F369318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 205 | 260 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100246904|Ga0070680_1002469042 |
| Length | 213 |
| Sequence | LLTNEADVRWRIRNAYLALARPEELILEIRPLHLADVKLVIPPIHRDTRGFFSETYNRKAMSAAGISTEFVQDNHTLSSESGTLRGLHFQAPPHAQGKLLRVTRGAIFDVAVDIRVGSPTFGQHATANLTAANWMQVWIPPGFAHGYCTLEPDTEVIYKVTDYYAPECDRGIKWDDAALGIKWPIAPDKVHLSEKDRNQPALKDIAPAFLFGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 149 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 152 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 155 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 181 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 182 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 183 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 194 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 197 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 198 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 199 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 201 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 202 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.69 |
| Nodule | 0 |
| Rhizoplane | 3.85 |
| Rhizosphere | 78.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000088 | 3300002987 | Bacteria | 43781 |
| 2 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 3 | JGI25160J50197_1000229 | 3300003354 | Bacteria | 43781 |
| 4 | JGI25161J50226_1000277 | 3300003374 | Bacteria | 29649 |
| 5 | Ga0055526_1000049 | 3300003771 | Bacteria | 118394 |
| 6 | Ga0055543_1001461 | 3300004625 | Bacteria | 9336 |
| 7 | Ga0065165_1000812 | 3300005262 | Bacteria | 41449 |
| 8 | Ga0070690_100005575 | 3300005330 | Bacteria | 7081 |
| 9 | Ga0070680_100246904 | 3300005336 | Bacteria | 1509 |
| 10 | Ga0070680_100923473 | 3300005336 | Bacteria | 753 |
| 11 | Ga0070682_100251632 | 3300005337 | Bacteria | 1274 |
| 12 | Ga0070689_100008344 | 3300005340 | Bacteria | 7293 |
| 13 | Ga0070691_10080581 | 3300005341 | Bacteria | 1593 |
| 14 | Ga0070687_100023016 | 3300005343 | Bacteria | 2955 |
| 15 | Ga0070692_10294754 | 3300005345 | Bacteria | 988 |
| 16 | Ga0070668_100273814 | 3300005347 | Bacteria | 1408 |
| 17 | Ga0070669_100506668 | 3300005353 | Bacteria | 1002 |
| 18 | Ga0070675_100028237 | 3300005354 | Bacteria | 4515 |
| 19 | Ga0070674_100090759 | 3300005356 | Bacteria | 2204 |
| 20 | Ga0070673_100084104 | 3300005364 | Bacteria | 2587 |
| 21 | Ga0070659_100457691 | 3300005366 | Bacteria | 1083 |
| 22 | Ga0070667_100488441 | 3300005367 | Bacteria | 1128 |
| 23 | Ga0070709_10163555 | 3300005434 | Unclassified | 1549 |
| 24 | Ga0070713_100500158 | 3300005436 | Bacteria | 1147 |
| 25 | Ga0070701_10133903 | 3300005438 | Bacteria | 1411 |
| 26 | Ga0070711_100368217 | 3300005439 | Bacteria | 1159 |
| 27 | Ga0070705_100056825 | 3300005440 | Bacteria | 2306 |
| 28 | Ga0070705_100114590 | 3300005440 | Bacteria | 1729 |
| 29 | Ga0070700_100043400 | 3300005441 | Bacteria | 2766 |
| 30 | Ga0070700_100382334 | 3300005441 | Bacteria | 1053 |
| 31 | Ga0070694_100036437 | 3300005444 | Bacteria | 3259 |
| 32 | Ga0070694_100441393 | 3300005444 | Bacteria | 1026 |
| 33 | Ga0070663_100001921 | 3300005455 | Bacteria | 11606 |
| 34 | Ga0070681_10012343 | 3300005458 | Bacteria | 8472 |
| 35 | Ga0070681_10126026 | 3300005458 | Bacteria | 2493 |
| 36 | Ga0070681_10179944 | 3300005458 | Unclassified | 2036 |
| 37 | Ga0068867_100019404 | 3300005459 | Bacteria | 4845 |
| 38 | Ga0070707_100002246 | 3300005468 | Bacteria | 18427 |
| 39 | Ga0070698_100982571 | 3300005471 | Bacteria | 791 |
| 40 | Ga0070679_100239497 | 3300005530 | Bacteria | 1772 |
| 41 | Ga0070697_100315131 | 3300005536 | Bacteria | 1346 |
| 42 | Ga0068853_100285899 | 3300005539 | Bacteria | 1521 |
| 43 | Ga0070686_100037702 | 3300005544 | Bacteria | 3000 |
| 44 | Ga0070686_100262993 | 3300005544 | Bacteria | 1265 |
| 45 | Ga0070695_100066101 | 3300005545 | Bacteria | 2356 |
| 46 | Ga0070696_100011588 | 3300005546 | Bacteria | 5908 |
| 47 | Ga0070696_100085399 | 3300005546 | Bacteria | 2240 |
| 48 | Ga0070696_100401697 | 3300005546 | Bacteria | 1072 |
| 49 | Ga0070696_100744692 | 3300005546 | Bacteria | 802 |
| 50 | Ga0070693_100028577 | 3300005547 | Bacteria | 3033 |
| 51 | Ga0070704_100658248 | 3300005549 | Bacteria | 925 |
| 52 | Ga0070664_100182279 | 3300005564 | Bacteria | 1867 |
| 53 | Ga0070702_100018457 | 3300005615 | Bacteria | 3620 |
| 54 | Ga0068852_100262023 | 3300005616 | Bacteria | 1660 |
| 55 | Ga0068852_100549776 | 3300005616 | Bacteria | 1155 |
| 56 | Ga0068859_100060102 | 3300005617 | Bacteria | 3829 |
| 57 | Ga0068861_100252163 | 3300005719 | Bacteria | 1506 |
| 58 | Ga0068870_10013919 | 3300005840 | Bacteria | 3789 |
| 59 | Ga0068863_100012608 | 3300005841 | Bacteria | 8154 |
| 60 | Ga0068858_100310217 | 3300005842 | Bacteria | 1506 |
| 61 | Ga0068860_100114827 | 3300005843 | Bacteria | 2574 |
| 62 | Ga0081538_10061536 | 3300005981 | Bacteria | 2148 |
| 63 | Ga0081540_1004095 | 3300005983 | Bacteria | 11265 |
| 64 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 65 | Ga0075365_10011584 | 3300006038 | Bacteria | 5193 |
| 66 | Ga0075432_10038557 | 3300006058 | Bacteria | 1665 |
| 67 | Ga0075362_10012081 | 3300006177 | Bacteria | 3420 |
| 68 | Ga0075367_10000175 | 3300006178 | Bacteria | 20774 |
| 69 | Ga0075366_10000180 | 3300006195 | Bacteria | 27599 |
| 70 | Ga0075370_10174272 | 3300006353 | Bacteria | 1265 |
| 71 | Ga0068871_100293331 | 3300006358 | Bacteria | 1426 |
| 72 | Ga0075428_100560251 | 3300006844 | Bacteria | 1222 |
| 73 | Ga0075431_100474425 | 3300006847 | Bacteria | 1244 |
| 74 | Ga0075433_10001423 | 3300006852 | Bacteria | 17629 |
| 75 | Ga0075434_100576687 | 3300006871 | Bacteria | 1144 |
| 76 | Ga0068865_100222119 | 3300006881 | Bacteria | 1477 |
| 77 | Ga0097620_100007111 | 3300006931 | Bacteria | 11360 |
| 78 | Ga0097620_100060102 | 3300006931 | Bacteria | 3829 |
| 79 | Ga0075435_100179856 | 3300007076 | Bacteria | 1787 |
| 80 | Ga0111539_10001286 | 3300009094 | Bacteria | 33550 |
| 81 | Ga0111539_10050821 | 3300009094 | Bacteria | 4939 |
| 82 | Ga0111539_10065612 | 3300009094 | Bacteria | 4289 |
| 83 | Ga0111539_10542080 | 3300009094 | Bacteria | 1355 |
| 84 | Ga0111539_10552138 | 3300009094 | Unclassified | 1342 |
| 85 | Ga0111539_11287269 | 3300009094 | Bacteria | 849 |
| 86 | Ga0105245_10021974 | 3300009098 | Bacteria | 5599 |
| 87 | Ga0105245_10393784 | 3300009098 | Bacteria | 1383 |
| 88 | Ga0105247_10002408 | 3300009101 | Bacteria | 12723 |
| 89 | Ga0114129_10883767 | 3300009147 | Bacteria | 1134 |
| 90 | Ga0105243_10053976 | 3300009148 | Bacteria | 3189 |
| 91 | Ga0105243_10101331 | 3300009148 | Bacteria | 2391 |
| 92 | Ga0105241_10007414 | 3300009174 | Bacteria | 8073 |
| 93 | Ga0105242_10026917 | 3300009176 | Bacteria | 4561 |
| 94 | Ga0105248_10007418 | 3300009177 | Bacteria | 12032 |
| 95 | Ga0105237_10101455 | 3300009545 | Bacteria | 2870 |
| 96 | Ga0105249_10161340 | 3300009553 | Bacteria | 2167 |
| 97 | Ga0105239_10390309 | 3300010375 | Bacteria | 1575 |
| 98 | Ga0105246_10073926 | 3300011119 | Bacteria | 2408 |
| 99 | Ga0157378_10000738 | 3300013297 | Bacteria | 30560 |
| 100 | Ga0163162_10026308 | 3300013306 | Bacteria | 5750 |
| 101 | Ga0157375_10149103 | 3300013308 | Bacteria | 2473 |
| 102 | Ga0157380_10045923 | 3300014326 | Bacteria | 3430 |
| 103 | Ga0157380_11188293 | 3300014326 | Bacteria | 806 |
| 104 | Ga0157379_10301735 | 3300014968 | Bacteria | 1460 |
| 105 | Ga0157376_10044050 | 3300014969 | Bacteria | 3666 |
| 106 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 107 | Ga0207710_10002630 | 3300025900 | Bacteria | 8285 |
| 108 | Ga0207684_10000019 | 3300025910 | Bacteria | 353902 |
| 109 | Ga0207654_10006839 | 3300025911 | Bacteria | 5740 |
| 110 | Ga0207707_10003597 | 3300025912 | Bacteria | 13745 |
| 111 | Ga0207707_10072939 | 3300025912 | Bacteria | 2993 |
| 112 | Ga0207671_10131622 | 3300025914 | Bacteria | 1920 |
| 113 | Ga0207671_10145797 | 3300025914 | Bacteria | 1826 |
| 114 | Ga0207660_10091363 | 3300025917 | Bacteria | 2258 |
| 115 | Ga0207660_10488032 | 3300025917 | Bacteria | 999 |
| 116 | Ga0207662_10060683 | 3300025918 | Bacteria | 2268 |
| 117 | Ga0207652_10504962 | 3300025921 | Bacteria | 1089 |
| 118 | Ga0207646_10005434 | 3300025922 | Bacteria | 13405 |
| 119 | Ga0207681_10000012 | 3300025923 | Bacteria | 361565 |
| 120 | Ga0207681_10059036 | 3300025923 | Bacteria | 2629 |
| 121 | Ga0207659_10018759 | 3300025926 | Bacteria | 4540 |
| 122 | Ga0207687_10059020 | 3300025927 | Bacteria | 2701 |
| 123 | Ga0207687_10276684 | 3300025927 | Bacteria | 1344 |
| 124 | Ga0207669_10015420 | 3300025937 | Bacteria | 3854 |
| 125 | Ga0207669_10362709 | 3300025937 | Bacteria | 1123 |
| 126 | Ga0207704_10114752 | 3300025938 | Bacteria | 1829 |
| 127 | Ga0207691_10030147 | 3300025940 | Bacteria | 5070 |
| 128 | Ga0207711_10187270 | 3300025941 | Bacteria | 1885 |
| 129 | Ga0207711_10530295 | 3300025941 | Bacteria | 1098 |
| 130 | Ga0207689_10011002 | 3300025942 | Bacteria | 7779 |
| 131 | Ga0207679_10197734 | 3300025945 | Unclassified | 1677 |
| 132 | Ga0207651_10083819 | 3300025960 | Bacteria | 2307 |
| 133 | Ga0207712_10034514 | 3300025961 | Bacteria | 3428 |
| 134 | Ga0207712_10148595 | 3300025961 | Bacteria | 1807 |
| 135 | Ga0207668_10847022 | 3300025972 | Bacteria | 811 |
| 136 | Ga0207640_10471610 | 3300025981 | Bacteria | 1039 |
| 137 | Ga0207658_10590657 | 3300025986 | Bacteria | 997 |
| 138 | Ga0207703_10345262 | 3300026035 | Bacteria | 1369 |
| 139 | Ga0207678_10008470 | 3300026067 | Bacteria | 9069 |
| 140 | Ga0207678_10080002 | 3300026067 | Bacteria | 2798 |
| 141 | Ga0207708_10004550 | 3300026075 | Bacteria | 10209 |
| 142 | Ga0207708_10208772 | 3300026075 | Bacteria | 1560 |
| 143 | Ga0207641_10062324 | 3300026088 | Bacteria | 3182 |
| 144 | Ga0207648_10007462 | 3300026089 | Bacteria | 10749 |
| 145 | Ga0207675_100084134 | 3300026118 | Bacteria | 2985 |
| 146 | Ga0207675_100338624 | 3300026118 | Bacteria | 1472 |
| 147 | Ga0207698_10191921 | 3300026142 | Bacteria | 1821 |
| 148 | Ga0207428_10001146 | 3300027907 | Bacteria | 28682 |
| 149 | Ga0207428_10010255 | 3300027907 | Bacteria | 8374 |
| 150 | Ga0207428_10147748 | 3300027907 | Bacteria | 1791 |
| 151 | Ga0207428_10337962 | 3300027907 | Bacteria | 1110 |
| 152 | Ga0268265_10102176 | 3300028380 | Bacteria | 2318 |
| 153 | Ga0268264_10227128 | 3300028381 | Bacteria | 1721 |
| 154 | Ga0265338_10052621 | 3300028800 | Bacteria | 3651 |
| 155 | Ga0265325_10000018 | 3300031241 | Bacteria | 128451 |
| 156 | Ga0265313_10061352 | 3300031595 | Bacteria | 1760 |
| 157 | Ga0373961_0035253 | 3300035241 | Bacteria | 1419 |
| 158 | Ga0373962_0035388 | 3300035242 | Unclassified | 1387 |
| 159 | Ga0373931_0874808 | 3300035691 | Bacteria | 603 |
| 160 | Ga0395900_0171594 | 3300037418 | Bacteria | 2207 |
| 161 | Ga0395900_1203143 | 3300037418 | Bacteria | 673 |
| 162 | Ga0395898_0026117 | 3300037466 | Bacteria | 5878 |
| 163 | Ga0395898_0134424 | 3300037466 | Bacteria | 2368 |
| 164 | Ga0395905_0324791 | 3300037471 | Bacteria | 1429 |
| 165 | Ga0395901_0023434 | 3300038443 | Bacteria | 6329 |
| 166 | Ga0436361_0996589 | 3300039447 | Bacteria | 1736 |
| 167 | Ga0439465_0056677 | 3300041413 | Bacteria | 1292 |
| 168 | Ga0495606_0001096 | 3300046507 | Bacteria | 38817 |
| 169 | Ga0495632_0014505 | 3300046519 | Bacteria | 4453 |
| 170 | Ga0495643_0159716 | 3300046522 | Bacteria | 1110 |
| 171 | Ga0495644_0118265 | 3300046523 | Bacteria | 1007 |
| 172 | Ga0495648_0038684 | 3300046524 | Bacteria | 3046 |
| 173 | Ga0495609_0005187 | 3300046538 | Bacteria | 6934 |
| 174 | Ga0495633_0238209 | 3300046558 | Bacteria | 831 |
| 175 | Ga0495625_0096725 | 3300046660 | Bacteria | 2033 |
| 176 | Ga0495672_0000303 | 3300047320 | Bacteria | 66366 |
| 177 | Ga0496102_0011523 | 3300048905 | Bacteria | 7626 |
| 178 | Ga0496102_1115491 | 3300048905 | Bacteria | 709 |
| 179 | Ga0496102_1128294 | 3300048905 | Unclassified | 704 |
| 180 | Ga0496103_0357224 | 3300048906 | Bacteria | 939 |
| 181 | Ga0496106_0008583 | 3300048909 | Bacteria | 7560 |
| 182 | Ga0496109_0934478 | 3300048912 | Bacteria | 805 |
| 183 | Ga0496111_0900420 | 3300048914 | Bacteria | 637 |
| 184 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 185 | Ga0496115_0001708 | 3300048918 | Bacteria | 15743 |
| 186 | Ga0496115_0062003 | 3300048918 | Bacteria | 3016 |
| 187 | Ga0496116_0183954 | 3300048919 | Bacteria | 1115 |
| 188 | Ga0496117_0006616 | 3300048920 | Bacteria | 11647 |
| 189 | Ga0496118_0007403 | 3300048921 | Bacteria | 11647 |
| 190 | Ga0496119_0006485 | 3300048922 | Bacteria | 10807 |
| 191 | Ga0496120_0030393 | 3300048923 | Bacteria | 3284 |
| 192 | Ga0496121_0001607 | 3300048924 | Bacteria | 37512 |
| 193 | Ga0496121_0006397 | 3300048924 | Bacteria | 14645 |
| 194 | Ga0496124_0000946 | 3300048927 | Bacteria | 46483 |
| 195 | Ga0496124_0007434 | 3300048927 | Bacteria | 11642 |
| 196 | Ga0496125_0118810 | 3300048928 | Bacteria | 1892 |
| 197 | Ga0496126_0190167 | 3300048929 | Bacteria | 1739 |
| 198 | Ga0496126_0398801 | 3300048929 | Bacteria | 1116 |
| 199 | Ga0501034_0074921 | 3300049571 | Bacteria | 3392 |
| 200 | Ga0501036_0017631 | 3300049572 | Bacteria | 5974 |
| 201 | Ga0501036_0072002 | 3300049572 | Bacteria | 2922 |
| 202 | Ga0501037_0036897 | 3300049573 | Bacteria | 3602 |
| 203 | Ga0501037_0052998 | 3300049573 | Bacteria | 2967 |
| 204 | Ga0501038_0019550 | 3300049574 | Bacteria | 6103 |
| 205 | Ga0501038_0066800 | 3300049574 | Bacteria | 3061 |
| 206 | Ga0501039_0019116 | 3300049575 | Bacteria | 5256 |
| 207 | Ga0501041_0018501 | 3300049577 | Bacteria | 4150 |
| 208 | Ga0501042_0016250 | 3300049578 | Bacteria | 5107 |
| 209 | Ga0501043_0035108 | 3300049579 | Bacteria | 3944 |
| 210 | Ga0501043_0083500 | 3300049579 | Unclassified | 2511 |
| 211 | Ga0501047_0098868 | 3300049581 | Bacteria | 2796 |
| 212 | Ga0501048_0028280 | 3300049582 | Bacteria | 4069 |
| 213 | Ga0501070_0040310 | 3300049586 | Bacteria | 3894 |
| 214 | Ga0501070_0187868 | 3300049586 | Bacteria | 1699 |
| 215 | Ga0501071_0065037 | 3300049587 | Bacteria | 2647 |
| 216 | Ga0501072_0025794 | 3300049588 | Bacteria | 4579 |
| 217 | Ga0501074_0113066 | 3300049590 | Bacteria | 1943 |
| 218 | Ga0501075_0022109 | 3300049591 | Bacteria | 4643 |
| 219 | Ga0501076_0026002 | 3300049592 | Bacteria | 4531 |
| 220 | Ga0501077_0509721 | 3300049593 | Bacteria | 771 |
| 221 | Ga0501079_0033501 | 3300049741 | Bacteria | 3952 |
| 222 | Ga0501035_0063070 | 3300049822 | Bacteria | 3297 |
| 223 | Ga0501035_0149913 | 3300049822 | Bacteria | 2024 |
| 224 | Ga0501044_0066949 | 3300049823 | Bacteria | 3660 |
| 225 | Ga0501045_0016832 | 3300049824 | Bacteria | 5193 |
| 226 | nmdc:mga03683_4294_c1 | 3300050489 | Bacteria | 4706 |
| 227 | nmdc:mga00v17_6758_c1 | 3300050491 | Bacteria | 6095 |
| 228 | nmdc:mga0yw44_7072_c1 | 3300050492 | Bacteria | 5493 |
| 229 | nmdc:mga0k408_411_c1 | 3300050493 | Bacteria | 23440 |
| 230 | nmdc:mga06z11_288992_c1 | 3300050494 | Bacteria | 972 |
| 231 | nmdc:mga06z11_508_c1 | 3300050494 | Bacteria | 14366 |
| 232 | nmdc:mga04h51_319782_c1 | 3300050495 | Bacteria | 636 |
| 233 | nmdc:mga07m45_188240_c1 | 3300050496 | Bacteria | 1200 |
| 234 | nmdc:mga05p37_329635_c1 | 3300050507 | Bacteria | 1804 |
| 235 | nmdc:mga05p37_622339_c1 | 3300050507 | Bacteria | 1214 |
| 236 | nmdc:mga05p37_647657_c1 | 3300050507 | Unclassified | 1184 |
| 237 | nmdc:mga06r32_117087_c1 | 3300050510 | Bacteria | 2626 |
| 238 | nmdc:mga08y16_13555_c1 | 3300050511 | Bacteria | 8580 |
| 239 | nmdc:mga08y16_14033_c1 | 3300050511 | Bacteria | 8433 |
| 240 | nmdc:mga08y16_17510_c1 | 3300050511 | Bacteria | 7546 |
| 241 | nmdc:mga0n895_562319_c1 | 3300050512 | Bacteria | 1146 |
| 242 | nmdc:mga0rr50_83613_c1 | 3300050513 | Bacteria | 1238 |
| 243 | nmdc:mga08x19_681884_c1 | 3300050514 | Bacteria | 729 |
| 244 | nmdc:mga0a205_7412_c1 | 3300050515 | Bacteria | 9935 |
| 245 | Ga0500641_0002303 | 3300053096 | Bacteria | 6773 |
| 246 | Ga0500650_0070364 | 3300053098 | Bacteria | 1636 |
| 247 | Ga0500555_016225 | 3300053103 | Bacteria | 2146 |
| 248 | Ga0500556_0006989 | 3300053104 | Bacteria | 3219 |
| 249 | Ga0500562_008315 | 3300053108 | Bacteria | 2621 |
| 250 | Ga0500569_175184 | 3300053109 | Bacteria | 728 |
| 251 | Ga0500559_0002879 | 3300053136 | Bacteria | 8687 |
| 252 | Ga0500568_0001112 | 3300053139 | Bacteria | 18049 |
| 253 | Ga0500604_0002096 | 3300053151 | Bacteria | 5493 |
| 254 | Ga0500604_0031665 | 3300053151 | Bacteria | 1554 |
| 255 | Ga0500616_0014124 | 3300053153 | Bacteria | 4601 |
| 256 | Ga0500616_0014739 | 3300053153 | Bacteria | 4485 |
| 257 | Ga0500645_036879 | 3300053730 | Bacteria | 1453 |
| 258 | Ga0501084_0021093 | 3300054114 | Bacteria | 5434 |
| 259 | Ga0501082_0044007 | 3300060353 | Bacteria | 3851 |
| 260 | Ga0530510_0056041 | 3300061734 | Bacteria | 2847 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100500158 | Ga0070713_1005001581 | 167 |
| 2 | 3300014326 | Ga0157380_11188293 | Ga0157380_111882931 | 167 |
| 3 | 3300006038 | Ga0075365_10011584 | Ga0075365_100115843 | 173 |
| 4 | 3300037418 | Ga0395900_1203143 | Ga0395900_1203143_95_643 | 174 |
| 5 | 3300037466 | Ga0395898_0134424 | Ga0395898_0134424_1005_1553 | 174 |
| 6 | 3300038443 | Ga0395901_0023434 | Ga0395901_0023434_4076_4606 | 176 |
| 7 | 3300050510 | nmdc:mga06r32_117087_c1 | nmdc:mga06r32_117087_c1_560_1090 | 176 |
| 8 | 3300005981 | Ga0081538_10061536 | Ga0081538_100615362 | 177 |
| 9 | 3300006058 | Ga0075432_10038557 | Ga0075432_100385572 | 177 |
| 10 | 3300006847 | Ga0075431_100474425 | Ga0075431_1004744252 | 177 |
| 11 | 3300009094 | Ga0111539_10552138 | Ga0111539_105521382 | 177 |
| 12 | 3300027907 | Ga0207428_10337962 | Ga0207428_103379622 | 177 |
| 13 | 3300050507 | nmdc:mga05p37_329635_c1 | nmdc:mga05p37_329635_c1_100_633 | 177 |
| 14 | 3300050507 | nmdc:mga05p37_647657_c1 | nmdc:mga05p37_647657_c1_40_573 | 177 |
| 15 | 3300005468 | Ga0070707_100002246 | Ga0070707_1000022469 | 178 |
| 16 | 3300006931 | Ga0097620_100007111 | Ga0097620_1000071119 | 178 |
| 17 | 3300009101 | Ga0105247_10002408 | Ga0105247_100024086 | 178 |
| 18 | 3300025900 | Ga0207710_10002630 | Ga0207710_100026304 | 178 |
| 19 | 3300025910 | Ga0207684_10000019 | Ga0207684_1000001942 | 178 |
| 20 | 3300025922 | Ga0207646_10005434 | Ga0207646_100054348 | 178 |
| 21 | 3300053136 | Ga0500559_0002879 | Ga0500559_0002879_3344_3883 | 178 |
| 22 | 3300005330 | Ga0070690_100005575 | Ga0070690_1000055755 | 179 |
| 23 | 3300005336 | Ga0070680_100923473 | Ga0070680_1009234731 | 179 |
| 24 | 3300005340 | Ga0070689_100008344 | Ga0070689_1000083444 | 179 |
| 25 | 3300005343 | Ga0070687_100023016 | Ga0070687_1000230162 | 179 |
| 26 | 3300005347 | Ga0070668_100273814 | Ga0070668_1002738141 | 179 |
| 27 | 3300005353 | Ga0070669_100506668 | Ga0070669_1005066682 | 179 |
| 28 | 3300005354 | Ga0070675_100028237 | Ga0070675_1000282372 | 179 |
| 29 | 3300005356 | Ga0070674_100090759 | Ga0070674_1000907593 | 179 |
| 30 | 3300005364 | Ga0070673_100084104 | Ga0070673_1000841042 | 179 |
| 31 | 3300005366 | Ga0070659_100457691 | Ga0070659_1004576912 | 179 |
| 32 | 3300005367 | Ga0070667_100488441 | Ga0070667_1004884411 | 179 |
| 33 | 3300005438 | Ga0070701_10133903 | Ga0070701_101339032 | 179 |
| 34 | 3300005439 | Ga0070711_100368217 | Ga0070711_1003682171 | 179 |
| 35 | 3300005440 | Ga0070705_100056825 | Ga0070705_1000568252 | 179 |
| 36 | 3300005441 | Ga0070700_100043400 | Ga0070700_1000434003 | 179 |
| 37 | 3300005444 | Ga0070694_100441393 | Ga0070694_1004413931 | 179 |
| 38 | 3300005459 | Ga0068867_100019404 | Ga0068867_1000194042 | 179 |
| 39 | 3300005544 | Ga0070686_100037702 | Ga0070686_1000377023 | 179 |
| 40 | 3300005546 | Ga0070696_100085399 | Ga0070696_1000853992 | 179 |
| 41 | 3300005546 | Ga0070696_100401697 | Ga0070696_1004016972 | 179 |
| 42 | 3300005546 | Ga0070696_100744692 | Ga0070696_1007446922 | 179 |
| 43 | 3300005564 | Ga0070664_100182279 | Ga0070664_1001822792 | 179 |
| 44 | 3300005615 | Ga0070702_100018457 | Ga0070702_1000184572 | 179 |
| 45 | 3300005616 | Ga0068852_100549776 | Ga0068852_1005497762 | 179 |
| 46 | 3300005617 | Ga0068859_100060102 | Ga0068859_1000601023 | 179 |
| 47 | 3300005719 | Ga0068861_100252163 | Ga0068861_1002521632 | 179 |
| 48 | 3300005840 | Ga0068870_10013919 | Ga0068870_100139194 | 179 |
| 49 | 3300005841 | Ga0068863_100012608 | Ga0068863_1000126086 | 179 |
| 50 | 3300005842 | Ga0068858_100310217 | Ga0068858_1003102172 | 179 |
| 51 | 3300005843 | Ga0068860_100114827 | Ga0068860_1001148273 | 179 |
| 52 | 3300006177 | Ga0075362_10012081 | Ga0075362_100120812 | 179 |
| 53 | 3300006178 | Ga0075367_10000175 | Ga0075367_1000017510 | 179 |
| 54 | 3300006195 | Ga0075366_10000180 | Ga0075366_1000018014 | 179 |
| 55 | 3300006353 | Ga0075370_10174272 | Ga0075370_101742722 | 179 |
| 56 | 3300006358 | Ga0068871_100293331 | Ga0068871_1002933312 | 179 |
| 57 | 3300006881 | Ga0068865_100222119 | Ga0068865_1002221192 | 179 |
| 58 | 3300006931 | Ga0097620_100060102 | Ga0097620_1000601023 | 179 |
| 59 | 3300009094 | Ga0111539_10001286 | Ga0111539_1000128610 | 179 |
| 60 | 3300009098 | Ga0105245_10393784 | Ga0105245_103937842 | 179 |
| 61 | 3300009148 | Ga0105243_10053976 | Ga0105243_100539761 | 179 |
| 62 | 3300009177 | Ga0105248_10007418 | Ga0105248_100074186 | 179 |
| 63 | 3300009553 | Ga0105249_10161340 | Ga0105249_101613402 | 179 |
| 64 | 3300013308 | Ga0157375_10149103 | Ga0157375_101491032 | 179 |
| 65 | 3300014326 | Ga0157380_10045923 | Ga0157380_100459233 | 179 |
| 66 | 3300014968 | Ga0157379_10301735 | Ga0157379_103017352 | 179 |
| 67 | 3300025917 | Ga0207660_10091363 | Ga0207660_100913633 | 179 |
| 68 | 3300025918 | Ga0207662_10060683 | Ga0207662_100606832 | 179 |
| 69 | 3300025921 | Ga0207652_10504962 | Ga0207652_105049621 | 179 |
| 70 | 3300025923 | Ga0207681_10000012 | Ga0207681_1000001275 | 179 |
| 71 | 3300025923 | Ga0207681_10059036 | Ga0207681_100590362 | 179 |
| 72 | 3300025926 | Ga0207659_10018759 | Ga0207659_100187592 | 179 |
| 73 | 3300025927 | Ga0207687_10276684 | Ga0207687_102766842 | 179 |
| 74 | 3300025937 | Ga0207669_10015420 | Ga0207669_100154202 | 179 |
| 75 | 3300025938 | Ga0207704_10114752 | Ga0207704_101147522 | 179 |
| 76 | 3300025940 | Ga0207691_10030147 | Ga0207691_100301472 | 179 |
| 77 | 3300025941 | Ga0207711_10187270 | Ga0207711_101872702 | 179 |
| 78 | 3300025942 | Ga0207689_10011002 | Ga0207689_100110026 | 179 |
| 79 | 3300025945 | Ga0207679_10197734 | Ga0207679_101977342 | 179 |
| 80 | 3300025960 | Ga0207651_10083819 | Ga0207651_100838192 | 179 |
| 81 | 3300025961 | Ga0207712_10034514 | Ga0207712_100345143 | 179 |
| 82 | 3300025961 | Ga0207712_10148595 | Ga0207712_101485952 | 179 |
| 83 | 3300025972 | Ga0207668_10847022 | Ga0207668_108470222 | 179 |
| 84 | 3300025981 | Ga0207640_10471610 | Ga0207640_104716102 | 179 |
| 85 | 3300025986 | Ga0207658_10590657 | Ga0207658_105906572 | 179 |
| 86 | 3300026035 | Ga0207703_10345262 | Ga0207703_103452622 | 179 |
| 87 | 3300026067 | Ga0207678_10080002 | Ga0207678_100800022 | 179 |
| 88 | 3300026075 | Ga0207708_10004550 | Ga0207708_100045502 | 179 |
| 89 | 3300026088 | Ga0207641_10062324 | Ga0207641_100623243 | 179 |
| 90 | 3300026089 | Ga0207648_10007462 | Ga0207648_100074625 | 179 |
| 91 | 3300026118 | Ga0207675_100084134 | Ga0207675_1000841342 | 179 |
| 92 | 3300026118 | Ga0207675_100338624 | Ga0207675_1003386242 | 179 |
| 93 | 3300027907 | Ga0207428_10001146 | Ga0207428_100011466 | 179 |
| 94 | 3300028380 | Ga0268265_10102176 | Ga0268265_101021762 | 179 |
| 95 | 3300028381 | Ga0268264_10227128 | Ga0268264_102271281 | 179 |
| 96 | 3300037418 | Ga0395900_0171594 | Ga0395900_0171594_421_969 | 179 |
| 97 | 3300037466 | Ga0395898_0026117 | Ga0395898_0026117_1079_1627 | 179 |
| 98 | 3300050489 | nmdc:mga03683_4294_c1 | nmdc:mga03683_4294_c1_3455_4021 | 179 |
| 99 | 3300050491 | nmdc:mga00v17_6758_c1 | nmdc:mga00v17_6758_c1_2661_3227 | 179 |
| 100 | 3300050492 | nmdc:mga0yw44_7072_c1 | nmdc:mga0yw44_7072_c1_1724_2290 | 179 |
| 101 | 3300050493 | nmdc:mga0k408_411_c1 | nmdc:mga0k408_411_c1_2870_3436 | 179 |
| 102 | 3300050494 | nmdc:mga06z11_508_c1 | nmdc:mga06z11_508_c1_4231_4797 | 179 |
| 103 | 3300050495 | nmdc:mga04h51_319782_c1 | nmdc:mga04h51_319782_c1_53_619 | 179 |
| 104 | 3300050496 | nmdc:mga07m45_188240_c1 | nmdc:mga07m45_188240_c1_278_844 | 179 |
| 105 | 3300050511 | nmdc:mga08y16_14033_c1 | nmdc:mga08y16_14033_c1_7023_7589 | 179 |
| 106 | 3300035242 | Ga0373962_0035388 | Ga0373962_0035388_574_1137 | 180 |
| 107 | 3300048905 | Ga0496102_1115491 | Ga0496102_1115491_116_676 | 181 |
| 108 | 3300048905 | Ga0496102_1128294 | Ga0496102_1128294_44_628 | 181 |
| 109 | 3300048912 | Ga0496109_0934478 | Ga0496109_0934478_71_631 | 181 |
| 110 | 3300048914 | Ga0496111_0900420 | Ga0496111_0900420_61_621 | 181 |
| 111 | 3300025941 | Ga0207711_10530295 | Ga0207711_105302952 | 183 |
| 112 | 3300035691 | Ga0373931_0874808 | Ga0373931_0874808_26_577 | 183 |
| 113 | 3300053104 | Ga0500556_0006989 | Ga0500556_0006989_953_1504 | 183 |
| 114 | 3300053108 | Ga0500562_008315 | Ga0500562_008315_845_1396 | 183 |
| 115 | 3300053153 | Ga0500616_0014739 | Ga0500616_0014739_3510_4061 | 183 |
| 116 | 3300053730 | Ga0500645_036879 | Ga0500645_036879_736_1290 | 183 |
| 117 | 3300005434 | Ga0070709_10163555 | Ga0070709_101635553 | 184 |
| 118 | 3300046519 | Ga0495632_0014505 | Ga0495632_0014505_838_1395 | 184 |
| 119 | 3300046522 | Ga0495643_0159716 | Ga0495643_0159716_117_674 | 184 |
| 120 | 3300046523 | Ga0495644_0118265 | Ga0495644_0118265_13_570 | 184 |
| 121 | 3300046524 | Ga0495648_0038684 | Ga0495648_0038684_1026_1583 | 184 |
| 122 | 3300046660 | Ga0495625_0096725 | Ga0495625_0096725_1457_2014 | 184 |
| 123 | 3300047320 | Ga0495672_0000303 | Ga0495672_0000303_39201_39758 | 184 |
| 124 | 3300053096 | Ga0500641_0002303 | Ga0500641_0002303_720_1286 | 184 |
| 125 | 3300053103 | Ga0500555_016225 | Ga0500555_016225_677_1234 | 184 |
| 126 | 3300053153 | Ga0500616_0014124 | Ga0500616_0014124_2959_3516 | 184 |
| 127 | 3300003771 | Ga0055526_1000049 | Ga0055526_100004951 | 185 |
| 128 | 3300005337 | Ga0070682_100251632 | Ga0070682_1002516322 | 185 |
| 129 | 3300005341 | Ga0070691_10080581 | Ga0070691_100805812 | 185 |
| 130 | 3300005440 | Ga0070705_100114590 | Ga0070705_1001145901 | 185 |
| 131 | 3300005455 | Ga0070663_100001921 | Ga0070663_10000192112 | 185 |
| 132 | 3300005458 | Ga0070681_10012343 | Ga0070681_100123435 | 185 |
| 133 | 3300005530 | Ga0070679_100239497 | Ga0070679_1002394972 | 185 |
| 134 | 3300005536 | Ga0070697_100315131 | Ga0070697_1003151312 | 185 |
| 135 | 3300005544 | Ga0070686_100262993 | Ga0070686_1002629931 | 185 |
| 136 | 3300005545 | Ga0070695_100066101 | Ga0070695_1000661012 | 185 |
| 137 | 3300005546 | Ga0070696_100011588 | Ga0070696_1000115883 | 185 |
| 138 | 3300005547 | Ga0070693_100028577 | Ga0070693_1000285773 | 185 |
| 139 | 3300009098 | Ga0105245_10021974 | Ga0105245_100219743 | 185 |
| 140 | 3300009148 | Ga0105243_10101331 | Ga0105243_101013312 | 185 |
| 141 | 3300009174 | Ga0105241_10007414 | Ga0105241_1000741410 | 185 |
| 142 | 3300009176 | Ga0105242_10026917 | Ga0105242_100269172 | 185 |
| 143 | 3300009545 | Ga0105237_10101455 | Ga0105237_101014552 | 185 |
| 144 | 3300010375 | Ga0105239_10390309 | Ga0105239_103903092 | 185 |
| 145 | 3300011119 | Ga0105246_10073926 | Ga0105246_100739263 | 185 |
| 146 | 3300013297 | Ga0157378_10000738 | Ga0157378_1000073819 | 185 |
| 147 | 3300013306 | Ga0163162_10026308 | Ga0163162_100263082 | 185 |
| 148 | 3300014969 | Ga0157376_10044050 | Ga0157376_100440503 | 185 |
| 149 | 3300025295 | Ga0209564_1000015 | Ga0209564_1000015445 | 185 |
| 150 | 3300025911 | Ga0207654_10006839 | Ga0207654_100068398 | 185 |
| 151 | 3300025912 | Ga0207707_10003597 | Ga0207707_1000359710 | 185 |
| 152 | 3300025914 | Ga0207671_10131622 | Ga0207671_101316222 | 185 |
| 153 | 3300025927 | Ga0207687_10059020 | Ga0207687_100590202 | 185 |
| 154 | 3300025937 | Ga0207669_10362709 | Ga0207669_103627092 | 185 |
| 155 | 3300026067 | Ga0207678_10008470 | Ga0207678_100084708 | 185 |
| 156 | 3300048905 | Ga0496102_0011523 | Ga0496102_0011523_4050_4607 | 185 |
| 157 | 3300048906 | Ga0496103_0357224 | Ga0496103_0357224_88_645 | 185 |
| 158 | 3300048909 | Ga0496106_0008583 | Ga0496106_0008583_3385_3942 | 185 |
| 159 | 3300048918 | Ga0496115_0001708 | Ga0496115_0001708_10786_11343 | 185 |
| 160 | 3300048918 | Ga0496115_0062003 | Ga0496115_0062003_1763_2332 | 185 |
| 161 | 3300048929 | Ga0496126_0398801 | Ga0496126_0398801_108_695 | 185 |
| 162 | 3300049579 | Ga0501043_0083500 | Ga0501043_0083500_962_1519 | 185 |
| 163 | 3300050494 | nmdc:mga06z11_288992_c1 | nmdc:mga06z11_288992_c1_64_621 | 185 |
| 164 | 3300053098 | Ga0500650_0070364 | Ga0500650_0070364_526_1083 | 185 |
| 165 | 3300005441 | Ga0070700_100382334 | Ga0070700_1003823341 | 186 |
| 166 | 3300005444 | Ga0070694_100036437 | Ga0070694_1000364372 | 186 |
| 167 | 3300005458 | Ga0070681_10126026 | Ga0070681_101260262 | 186 |
| 168 | 3300005549 | Ga0070704_100658248 | Ga0070704_1006582481 | 186 |
| 169 | 3300005983 | Ga0081540_1004095 | Ga0081540_10040954 | 186 |
| 170 | 3300006844 | Ga0075428_100560251 | Ga0075428_1005602512 | 186 |
| 171 | 3300006852 | Ga0075433_10001423 | Ga0075433_100014239 | 186 |
| 172 | 3300006871 | Ga0075434_100576687 | Ga0075434_1005766872 | 186 |
| 173 | 3300007076 | Ga0075435_100179856 | Ga0075435_1001798563 | 186 |
| 174 | 3300009094 | Ga0111539_10065612 | Ga0111539_100656123 | 186 |
| 175 | 3300009094 | Ga0111539_10542080 | Ga0111539_105420801 | 186 |
| 176 | 3300025912 | Ga0207707_10072939 | Ga0207707_100729392 | 186 |
| 177 | 3300026075 | Ga0207708_10208772 | Ga0207708_102087721 | 186 |
| 178 | 3300027907 | Ga0207428_10010255 | Ga0207428_100102551 | 186 |
| 179 | 3300031241 | Ga0265325_10000018 | Ga0265325_1000001885 | 186 |
| 180 | 3300035241 | Ga0373961_0035253 | Ga0373961_0035253_699_1262 | 186 |
| 181 | 3300037471 | Ga0395905_0324791 | Ga0395905_0324791_217_780 | 186 |
| 182 | 3300041413 | Ga0439465_0056677 | Ga0439465_0056677_682_1257 | 186 |
| 183 | 3300048929 | Ga0496126_0190167 | Ga0496126_0190167_846_1415 | 186 |
| 184 | 3300049571 | Ga0501034_0074921 | Ga0501034_0074921_2146_2709 | 186 |
| 185 | 3300049572 | Ga0501036_0017631 | Ga0501036_0017631_3331_3948 | 186 |
| 186 | 3300049572 | Ga0501036_0072002 | Ga0501036_0072002_818_1381 | 186 |
| 187 | 3300049573 | Ga0501037_0036897 | Ga0501037_0036897_1707_2270 | 186 |
| 188 | 3300049573 | Ga0501037_0052998 | Ga0501037_0052998_2016_2633 | 186 |
| 189 | 3300049574 | Ga0501038_0019550 | Ga0501038_0019550_4677_5240 | 186 |
| 190 | 3300049574 | Ga0501038_0066800 | Ga0501038_0066800_2348_2965 | 186 |
| 191 | 3300049575 | Ga0501039_0019116 | Ga0501039_0019116_2314_2931 | 186 |
| 192 | 3300049577 | Ga0501041_0018501 | Ga0501041_0018501_1803_2420 | 186 |
| 193 | 3300049578 | Ga0501042_0016250 | Ga0501042_0016250_2257_2874 | 186 |
| 194 | 3300049579 | Ga0501043_0035108 | Ga0501043_0035108_1300_1863 | 186 |
| 195 | 3300049581 | Ga0501047_0098868 | Ga0501047_0098868_727_1290 | 186 |
| 196 | 3300049582 | Ga0501048_0028280 | Ga0501048_0028280_1316_1933 | 186 |
| 197 | 3300049586 | Ga0501070_0040310 | Ga0501070_0040310_2408_2971 | 186 |
| 198 | 3300049586 | Ga0501070_0187868 | Ga0501070_0187868_17_634 | 186 |
| 199 | 3300049587 | Ga0501071_0065037 | Ga0501071_0065037_1530_2147 | 186 |
| 200 | 3300049588 | Ga0501072_0025794 | Ga0501072_0025794_1918_2535 | 186 |
| 201 | 3300049590 | Ga0501074_0113066 | Ga0501074_0113066_494_1111 | 186 |
| 202 | 3300049591 | Ga0501075_0022109 | Ga0501075_0022109_2137_2754 | 186 |
| 203 | 3300049592 | Ga0501076_0026002 | Ga0501076_0026002_1040_1657 | 186 |
| 204 | 3300049593 | Ga0501077_0509721 | Ga0501077_0509721_65_682 | 186 |
| 205 | 3300049741 | Ga0501079_0033501 | Ga0501079_0033501_1757_2374 | 186 |
| 206 | 3300049822 | Ga0501035_0063070 | Ga0501035_0063070_583_1200 | 186 |
| 207 | 3300049822 | Ga0501035_0149913 | Ga0501035_0149913_492_1055 | 186 |
| 208 | 3300049823 | Ga0501044_0066949 | Ga0501044_0066949_1778_2341 | 186 |
| 209 | 3300049824 | Ga0501045_0016832 | Ga0501045_0016832_1923_2540 | 186 |
| 210 | 3300050511 | nmdc:mga08y16_13555_c1 | nmdc:mga08y16_13555_c1_6543_7106 | 186 |
| 211 | 3300050512 | nmdc:mga0n895_562319_c1 | nmdc:mga0n895_562319_c1_433_996 | 186 |
| 212 | 3300050513 | nmdc:mga0rr50_83613_c1 | nmdc:mga0rr50_83613_c1_289_852 | 186 |
| 213 | 3300050514 | nmdc:mga08x19_681884_c1 | nmdc:mga08x19_681884_c1_120_683 | 186 |
| 214 | 3300050515 | nmdc:mga0a205_7412_c1 | nmdc:mga0a205_7412_c1_835_1398 | 186 |
| 215 | 3300053109 | Ga0500569_175184 | Ga0500569_175184_110_679 | 186 |
| 216 | 3300053139 | Ga0500568_0001112 | Ga0500568_0001112_10813_11382 | 186 |
| 217 | 3300053151 | Ga0500604_0002096 | Ga0500604_0002096_1417_1986 | 186 |
| 218 | 3300053151 | Ga0500604_0031665 | Ga0500604_0031665_558_1127 | 186 |
| 219 | 3300054114 | Ga0501084_0021093 | Ga0501084_0021093_3054_3671 | 186 |
| 220 | 3300060353 | Ga0501082_0044007 | Ga0501082_0044007_1293_1910 | 186 |
| 221 | 3300061734 | Ga0530510_0056041 | Ga0530510_0056041_65_682 | 186 |
| 222 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_1000001415 | 188 |
| 223 | 3300005336 | Ga0070680_100246904 | Ga0070680_1002469042 | 188 |
| 224 | 3300005345 | Ga0070692_10294754 | Ga0070692_102947541 | 188 |
| 225 | 3300005458 | Ga0070681_10179944 | Ga0070681_101799442 | 188 |
| 226 | 3300005471 | Ga0070698_100982571 | Ga0070698_1009825712 | 188 |
| 227 | 3300005539 | Ga0068853_100285899 | Ga0068853_1002858992 | 188 |
| 228 | 3300005616 | Ga0068852_100262023 | Ga0068852_1002620232 | 188 |
| 229 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008157 | 188 |
| 230 | 3300009094 | Ga0111539_10050821 | Ga0111539_100508214 | 188 |
| 231 | 3300009094 | Ga0111539_11287269 | Ga0111539_112872692 | 188 |
| 232 | 3300009147 | Ga0114129_10883767 | Ga0114129_108837671 | 188 |
| 233 | 3300025917 | Ga0207660_10488032 | Ga0207660_104880321 | 188 |
| 234 | 3300026142 | Ga0207698_10191921 | Ga0207698_101919212 | 188 |
| 235 | 3300027907 | Ga0207428_10147748 | Ga0207428_101477482 | 188 |
| 236 | 3300031595 | Ga0265313_10061352 | Ga0265313_100613522 | 188 |
| 237 | 3300039447 | Ga0436361_0996589 | Ga0436361_0996589_509_1117 | 188 |
| 238 | 3300046507 | Ga0495606_0001096 | Ga0495606_0001096_28323_28934 | 188 |
| 239 | 3300046538 | Ga0495609_0005187 | Ga0495609_0005187_5514_6167 | 188 |
| 240 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_238321_238914 | 188 |
| 241 | 3300050507 | nmdc:mga05p37_622339_c1 | nmdc:mga05p37_622339_c1_604_1176 | 188 |
| 242 | 3300050511 | nmdc:mga08y16_17510_c1 | nmdc:mga08y16_17510_c1_4671_5240 | 188 |
| 243 | 3300028800 | Ga0265338_10052621 | Ga0265338_100526213 | 189 |
| 244 | 3300046558 | Ga0495633_0238209 | Ga0495633_0238209_99_803 | 191 |
| 245 | 3300002987 | JGI25159J45721_1000088 | JGI25159J45721_10000886 | 193 |
| 246 | 3300003354 | JGI25160J50197_1000229 | JGI25160J50197_10002296 | 193 |
| 247 | 3300003374 | JGI25161J50226_1000277 | JGI25161J50226_10002778 | 193 |
| 248 | 3300004625 | Ga0055543_1001461 | Ga0055543_10014614 | 193 |
| 249 | 3300005262 | Ga0065165_1000812 | Ga0065165_10008125 | 193 |
| 250 | 3300025914 | Ga0207671_10145797 | Ga0207671_101457972 | 193 |
| 251 | 3300048919 | Ga0496116_0183954 | Ga0496116_0183954_270_944 | 193 |
| 252 | 3300048920 | Ga0496117_0006616 | Ga0496117_0006616_10430_11104 | 193 |
| 253 | 3300048921 | Ga0496118_0007403 | Ga0496118_0007403_10430_11104 | 193 |
| 254 | 3300048922 | Ga0496119_0006485 | Ga0496119_0006485_9775_10449 | 193 |
| 255 | 3300048923 | Ga0496120_0030393 | Ga0496120_0030393_538_1212 | 193 |
| 256 | 3300048924 | Ga0496121_0001607 | Ga0496121_0001607_32471_33058 | 193 |
| 257 | 3300048924 | Ga0496121_0006397 | Ga0496121_0006397_3975_4649 | 193 |
| 258 | 3300048927 | Ga0496124_0000946 | Ga0496124_0000946_43398_43985 | 193 |
| 259 | 3300048927 | Ga0496124_0007434 | Ga0496124_0007434_10430_11104 | 193 |
| 260 | 3300048928 | Ga0496125_0118810 | Ga0496125_0118810_875_1549 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.97 | 8 | 182 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9673 | 4 | 193 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9664 | 8 | 184 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9628 | 5 | 188 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.9618 | 5 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9631 | 9 | 185 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9605 | 6 | 188 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9592 | 6 | 182 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.957 | 9 | 184 | 2.60.120.10 |
| 2b9uD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9503 | 7 | 185 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A1TYN0-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9973 | 9 | 193 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7K1PXZ3-F1-model_v4 | deleted | 0.9973 | 9 | 152 |
|
| AF-A0A068SRU5-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9938 | 22 | 193 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7X0CZE8-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9919 | 9 | 192 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A838N2P6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9909 | 53 | 193 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar