F369411

General Info

Members Datasets Scaffolds Average Seq Length
260 211 257 107

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100503582|Ga0068853_1005035822
Length 115
Sequence MKVNEELGHPMASRTVIDPNVLRAAAGEAVGVLKLLANEERLLLLCQLSQGEMSVGDLEDQLDIRQPTLSQQLGVLRAHGVVDTRREGKRIYYRIADPSLLQIIAVLYRLYCPKE

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221656 Pelomonas sp. Root405 Isolate Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
135 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
136 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
137 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
138 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
144 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
176 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
177 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
180 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
185 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
186 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
187 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
188 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
189 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
190 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
191 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
210 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.69
Nodule 0
Rhizoplane 4.62
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10141799 3300003187 Bacteria 585
2 JGI25153J46596_10099629 3300003215 Bacteria 685
3 rootH2_10141630 3300003320 Bacteria 1883
4 rootL2_10093468 3300003322 Bacteria 3679
5 rootL2_10093470 3300003322 Bacteria 9372
6 rootL2_10117302 3300003322 Bacteria 3138
7 rootH1_10031037 3300003323 Bacteria 7380
8 rootH1_10041676 3300003323 Bacteria 2742
9 rootH1_10211675 3300003323 Bacteria 1673
10 Ga0055529_1001082 3300003763 Bacteria 12469
11 Ga0055526_1000019 3300003771 Bacteria 189698
12 Ga0055531_10001392 3300003794 Bacteria 17911
13 Ga0070676_10013668 3300005328 Bacteria 4449
14 Ga0070676_10769662 3300005328 Unclassified 708
15 Ga0068869_100195045 3300005334 Bacteria 1594
16 Ga0070666_10061045 3300005335 Bacteria 2552
17 Ga0068868_100027552 3300005338 Bacteria 4336
18 Ga0070687_100199501 3300005343 Bacteria 1211
19 Ga0070668_100026304 3300005347 Bacteria 4415
20 Ga0070669_100022402 3300005353 Bacteria 4516
21 Ga0070669_100874655 3300005353 Unclassified 767
22 Ga0070675_100022810 3300005354 Bacteria 5001
23 Ga0070673_101706230 3300005364 Unclassified 596
24 Ga0070688_101202817 3300005365 Bacteria 609
25 Ga0070659_100261729 3300005366 Bacteria 1435
26 Ga0070711_100699625 3300005439 Bacteria 853
27 Ga0070678_100420344 3300005456 Bacteria 1165
28 Ga0070678_100691650 3300005456 Bacteria 918
29 Ga0070662_100013603 3300005457 Bacteria 5418
30 Ga0068867_100027885 3300005459 Bacteria 4063
31 Ga0068867_100044431 3300005459 Bacteria 3255
32 Ga0070707_101200517 3300005468 Bacteria 725
33 Ga0068853_100503582 3300005539 Bacteria 1143
34 Ga0070672_100180649 3300005543 Bacteria 1758
35 Ga0070672_100794783 3300005543 Bacteria 832
36 Ga0068855_101081828 3300005563 Bacteria 839
37 Ga0068857_100879958 3300005577 Bacteria 858
38 Ga0068854_100286405 3300005578 Bacteria 1328
39 Ga0068852_100110851 3300005616 Bacteria 2494
40 Ga0068852_101292389 3300005616 Unclassified 751
41 Ga0068859_100257950 3300005617 Bacteria 1834
42 Ga0068864_100121077 3300005618 Bacteria 2340
43 Ga0068864_101476272 3300005618 Bacteria 683
44 Ga0068861_100073191 3300005719 Bacteria 2661
45 Ga0068870_10227806 3300005840 Bacteria 1144
46 Ga0068863_100189691 3300005841 Bacteria 1975
47 Ga0068863_100955685 3300005841 Bacteria 858
48 Ga0068862_100047819 3300005844 Bacteria 3651
49 Ga0075368_10126600 3300006042 Unclassified 1060
50 Ga0075367_10200165 3300006178 Bacteria 1248
51 Ga0075366_10095216 3300006195 Bacteria 1785
52 Ga0075366_10231522 3300006195 Unclassified 1126
53 Ga0075366_10337554 3300006195 Bacteria 924
54 Ga0075370_10000047 3300006353 Bacteria 37208
55 Ga0075370_10071164 3300006353 Bacteria 1990
56 Ga0075370_10306973 3300006353 Bacteria 944
57 Ga0075370_10533989 3300006353 Bacteria 709
58 Ga0097620_100257966 3300006931 Bacteria 1834
59 Ga0105243_10164903 3300009148 Bacteria 1914
60 Ga0105248_10134284 3300009177 Bacteria 2792
61 Ga0105248_10944469 3300009177 Bacteria 974
62 Ga0105238_10319337 3300009551 Bacteria 1539
63 Ga0105239_10543933 3300010375 Bacteria 1322
64 Ga0105239_11138191 3300010375 Unclassified 899
65 Ga0157370_12150003 3300013104 Bacteria 500
66 Ga0157374_10066242 3300013296 Bacteria 3395
67 Ga0157378_11002248 3300013297 Unclassified 870
68 Ga0163162_10019000 3300013306 Bacteria 6739
69 Ga0157375_10021731 3300013308 Bacteria 5891
70 Ga0157380_10034206 3300014326 Bacteria 3919
71 Ga0157379_10011840 3300014968 Bacteria 7620
72 Ga0157376_10179017 3300014969 Bacteria 1936
73 Ga0163161_10246784 3300017792 Bacteria 1390
74 Ga0213872_10002248 3300021361 Bacteria 11544
75 Ga0213872_10011564 3300021361 Bacteria 4174
76 Ga0213872_10056449 3300021361 Bacteria 1779
77 Ga0209437_114187 3300025233 Bacteria 1118
78 Ga0207425_1000128 3300025245 Bacteria 71502
79 Ga0209455_1000044 3300025272 Bacteria 410787
80 Ga0209025_1003856 3300025294 Bacteria 13611
81 Ga0209564_1000007 3300025295 Bacteria 1028582
82 Ga0209758_1000578 3300025297 Bacteria 57247
83 Ga0209050_1006371 3300025298 Bacteria 7004
84 Ga0209051_1037210 3300025303 Bacteria 1787
85 Ga0209257_1000032 3300025304 Bacteria 680354
86 Ga0207680_10050560 3300025903 Bacteria 2480
87 Ga0207645_10019295 3300025907 Bacteria 4471
88 Ga0207705_11095186 3300025909 Bacteria 614
89 Ga0207663_10727053 3300025916 Bacteria 787
90 Ga0207662_10310369 3300025918 Bacteria 1051
91 Ga0207646_10343542 3300025922 Bacteria 1348
92 Ga0207681_10022443 3300025923 Bacteria 4025
93 Ga0207644_10537251 3300025931 Bacteria 967
94 Ga0207690_10185672 3300025932 Bacteria 1569
95 Ga0207706_10026693 3300025933 Bacteria 5170
96 Ga0207709_10186304 3300025935 Bacteria 1470
97 Ga0207669_10285001 3300025937 Bacteria 1248
98 Ga0207691_10066495 3300025940 Bacteria 3261
99 Ga0207691_10073442 3300025940 Bacteria 3084
100 Ga0207711_10054323 3300025941 Bacteria 3437
101 Ga0207689_10027889 3300025942 Bacteria 4724
102 Ga0207651_10314692 3300025960 Bacteria 1307
103 Ga0207668_10014273 3300025972 Bacteria 4915
104 Ga0207658_10307786 3300025986 Bacteria 1367
105 Ga0207677_11013860 3300026023 Bacteria 753
106 Ga0207703_10030315 3300026035 Bacteria 4274
107 Ga0207639_11051020 3300026041 Bacteria 763
108 Ga0207702_10092487 3300026078 Bacteria 2651
109 Ga0207641_10273085 3300026088 Bacteria 1587
110 Ga0207641_10423736 3300026088 Bacteria 1282
111 Ga0207648_10031976 3300026089 Bacteria 4649
112 Ga0207648_10068544 3300026089 Bacteria 3091
113 Ga0207648_10110425 3300026089 Bacteria 2414
114 Ga0207676_10057019 3300026095 Bacteria 3075
115 Ga0207676_10617478 3300026095 Bacteria 1043
116 Ga0207675_100038310 3300026118 Bacteria 4473
117 Ga0207683_11588006 3300026121 Bacteria 603
118 Ga0207698_10721140 3300026142 Bacteria 994
119 Ga0209968_1001552 3300027526 Bacteria 3478
120 Ga0209999_1046731 3300027543 Bacteria 815
121 Ga0209966_1000027 3300027695 Bacteria 65242
122 Ga0209813_10083566 3300027866 Unclassified 1060
123 Ga0268265_10082672 3300028380 Bacteria 2540
124 Ga0268264_10078532 3300028381 Bacteria 2814
125 Ga0307515_10886881 3300028794 Bacteria 522
126 Ga0307511_10002108 3300030521 Bacteria 20827
127 Ga0307512_10074967 3300030522 Bacteria 2479
128 Ga0307408_100140804 3300031548 Bacteria 1893
129 Ga0307408_100300136 3300031548 Bacteria 1345
130 Ga0307516_10243029 3300031730 Bacteria 1498
131 Ga0307516_10333905 3300031730 Bacteria 1184
132 Ga0307405_10430797 3300031731 Bacteria 1040
133 Ga0307413_11968156 3300031824 Bacteria 526
134 Ga0307407_10832055 3300031903 Bacteria 704
135 Ga0307412_10169833 3300031911 Bacteria 1629
136 Ga0307416_100356826 3300032002 Bacteria 1482
137 Ga0307416_101954060 3300032002 Bacteria 690
138 Ga0307414_11451912 3300032004 Bacteria 638
139 Ga0307411_10058265 3300032005 Bacteria 2555
140 Ga0307411_10128800 3300032005 Bacteria 1846
141 Ga0307411_10879245 3300032005 Bacteria 795
142 Ga0373931_0424542 3300035691 Bacteria 846
143 Ga0395900_0084897 3300037418 Bacteria 3254
144 Ga0395900_1130451 3300037418 Bacteria 700
145 Ga0395905_0006945 3300037471 Bacteria 11315
146 Ga0395905_0014450 3300037471 Bacteria 7537
147 Ga0395905_0023422 3300037471 Bacteria 5834
148 Ga0395901_0069418 3300038443 Bacteria 3670
149 Ga0439436_0005527 3300041404 Bacteria 3871
150 Ga0439438_051563 3300041405 Bacteria 1045
151 Ga0439461_0002702 3300041410 Bacteria 2859
152 Ga0439461_0041277 3300041410 Bacteria 997
153 Ga0439461_0127534 3300041410 Bacteria 641
154 Ga0439466_0209997 3300041411 Bacteria 591
155 Ga0439465_0000037 3300041413 Bacteria 27063
156 Ga0451793_0738092 3300041452 Bacteria 780
157 Ga0451800_1378062 3300041459 Bacteria 596
158 Ga0451837_1567991 3300041494 Bacteria 635
159 Ga0439431_0000349 3300041997 Bacteria 9703
160 Ga0439433_0000989 3300041999 Bacteria 5733
161 Ga0439442_003235 3300042002 Bacteria 3221
162 Ga0439445_0002122 3300042004 Bacteria 4385
163 Ga0439432_024428 3300042006 Bacteria 1986
164 Ga0439452_020521 3300042010 Bacteria 1732
165 Ga0450917_000350 3300042120 Bacteria 3472
166 Ga0450923_166310 3300042125 Bacteria 539
167 Ga0450888_000965 3300042126 Bacteria 2725
168 Ga0450890_005423 3300042127 Bacteria 1639
169 Ga0450891_000163 3300042129 Bacteria 6353
170 Ga0450892_004190 3300042130 Bacteria 1177
171 Ga0450894_013809 3300042131 Bacteria 1062
172 Ga0450906_013141 3300042145 Bacteria 1530
173 Ga0450909_002632 3300042185 Bacteria 2545
174 Ga0439434_0008476 3300042435 Bacteria 3014
175 Ga0439434_0051022 3300042435 Bacteria 1282
176 Ga0439464_0064975 3300042439 Bacteria 1073
177 Ga0450918_034788 3300042531 Bacteria 895
178 Ga0450893_0001105 3300042532 Bacteria 4063
179 Ga0495627_005689 3300046453 Bacteria 4979
180 Ga0495650_0000066 3300046471 Bacteria 272883
181 Ga0495650_0016350 3300046471 Bacteria 3762
182 Ga0495606_0365811 3300046507 Bacteria 761
183 Ga0495620_0018100 3300046515 Bacteria 3494
184 Ga0495637_0070894 3300046520 Bacteria 1406
185 Ga0495643_0416777 3300046522 Bacteria 590
186 Ga0495663_0123463 3300046525 Bacteria 869
187 Ga0495642_0213236 3300046528 Bacteria 842
188 Ga0495656_0193609 3300046615 Bacteria 1005
189 Ga0495668_0002895 3300046616 Bacteria 13554
190 Ga0495661_0140559 3300046665 Bacteria 1314
191 Ga0495661_0389772 3300046665 Bacteria 679
192 Ga0495588_0005437 3300046674 Bacteria 5669
193 Ga0495588_0084713 3300046674 Bacteria 1657
194 Ga0495670_0038647 3300046691 Bacteria 2380
195 Ga0495671_0018916 3300046692 Bacteria 3649
196 Ga0495685_072668 3300047447 Bacteria 1151
197 Ga0495681_0323242 3300047470 Bacteria 592
198 Ga0495615_0213158 3300048090 Bacteria 600
199 Ga0496102_1453350 3300048905 Bacteria 604
200 Ga0496103_0704841 3300048906 Bacteria 640
201 Ga0496104_1536970 3300048907 Bacteria 568
202 Ga0496107_0381251 3300048910 Bacteria 1049
203 Ga0496108_0069356 3300048911 Bacteria 2975
204 Ga0496109_0331860 3300048912 Bacteria 1436
205 Ga0496110_0180005 3300048913 Bacteria 1920
206 Ga0496111_0567790 3300048914 Bacteria 832
207 Ga0496112_0093246 3300048915 Bacteria 2981
208 Ga0496113_0354919 3300048916 Bacteria 1176
209 Ga0496118_0220087 3300048921 Bacteria 1106
210 Ga0496124_0036224 3300048927 Bacteria 4306
211 Ga0496124_0370445 3300048927 Bacteria 1006
212 Ga0496126_0596487 3300048929 Bacteria 871
213 Ga0501291_012759 3300049514 Bacteria 1233
214 Ga0501300_011518 3300049523 Bacteria 1288
215 Ga0501303_006701 3300049526 Bacteria 1011
216 Ga0501201_035006 3300049651 Bacteria 586
217 Ga0501211_000129 3300049658 Bacteria 5863
218 Ga0501222_011296 3300049662 Bacteria 1178
219 Ga0501223_005346 3300049663 Bacteria 2701
220 Ga0501233_028902 3300049668 Bacteria 1240
221 Ga0501235_034705 3300049669 Bacteria 1144
222 Ga0501253_227918 3300049683 Bacteria 501
223 Ga0501255_012358 3300049684 Bacteria 1000
224 Ga0501258_005477 3300049687 Bacteria 1233
225 Ga0501221_001033 3300049704 Bacteria 4572
226 Ga0501229_000324 3300049706 Bacteria 5434
227 Ga0501229_002498 3300049706 Bacteria 2170
228 Ga0501232_008612 3300049757 Bacteria 1107
229 Ga0501262_003528 3300049759 Bacteria 1795
230 Ga0501264_042212 3300049761 Bacteria 563
231 Ga0501266_009730 3300049763 Bacteria 1219
232 Ga0501269_003067 3300049766 Bacteria 2029
233 Ga0501270_054988 3300049767 Bacteria 731
234 Ga0501272_022054 3300049769 Bacteria 769
235 Ga0501204_027154 3300049850 Bacteria 778
236 nmdc:mga0yw44_916080_c1 3300050492 Bacteria 594
237 nmdc:mga0k408_339476_c1 3300050493 Unclassified 896
238 nmdc:mga0k408_398394_c1 3300050493 Bacteria 819
239 nmdc:mga0k408_406621_c1 3300050493 Bacteria 810
240 nmdc:mga0k408_709842_c1 3300050493 Bacteria 589
241 nmdc:mga07m45_1988_c1 3300050496 Bacteria 9470
242 nmdc:mga07m45_385468_c1 3300050496 Bacteria 814
243 nmdc:mga07m45_521990_c1 3300050496 Bacteria 687
244 nmdc:mga07m45_634243_c1 3300050496 Bacteria 616
245 Ga0500610_0054505 3300053079 Bacteria 2085
246 Ga0500644_0448131 3300053088 Bacteria 565
247 Ga0500646_0000786 3300053090 Bacteria 8853
248 Ga0500583_0153085 3300053092 Bacteria 1148
249 Ga0500583_0197271 3300053092 Bacteria 1001
250 Ga0500593_000109 3300053117 Bacteria 31699
251 Ga0500607_000040 3300053121 Bacteria 85325
252 Ga0500655_031034 3300053133 Bacteria 1030
253 Ga0500568_0109401 3300053139 Bacteria 1033
254 Ga0500604_0000537 3300053151 Bacteria 10439
255 Ga0500627_0255468 3300053158 Bacteria 775
256 Ga0500634_0006588 3300053161 Bacteria 5634
257 Ga0500637_0354687 3300053178 Bacteria 779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_101200517 Ga0070707_1012005172 94
2 3300025922 Ga0207646_10343542 Ga0207646_103435423 94
3 3300048914 Ga0496111_0567790 Ga0496111_0567790_536_820 94
4 3300005456 Ga0070678_100420344 Ga0070678_1004203442 95
5 3300005459 Ga0068867_100027885 Ga0068867_1000278852 95
6 3300005577 Ga0068857_100879958 Ga0068857_1008799582 95
7 3300025937 Ga0207669_10285001 Ga0207669_102850012 95
8 3300026089 Ga0207648_10068544 Ga0207648_100685444 95
9 3300021361 Ga0213872_10002248 Ga0213872_1000224810 96
10 3300021361 Ga0213872_10011564 Ga0213872_100115642 96
11 3300021361 Ga0213872_10056449 Ga0213872_100564492 96
12 3300048921 Ga0496118_0220087 Ga0496118_0220087_705_995 96
13 3300048929 Ga0496126_0596487 Ga0496126_0596487_110_400 96
14 iso_pu_bacteria 2643221585 2643936931 100
15 iso_pu_bacteria 2643221656 2644318096 100
16 3300030521 Ga0307511_10002108 Ga0307511_1000210820 102
17 3300053090 Ga0500646_0000786 Ga0500646_0000786_5678_5986 102
18 3300053092 Ga0500583_0153085 Ga0500583_0153085_120_428 102
19 3300053092 Ga0500583_0197271 Ga0500583_0197271_408_716 102
20 3300053133 Ga0500655_031034 Ga0500655_031034_370_678 102
21 3300053139 Ga0500568_0109401 Ga0500568_0109401_549_857 102
22 3300053151 Ga0500604_0000537 Ga0500604_0000537_5578_5886 102
23 3300053178 Ga0500637_0354687 Ga0500637_0354687_185_505 102
24 3300005543 Ga0070672_100794783 Ga0070672_1007947832 103
25 3300006353 Ga0075370_10071164 Ga0075370_100711642 103
26 3300025909 Ga0207705_11095186 Ga0207705_110951861 103
27 3300046471 Ga0495650_0016350 Ga0495650_0016350_2799_3116 103
28 3300050496 nmdc:mga07m45_634243_c1 nmdc:mga07m45_634243_c1_180_500 103
29 3300005328 Ga0070676_10013668 Ga0070676_100136683 105
30 3300005328 Ga0070676_10769662 Ga0070676_107696621 105
31 3300005334 Ga0068869_100195045 Ga0068869_1001950452 105
32 3300005335 Ga0070666_10061045 Ga0070666_100610452 105
33 3300005338 Ga0068868_100027552 Ga0068868_1000275524 105
34 3300005343 Ga0070687_100199501 Ga0070687_1001995011 105
35 3300005347 Ga0070668_100026304 Ga0070668_1000263045 105
36 3300005353 Ga0070669_100022402 Ga0070669_1000224023 105
37 3300005353 Ga0070669_100874655 Ga0070669_1008746552 105
38 3300005354 Ga0070675_100022810 Ga0070675_1000228103 105
39 3300005364 Ga0070673_101706230 Ga0070673_1017062301 105
40 3300005365 Ga0070688_101202817 Ga0070688_1012028172 105
41 3300005366 Ga0070659_100261729 Ga0070659_1002617292 105
42 3300005439 Ga0070711_100699625 Ga0070711_1006996252 105
43 3300005457 Ga0070662_100013603 Ga0070662_1000136034 105
44 3300005459 Ga0068867_100044431 Ga0068867_1000444313 105
45 3300005539 Ga0068853_100503582 Ga0068853_1005035822 105
46 3300005543 Ga0070672_100180649 Ga0070672_1001806492 105
47 3300005563 Ga0068855_101081828 Ga0068855_1010818282 105
48 3300005578 Ga0068854_100286405 Ga0068854_1002864051 105
49 3300005616 Ga0068852_100110851 Ga0068852_1001108513 105
50 3300005616 Ga0068852_101292389 Ga0068852_1012923892 105
51 3300005617 Ga0068859_100257950 Ga0068859_1002579503 105
52 3300005618 Ga0068864_100121077 Ga0068864_1001210772 105
53 3300005618 Ga0068864_101476272 Ga0068864_1014762722 105
54 3300005719 Ga0068861_100073191 Ga0068861_1000731913 105
55 3300005840 Ga0068870_10227806 Ga0068870_102278063 105
56 3300005841 Ga0068863_100189691 Ga0068863_1001896914 105
57 3300005841 Ga0068863_100955685 Ga0068863_1009556852 105
58 3300005844 Ga0068862_100047819 Ga0068862_1000478194 105
59 3300006042 Ga0075368_10126600 Ga0075368_101266002 105
60 3300006178 Ga0075367_10200165 Ga0075367_102001652 105
61 3300006195 Ga0075366_10231522 Ga0075366_102315222 105
62 3300006353 Ga0075370_10000047 Ga0075370_1000004723 105
63 3300006353 Ga0075370_10533989 Ga0075370_105339892 105
64 3300006931 Ga0097620_100257966 Ga0097620_1002579663 105
65 3300009148 Ga0105243_10164903 Ga0105243_101649032 105
66 3300009177 Ga0105248_10134284 Ga0105248_101342843 105
67 3300009177 Ga0105248_10944469 Ga0105248_109444693 105
68 3300009551 Ga0105238_10319337 Ga0105238_103193371 105
69 3300010375 Ga0105239_10543933 Ga0105239_105439333 105
70 3300010375 Ga0105239_11138191 Ga0105239_111381912 105
71 3300013104 Ga0157370_12150003 Ga0157370_121500032 105
72 3300013296 Ga0157374_10066242 Ga0157374_100662424 105
73 3300013297 Ga0157378_11002248 Ga0157378_110022482 105
74 3300013306 Ga0163162_10019000 Ga0163162_100190006 105
75 3300013308 Ga0157375_10021731 Ga0157375_100217313 105
76 3300014326 Ga0157380_10034206 Ga0157380_100342063 105
77 3300014968 Ga0157379_10011840 Ga0157379_100118406 105
78 3300014969 Ga0157376_10179017 Ga0157376_101790173 105
79 3300017792 Ga0163161_10246784 Ga0163161_102467843 105
80 3300025903 Ga0207680_10050560 Ga0207680_100505603 105
81 3300025907 Ga0207645_10019295 Ga0207645_100192954 105
82 3300025916 Ga0207663_10727053 Ga0207663_107270532 105
83 3300025918 Ga0207662_10310369 Ga0207662_103103691 105
84 3300025923 Ga0207681_10022443 Ga0207681_100224434 105
85 3300025931 Ga0207644_10537251 Ga0207644_105372512 105
86 3300025932 Ga0207690_10185672 Ga0207690_101856723 105
87 3300025933 Ga0207706_10026693 Ga0207706_100266933 105
88 3300025935 Ga0207709_10186304 Ga0207709_101863042 105
89 3300025940 Ga0207691_10066495 Ga0207691_100664953 105
90 3300025940 Ga0207691_10073442 Ga0207691_100734422 105
91 3300025941 Ga0207711_10054323 Ga0207711_100543235 105
92 3300025942 Ga0207689_10027889 Ga0207689_100278895 105
93 3300025960 Ga0207651_10314692 Ga0207651_103146922 105
94 3300025972 Ga0207668_10014273 Ga0207668_100142735 105
95 3300025986 Ga0207658_10307786 Ga0207658_103077863 105
96 3300026023 Ga0207677_11013860 Ga0207677_110138602 105
97 3300026035 Ga0207703_10030315 Ga0207703_100303154 105
98 3300026041 Ga0207639_11051020 Ga0207639_110510202 105
99 3300026088 Ga0207641_10273085 Ga0207641_102730852 105
100 3300026088 Ga0207641_10423736 Ga0207641_104237363 105
101 3300026089 Ga0207648_10031976 Ga0207648_100319764 105
102 3300026089 Ga0207648_10110425 Ga0207648_101104252 105
103 3300026095 Ga0207676_10057019 Ga0207676_100570195 105
104 3300026095 Ga0207676_10617478 Ga0207676_106174782 105
105 3300026118 Ga0207675_100038310 Ga0207675_1000383103 105
106 3300026142 Ga0207698_10721140 Ga0207698_107211402 105
107 3300027526 Ga0209968_1001552 Ga0209968_10015522 105
108 3300027543 Ga0209999_1046731 Ga0209999_10467312 105
109 3300027695 Ga0209966_1000027 Ga0209966_100002757 105
110 3300027866 Ga0209813_10083566 Ga0209813_100835662 105
111 3300028380 Ga0268265_10082672 Ga0268265_100826724 105
112 3300028381 Ga0268264_10078532 Ga0268264_100785322 105
113 3300031548 Ga0307408_100300136 Ga0307408_1003001362 105
114 3300031731 Ga0307405_10430797 Ga0307405_104307972 105
115 3300031824 Ga0307413_11968156 Ga0307413_119681562 105
116 3300031911 Ga0307412_10169833 Ga0307412_101698333 105
117 3300032002 Ga0307416_100356826 Ga0307416_1003568263 105
118 3300032002 Ga0307416_101954060 Ga0307416_1019540602 105
119 3300032004 Ga0307414_11451912 Ga0307414_114519122 105
120 3300032005 Ga0307411_10128800 Ga0307411_101288004 105
121 3300032005 Ga0307411_10879245 Ga0307411_108792452 105
122 3300035691 Ga0373931_0424542 Ga0373931_0424542_72_389 105
123 3300037418 Ga0395900_0084897 Ga0395900_0084897_128_451 105
124 3300037471 Ga0395905_0006945 Ga0395905_0006945_1982_2314 105
125 3300037471 Ga0395905_0014450 Ga0395905_0014450_28_351 105
126 3300038443 Ga0395901_0069418 Ga0395901_0069418_2121_2444 105
127 3300041404 Ga0439436_0005527 Ga0439436_0005527_2911_3231 105
128 3300041405 Ga0439438_051563 Ga0439438_051563_619_939 105
129 3300041410 Ga0439461_0002702 Ga0439461_0002702_166_486 105
130 3300041410 Ga0439461_0041277 Ga0439461_0041277_187_513 105
131 3300041410 Ga0439461_0127534 Ga0439461_0127534_120_446 105
132 3300041411 Ga0439466_0209997 Ga0439466_0209997_135_455 105
133 3300041413 Ga0439465_0000037 Ga0439465_0000037_11574_11894 105
134 3300041459 Ga0451800_1378062 Ga0451800_1378062_264_584 105
135 3300041494 Ga0451837_1567991 Ga0451837_1567991_102_422 105
136 3300041997 Ga0439431_0000349 Ga0439431_0000349_1860_2180 105
137 3300041999 Ga0439433_0000989 Ga0439433_0000989_961_1281 105
138 3300042002 Ga0439442_003235 Ga0439442_003235_2502_2822 105
139 3300042004 Ga0439445_0002122 Ga0439445_0002122_917_1237 105
140 3300042006 Ga0439432_024428 Ga0439432_024428_789_1109 105
141 3300042010 Ga0439452_020521 Ga0439452_020521_378_698 105
142 3300042125 Ga0450923_166310 Ga0450923_166310_117_437 105
143 3300042131 Ga0450894_013809 Ga0450894_013809_89_409 105
144 3300042145 Ga0450906_013141 Ga0450906_013141_811_1131 105
145 3300042185 Ga0450909_002632 Ga0450909_002632_1681_2001 105
146 3300042435 Ga0439434_0008476 Ga0439434_0008476_2169_2489 105
147 3300042435 Ga0439434_0051022 Ga0439434_0051022_225_551 105
148 3300042439 Ga0439464_0064975 Ga0439464_0064975_181_501 105
149 3300042531 Ga0450918_034788 Ga0450918_034788_66_386 105
150 3300046507 Ga0495606_0365811 Ga0495606_0365811_162_482 105
151 3300046525 Ga0495663_0123463 Ga0495663_0123463_296_616 105
152 3300046528 Ga0495642_0213236 Ga0495642_0213236_90_410 105
153 3300046615 Ga0495656_0193609 Ga0495656_0193609_297_617 105
154 3300046665 Ga0495661_0389772 Ga0495661_0389772_63_383 105
155 3300046674 Ga0495588_0084713 Ga0495588_0084713_350_670 105
156 3300047447 Ga0495685_072668 Ga0495685_072668_506_826 105
157 3300047470 Ga0495681_0323242 Ga0495681_0323242_140_460 105
158 3300048090 Ga0495615_0213158 Ga0495615_0213158_58_378 105
159 3300048905 Ga0496102_1453350 Ga0496102_1453350_32_352 105
160 3300048906 Ga0496103_0704841 Ga0496103_0704841_24_344 105
161 3300048907 Ga0496104_1536970 Ga0496104_1536970_225_545 105
162 3300048910 Ga0496107_0381251 Ga0496107_0381251_448_765 105
163 3300048911 Ga0496108_0069356 Ga0496108_0069356_1764_2084 105
164 3300048912 Ga0496109_0331860 Ga0496109_0331860_127_447 105
165 3300048913 Ga0496110_0180005 Ga0496110_0180005_1443_1763 105
166 3300048915 Ga0496112_0093246 Ga0496112_0093246_1324_1644 105
167 3300048916 Ga0496113_0354919 Ga0496113_0354919_289_609 105
168 3300048927 Ga0496124_0370445 Ga0496124_0370445_490_807 105
169 3300049761 Ga0501264_042212 Ga0501264_042212_89_406 105
170 3300050492 nmdc:mga0yw44_916080_c1 nmdc:mga0yw44_916080_c1_57_377 105
171 3300050493 nmdc:mga0k408_339476_c1 nmdc:mga0k408_339476_c1_53_373 105
172 3300050496 nmdc:mga07m45_1988_c1 nmdc:mga07m45_1988_c1_1492_1812 105
173 3300050496 nmdc:mga07m45_521990_c1 nmdc:mga07m45_521990_c1_184_504 105
174 3300003771 Ga0055526_1000019 Ga0055526_10000196 106
175 3300025295 Ga0209564_1000007 Ga0209564_1000007221 106
176 3300031548 Ga0307408_100140804 Ga0307408_1001408042 106
177 3300031730 Ga0307516_10243029 Ga0307516_102430292 106
178 3300031730 Ga0307516_10333905 Ga0307516_103339052 106
179 3300041452 Ga0451793_0738092 Ga0451793_0738092_264_587 106
180 3300046471 Ga0495650_0000066 Ga0495650_0000066_134003_134323 106
181 3300046616 Ga0495668_0002895 Ga0495668_0002895_5420_5740 106
182 3300048927 Ga0496124_0036224 Ga0496124_0036224_190_510 106
183 3300053158 Ga0500627_0255468 Ga0500627_0255468_208_531 106
184 iso_pu_bacteria 2643221544 2643745956 106
185 3300003187 JGI25151J46595_10141799 JGI25151J46595_101417991 107
186 3300003215 JGI25153J46596_10099629 JGI25153J46596_100996291 107
187 3300003320 rootH2_10141630 rootH2_101416302 107
188 3300003322 rootL2_10093468 rootL2_100934683 107
189 3300003322 rootL2_10093470 rootL2_100934704 107
190 3300003322 rootL2_10117302 rootL2_101173024 107
191 3300003323 rootH1_10031037 rootH1_100310377 107
192 3300003323 rootH1_10041676 rootH1_100416762 107
193 3300003323 rootH1_10211675 rootH1_102116752 107
194 3300003763 Ga0055529_1001082 Ga0055529_10010825 107
195 3300003794 Ga0055531_10001392 Ga0055531_100013927 107
196 3300005456 Ga0070678_100691650 Ga0070678_1006916502 107
197 3300006195 Ga0075366_10095216 Ga0075366_100952162 107
198 3300006195 Ga0075366_10337554 Ga0075366_103375542 107
199 3300006353 Ga0075370_10306973 Ga0075370_103069732 107
200 3300025233 Ga0209437_114187 Ga0209437_1141872 107
201 3300025245 Ga0207425_1000128 Ga0207425_100012823 107
202 3300025272 Ga0209455_1000044 Ga0209455_10000445 107
203 3300025294 Ga0209025_1003856 Ga0209025_10038564 107
204 3300025297 Ga0209758_1000578 Ga0209758_100057822 107
205 3300025298 Ga0209050_1006371 Ga0209050_10063713 107
206 3300025303 Ga0209051_1037210 Ga0209051_10372104 107
207 3300025304 Ga0209257_1000032 Ga0209257_1000032374 107
208 3300026078 Ga0207702_10092487 Ga0207702_100924873 107
209 3300026121 Ga0207683_11588006 Ga0207683_115880061 107
210 3300028794 Ga0307515_10886881 Ga0307515_108868811 107
211 3300030522 Ga0307512_10074967 Ga0307512_100749674 107
212 3300031903 Ga0307407_10832055 Ga0307407_108320552 107
213 3300032005 Ga0307411_10058265 Ga0307411_100582653 107
214 3300037418 Ga0395900_1130451 Ga0395900_1130451_21_344 107
215 3300037471 Ga0395905_0023422 Ga0395905_0023422_3309_3641 107
216 3300042120 Ga0450917_000350 Ga0450917_000350_3110_3433 107
217 3300042126 Ga0450888_000965 Ga0450888_000965_719_1042 107
218 3300042127 Ga0450890_005423 Ga0450890_005423_572_895 107
219 3300042129 Ga0450891_000163 Ga0450891_000163_2509_2832 107
220 3300042130 Ga0450892_004190 Ga0450892_004190_165_488 107
221 3300042532 Ga0450893_0001105 Ga0450893_0001105_1745_2068 107
222 3300046453 Ga0495627_005689 Ga0495627_005689_201_533 107
223 3300046515 Ga0495620_0018100 Ga0495620_0018100_834_1166 107
224 3300046520 Ga0495637_0070894 Ga0495637_0070894_658_984 107
225 3300046522 Ga0495643_0416777 Ga0495643_0416777_25_363 107
226 3300046665 Ga0495661_0140559 Ga0495661_0140559_67_396 107
227 3300046674 Ga0495588_0005437 Ga0495588_0005437_3992_4318 107
228 3300046691 Ga0495670_0038647 Ga0495670_0038647_1139_1465 107
229 3300046692 Ga0495671_0018916 Ga0495671_0018916_2263_2595 107
230 3300049514 Ga0501291_012759 Ga0501291_012759_890_1213 107
231 3300049523 Ga0501300_011518 Ga0501300_011518_663_986 107
232 3300049526 Ga0501303_006701 Ga0501303_006701_176_499 107
233 3300049651 Ga0501201_035006 Ga0501201_035006_252_575 107
234 3300049658 Ga0501211_000129 Ga0501211_000129_4951_5274 107
235 3300049662 Ga0501222_011296 Ga0501222_011296_157_480 107
236 3300049663 Ga0501223_005346 Ga0501223_005346_1458_1781 107
237 3300049668 Ga0501233_028902 Ga0501233_028902_413_736 107
238 3300049669 Ga0501235_034705 Ga0501235_034705_190_513 107
239 3300049683 Ga0501253_227918 Ga0501253_227918_26_349 107
240 3300049684 Ga0501255_012358 Ga0501255_012358_176_499 107
241 3300049687 Ga0501258_005477 Ga0501258_005477_186_509 107
242 3300049704 Ga0501221_001033 Ga0501221_001033_1206_1529 107
243 3300049706 Ga0501229_000324 Ga0501229_000324_397_720 107
244 3300049706 Ga0501229_002498 Ga0501229_002498_887_1210 107
245 3300049757 Ga0501232_008612 Ga0501232_008612_54_377 107
246 3300049759 Ga0501262_003528 Ga0501262_003528_538_861 107
247 3300049763 Ga0501266_009730 Ga0501266_009730_263_586 107
248 3300049766 Ga0501269_003067 Ga0501269_003067_378_701 107
249 3300049767 Ga0501270_054988 Ga0501270_054988_36_359 107
250 3300049769 Ga0501272_022054 Ga0501272_022054_411_734 107
251 3300049850 Ga0501204_027154 Ga0501204_027154_410_733 107
252 3300050493 nmdc:mga0k408_398394_c1 nmdc:mga0k408_398394_c1_461_787 107
253 3300050493 nmdc:mga0k408_406621_c1 nmdc:mga0k408_406621_c1_149_481 107
254 3300050493 nmdc:mga0k408_709842_c1 nmdc:mga0k408_709842_c1_242_574 107
255 3300050496 nmdc:mga07m45_385468_c1 nmdc:mga07m45_385468_c1_150_482 107
256 3300053079 Ga0500610_0054505 Ga0500610_0054505_549_878 107
257 3300053088 Ga0500644_0448131 Ga0500644_0448131_111_443 107
258 3300053117 Ga0500593_000109 Ga0500593_000109_12661_12993 107
259 3300053121 Ga0500607_000040 Ga0500607_000040_18196_18528 107
260 3300053161 Ga0500634_0006588 Ga0500634_0006588_3643_3972 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

38

84

0.96

PF12840

HTH_20

Helix-turn-helix domain

36

85

0.93

PF01638

HxlR

HxlR-like helix-turn-helix

35

111

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o8m-assembly1.cif.gz_A crystal structure of c9s apo sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulated bound to diamide (tetramethylazodicarboxamide). 0.9458 12 105
3cuo-assembly2.cif.gz_C crystal structure of the predicted dna-binding transcriptional regulator from e. coli 0.9397 8 101
4ooi-assembly1.cif.gz_B reduced hlyu from vibrio cholerae n16961 0.9368 8 103
3jth-assembly1.cif.gz_A crystal structure of a transcriptional regulator hlyu from vibrio vulnificus cmcp6 0.9277 9 102
4ooi-assembly1.cif.gz_B reduced hlyu from vibrio cholerae n16961 0.9277 8 103
ID Description Score Start End Superfamily
3jthB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9636 13 102 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 28 87 1.10.10.10
3jthB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9426 13 102 1.10.10.10
af_P77295_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9384 6 103 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.927 43 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3G6XYJ4-F1-model_v4 deleted 0.9944 23 102
AF-A0A352RSP6-F1-model_v4 Transcriptional regulator 0.9938 20 102 GO:0003700
AF-A0A7Y0BUZ4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.985 13 105 GO:0003700
AF-A0A2I5TQV6-F1-model_v4 Transcriptional regulator 0.9848 13 106 GO:0003700
AF-A0A6P2R3I9-F1-model_v4 ArsR family transcriptional regulator (Biofilm growth-associated repressor) 0.9805 13 102 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.96 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map