_0304661 3300049823 Bacteria 1521
240 Ga0501044_0478269 3300049823 Bacteria 1149
241 nmdc:mga0yw44_361227_c1 3300050492 Bacteria 979
242 nmdc:mga05p37_199325_c1 3300050507 Bacteria 2425
243 nmdc:mga06r32_991655_c1 3300050510 Bacteria 793
244 nmdc:mga08y16_38347_c1 3300050511 Bacteria 5032
245 Ga0500646_0000561 3300053090 Bacteria 10699
246 Ga0500579_046729 3300053143 Bacteria 2678
247 Ga0500588_0004394 3300053146 Bacteria 3054
248 Ga0500600_0052127 3300053149 Bacteria 2316
249 Ga0500604_0097336 3300053151 Bacteria 967
250 Ga0501082_0077492 3300060353 Bacteria 2866
251 Ga0530510_0673255 3300061734 Bacteria 788
252 2753263081 2751185782 Bacteria 11227053
253 2819625004 2818991450 Bacteria 6962147
254 2831939094 2831935698 Bacteria 5963223
255 2867512430 2867507094 Bacteria 6506033
256 2928109053 2928108538 Bacteria 7360024
257 2928136276 2928135762 Bacteria 7259641
258 2928503942 2928503688 Bacteria 7268108
259 8001783876 8001781756 Bacteria 9586736
260 8057569521 8057568493 Bacteria 7221719
261 Ga0081455_10173061
262 Ga0070658_10017753
263 Ga0070658_10037123
264 Ga0070683_100014298
265 Ga0070683_100110267
266 Ga0070683_100119873
267 Ga0070683_100187271
268 Ga0068869_100015060
269 Ga0070680_100006550
270 Ga0070682_100056841
271 Ga0070682_100091644
272 Ga0068868_100013323
273 Ga0070660_100032206
274 Ga0070660_100061724
275 Ga0070691_10236605
276 Ga0070661_100027046
277 Ga0070692_10267900
278 Ga0070668_100000248
279 Ga0070668_100422106
280 Ga0070659_100027497
281 Ga0070659_100222272
282 Ga0070667_100123231
283 Ga0070709_10124233
284 Ga0070714_100630793
285 Ga0070714_100950019
286 Ga0070713_100140915
287 Ga0070713_100479421
288 Ga0070700_100130330
289 Ga0070700_100204151
290 Ga0070663_100032906
291 Ga0070662_100020075
292 Ga0070681_10015898
293 Ga0070679_100023746
294 Ga0070684_100010783
295 Ga0070684_100025972
296 Ga0070684_100164353
297 Ga0070665_100017808
298 Ga0068855_100349880
299 Ga0070664_100017722
300 Ga0068857_100439310
301 Ga0068852_100291703
302 Ga0068864_100050585
303 Ga0068863_100005613
304 Ga0068863_100322144
305 Ga0068860_100032966
306 Ga0068862_100132367
307 Ga0068862_100250836
308 Ga0081455_10060381
309 Ga0081540_1008354
310 Ga0081539_10003473
311 Ga0081539_10018857
312 Ga0075365_10163043
313 Ga0111539_10081466
314 Ga0105245_10008294
315 Ga0114129_10093439
316 Ga0114129_10962594
317 Ga0105243_10176855
318 Ga0105248_10819293
319 Ga0105246_10100487
320 Ga0157369_10004938
321 Ga0157369_10021731
322 Ga0157374_10746419
323 Ga0163162_10152335
324 Ga0163162_10301325
325 Ga0157372_10440171
326 Ga0157372_10838916
327 Ga0163163_10388849
328 Ga0157377_10007661
329 Ga0206356_10799376
330 Ga0206356_11707938
331 Ga0206354_10068305
332 Ga0206353_10056788
333 Ga0206353_10564429
334 Ga0224712_10012652
335 Ga0207680_10179168
336 Ga0207643_10160116
337 Ga0207705_10045802
338 Ga0207705_10077348
339 Ga0207707_10008466
340 Ga0207707_10103858
341 Ga0207663_10068315
342 Ga0207660_10059066
343 Ga0207660_10099257
344 Ga0207662_10039131
345 Ga0207657_10026480
346 Ga0207657_10141916
347 Ga0207649_10121427
348 Ga0207649_10158199
349 Ga0207652_10123607
350 Ga0207659_10027071
351 Ga0207687_10052456
352 Ga0207700_10162544
353 Ga0207700_10253387
354 Ga0207664_10481964
355 Ga0207664_10492787
356 Ga0207664_10514731
357 Ga0207690_10173917
358 Ga0207690_10180377
359 Ga0207706_10077704
360 Ga0207689_10024156
361 Ga0207689_10551974
362 Ga0207661_10009803
363 Ga0207661_10049904
364 Ga0207661_10060791
365 Ga0207661_10233999
366 Ga0207661_10619858
367 Ga0207679_10005743
368 Ga0207668_10011018
369 Ga0207668_10325418
370 Ga0207658_10082340
371 Ga0207677_10007432
372 Ga0207678_10048349
373 Ga0207708_10064257
374 Ga0207641_10015485
375 Ga0207676_10121804
376 Ga0207674_10030235
377 Ga0207674_10057611
378 Ga0207674_10171387
379 Ga0207674_10465744
380 Ga0207675_100691352
381 Ga0207698_10070987
382 Ga0207428_10024942
383 Ga0268266_10270725
384 Ga0268266_10368676
385 Ga0268265_10225050
386 Ga0268264_10147757
387 Ga0307515_10000192
388 Ga0307515_10024235
389 Ga0307515_10032618
390 Ga0307515_10035142
391 Ga0265338_10001934
392 Ga0307512_10007737
393 Ga0307513_10031276
394 Ga0307513_10035921
395 Ga0307513_10125483
396 Ga0307513_10327064
397 Ga0307509_10232136
398 Ga0307508_10041227
399 Ga0307508_10088669
400 Ga0316579_10129417
401 Ga0316576_10135364
402 Ga0307516_10001127
403 Ga0307516_10009559
404 Ga0307516_10011284
405 Ga0307516_10012765
406 Ga0307516_10031533
407 Ga0307405_10215933
408 Ga0307413_10027049
409 Ga0307413_10376394
410 Ga0307410_10007758
411 Ga0307406_10012087
412 Ga0307406_10041811
413 Ga0307406_10055390
414 Ga0307406_10269143
415 Ga0307407_10011295
416 Ga0307412_10253054
417 Ga0307412_10306058
418 Ga0307409_100033544
419 Ga0307409_100125900
420 Ga0307409_100669257
421 Ga0307416_100001039
422 Ga0307416_100055409
423 Ga0307416_100760619
424 Ga0307416_101488714
425 Ga0307415_100000041
426 Ga0307415_100050083
427 Ga0307415_100433856
428 Ga0307415_100563947
429 Ga0316583_10010087
430 Ga0316585_10008007
431 Ga0307507_10023600
432 Ga0373962_0001687
433 Ga0316574_0002423
434 Ga0316574_0161186
435 Ga0373935_0003276
436 Ga0373925_0000231
437 Ga0395899_0021598
438 Ga0395899_0045108
439 Ga0395900_0003211
440 Ga0395900_0028102
441 Ga0395900_0051142
442 Ga0395900_0061202
443 Ga0395900_0734630
444 Ga0395898_0005286
445 Ga0395898_0019507
446 Ga0395898_0061935
447 Ga0395905_0010970
448 Ga0395905_0016463
449 Ga0395905_0019666
450 Ga0395905_0124199
451 Ga0395905_0273139
452 Ga0316581_0128420
453 Ga0395901_0002828
454 Ga0395901_0015699
455 Ga0395901_0030627
456 Ga0395901_0052969
457 Ga0395901_0143102
458 Ga0395901_0329151
459 Ga0395901_1048835
460 Ga0436365_0196110
461 Ga0451795_1217093
462 Ga0495629_0042911
463 Ga0495629_0070831
464 Ga0495594_0049882
465 Ga0495594_0142133
466 Ga0495606_0124752
467 Ga0495616_0065438
468 Ga0496104_0083745
469 Ga0496104_0204428
470 Ga0496104_0799265
471 Ga0496105_0300694
472 Ga0496105_0461726
473 Ga0496108_0106653
474 Ga0496109_0016011
475 Ga0496109_0172761
476 Ga0496109_0536318
477 Ga0496110_0011601
478 Ga0496110_0111753
479 Ga0496110_0134352
480 Ga0496111_0105248
481 Ga0496111_0117650
482 Ga0496112_0021045
483 Ga0496112_0279066
484 Ga0496114_0052741
485 Ga0496126_0006492
486 Ga0501031_0097966
487 Ga0501032_0035378
488 Ga0501034_0468706
489 Ga0501037_0044481
490 Ga0501043_0136454
491 Ga0501046_0005552
492 Ga0501047_0072483
493 Ga0501068_0274377
494 Ga0501069_0007880
495 Ga0501071_0123860
496 Ga0501072_0052488
497 Ga0501074_0415608
498 Ga0501035_0223292
499 Ga0501044_0304661
500 Ga0501044_0478269
501 nmdc:mga0yw44_361227_c1
502 nmdc:mga05p37_199325_c1
503 nmdc:mga06r32_991655_c1
504 nmdc:mga08y16_38347_c1
505 Ga0500646_0000561
506 Ga0500579_046729
507 Ga0500588_0004394
508 Ga0500600_0052127
509 Ga0500604_0097336
510 Ga0501082_0077492
511 Ga0530510_0673255
512 2753263081
513 2819625004
514 2831939094
515 2867512430
516 2928109053
517 2928136276
518 2928503942
519 8001783876
520 8057569521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

19

129

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

169

244

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9817 3 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9784 3 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9776 3 120
5za3-assembly1.cif.gz_B structure of a c-terminal s. mutans response regulator vicr domain 0.9743 130 226
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.973 3 123
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9914 3 85 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9864 1 81 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9795 4 81 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9766 1 120 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9765 4 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H6F9D1-F1-model_v4 Transcriptional regulatory protein ZraR 0.9814 1 121 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A1J4VQ58-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9809 1 121 GO:0000155
GO:0005524
GO:0005886
GO:0009927
AF-A0A0G3EDR7-F1-model_v4 Fis family transcriptional regulator 0.9776 3 121 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7Y2WYQ2-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9763 2 121 GO:0000160
GO:0003677
GO:0005524
GO:0006355
GO:0016887
AF-A0A419J0U7-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.974 2 120 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Map