F369318

General Info

Members Datasets Scaffolds Average Seq Length
260 205 260 191

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100246904|Ga0070680_1002469042
Length 213
Sequence LLTNEADVRWRIRNAYLALARPEELILEIRPLHLADVKLVIPPIHRDTRGFFSETYNRKAMSAAGISTEFVQDNHTLSSESGTLRGLHFQAPPHAQGKLLRVTRGAIFDVAVDIRVGSPTFGQHATANLTAANWMQVWIPPGFAHGYCTLEPDTEVIYKVTDYYAPECDRGIKWDDAALGIKWPIAPDKVHLSEKDRNQPALKDIAPAFLFGR

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 3.85
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000088 3300002987 Bacteria 43781
2 JGI25406J46586_10000014 3300003203 Bacteria 93855
3 JGI25160J50197_1000229 3300003354 Bacteria 43781
4 JGI25161J50226_1000277 3300003374 Bacteria 29649
5 Ga0055526_1000049 3300003771 Bacteria 118394
6 Ga0055543_1001461 3300004625 Bacteria 9336
7 Ga0065165_1000812 3300005262 Bacteria 41449
8 Ga0070690_100005575 3300005330 Bacteria 7081
9 Ga0070680_100246904 3300005336 Bacteria 1509
10 Ga0070680_100923473 3300005336 Bacteria 753
11 Ga0070682_100251632 3300005337 Bacteria 1274
12 Ga0070689_100008344 3300005340 Bacteria 7293
13 Ga0070691_10080581 3300005341 Bacteria 1593
14 Ga0070687_100023016 3300005343 Bacteria 2955
15 Ga0070692_10294754 3300005345 Bacteria 988
16 Ga0070668_100273814 3300005347 Bacteria 1408
17 Ga0070669_100506668 3300005353 Bacteria 1002
18 Ga0070675_100028237 3300005354 Bacteria 4515
19 Ga0070674_100090759 3300005356 Bacteria 2204
20 Ga0070673_100084104 3300005364 Bacteria 2587
21 Ga0070659_100457691 3300005366 Bacteria 1083
22 Ga0070667_100488441 3300005367 Bacteria 1128
23 Ga0070709_10163555 3300005434 Unclassified 1549
24 Ga0070713_100500158 3300005436 Bacteria 1147
25 Ga0070701_10133903 3300005438 Bacteria 1411
26 Ga0070711_100368217 3300005439 Bacteria 1159
27 Ga0070705_100056825 3300005440 Bacteria 2306
28 Ga0070705_100114590 3300005440 Bacteria 1729
29 Ga0070700_100043400 3300005441 Bacteria 2766
30 Ga0070700_100382334 3300005441 Bacteria 1053
31 Ga0070694_100036437 3300005444 Bacteria 3259
32 Ga0070694_100441393 3300005444 Bacteria 1026
33 Ga0070663_100001921 3300005455 Bacteria 11606
34 Ga0070681_10012343 3300005458 Bacteria 8472
35 Ga0070681_10126026 3300005458 Bacteria 2493
36 Ga0070681_10179944 3300005458 Unclassified 2036
37 Ga0068867_100019404 3300005459 Bacteria 4845
38 Ga0070707_100002246 3300005468 Bacteria 18427
39 Ga0070698_100982571 3300005471 Bacteria 791
40 Ga0070679_100239497 3300005530 Bacteria 1772
41 Ga0070697_100315131 3300005536 Bacteria 1346
42 Ga0068853_100285899 3300005539 Bacteria 1521
43 Ga0070686_100037702 3300005544 Bacteria 3000
44 Ga0070686_100262993 3300005544 Bacteria 1265
45 Ga0070695_100066101 3300005545 Bacteria 2356
46 Ga0070696_100011588 3300005546 Bacteria 5908
47 Ga0070696_100085399 3300005546 Bacteria 2240
48 Ga0070696_100401697 3300005546 Bacteria 1072
49 Ga0070696_100744692 3300005546 Bacteria 802
50 Ga0070693_100028577 3300005547 Bacteria 3033
51 Ga0070704_100658248 3300005549 Bacteria 925
52 Ga0070664_100182279 3300005564 Bacteria 1867
53 Ga0070702_100018457 3300005615 Bacteria 3620
54 Ga0068852_100262023 3300005616 Bacteria 1660
55 Ga0068852_100549776 3300005616 Bacteria 1155
56 Ga0068859_100060102 3300005617 Bacteria 3829
57 Ga0068861_100252163 3300005719 Bacteria 1506
58 Ga0068870_10013919 3300005840 Bacteria 3789
59 Ga0068863_100012608 3300005841 Bacteria 8154
60 Ga0068858_100310217 3300005842 Bacteria 1506
61 Ga0068860_100114827 3300005843 Bacteria 2574
62 Ga0081538_10061536 3300005981 Bacteria 2148
63 Ga0081540_1004095 3300005983 Bacteria 11265
64 Ga0081539_10000008 3300005985 Bacteria 525071
65 Ga0075365_10011584 3300006038 Bacteria 5193
66 Ga0075432_10038557 3300006058 Bacteria 1665
67 Ga0075362_10012081 3300006177 Bacteria 3420
68 Ga0075367_10000175 3300006178 Bacteria 20774
69 Ga0075366_10000180 3300006195 Bacteria 27599
70 Ga0075370_10174272 3300006353 Bacteria 1265
71 Ga0068871_100293331 3300006358 Bacteria 1426
72 Ga0075428_100560251 3300006844 Bacteria 1222
73 Ga0075431_100474425 3300006847 Bacteria 1244
74 Ga0075433_10001423 3300006852 Bacteria 17629
75 Ga0075434_100576687 3300006871 Bacteria 1144
76 Ga0068865_100222119 3300006881 Bacteria 1477
77 Ga0097620_100007111 3300006931 Bacteria 11360
78 Ga0097620_100060102 3300006931 Bacteria 3829
79 Ga0075435_100179856 3300007076 Bacteria 1787
80 Ga0111539_10001286 3300009094 Bacteria 33550
81 Ga0111539_10050821 3300009094 Bacteria 4939
82 Ga0111539_10065612 3300009094 Bacteria 4289
83 Ga0111539_10542080 3300009094 Bacteria 1355
84 Ga0111539_10552138 3300009094 Unclassified 1342
85 Ga0111539_11287269 3300009094 Bacteria 849
86 Ga0105245_10021974 3300009098 Bacteria 5599
87 Ga0105245_10393784 3300009098 Bacteria 1383
88 Ga0105247_10002408 3300009101 Bacteria 12723
89 Ga0114129_10883767 3300009147 Bacteria 1134
90 Ga0105243_10053976 3300009148 Bacteria 3189
91 Ga0105243_10101331 3300009148 Bacteria 2391
92 Ga0105241_10007414 3300009174 Bacteria 8073
93 Ga0105242_10026917 3300009176 Bacteria 4561
94 Ga0105248_10007418 3300009177 Bacteria 12032
95 Ga0105237_10101455 3300009545 Bacteria 2870
96 Ga0105249_10161340 3300009553 Bacteria 2167
97 Ga0105239_10390309 3300010375 Bacteria 1575
98 Ga0105246_10073926 3300011119 Bacteria 2408
99 Ga0157378_10000738 3300013297 Bacteria 30560
100 Ga0163162_10026308 3300013306 Bacteria 5750
101 Ga0157375_10149103 3300013308 Bacteria 2473
102 Ga0157380_10045923 3300014326 Bacteria 3430
103 Ga0157380_11188293 3300014326 Bacteria 806
104 Ga0157379_10301735 3300014968 Bacteria 1460
105 Ga0157376_10044050 3300014969 Bacteria 3666
106 Ga0209564_1000015 3300025295 Bacteria 615324
107 Ga0207710_10002630 3300025900 Bacteria 8285
108 Ga0207684_10000019 3300025910 Bacteria 353902
109 Ga0207654_10006839 3300025911 Bacteria 5740
110 Ga0207707_10003597 3300025912 Bacteria 13745
111 Ga0207707_10072939 3300025912 Bacteria 2993
112 Ga0207671_10131622 3300025914 Bacteria 1920
113 Ga0207671_10145797 3300025914 Bacteria 1826
114 Ga0207660_10091363 3300025917 Bacteria 2258
115 Ga0207660_10488032 3300025917 Bacteria 999
116 Ga0207662_10060683 3300025918 Bacteria 2268
117 Ga0207652_10504962 3300025921 Bacteria 1089
118 Ga0207646_10005434 3300025922 Bacteria 13405
119 Ga0207681_10000012 3300025923 Bacteria 361565
120 Ga0207681_10059036 3300025923 Bacteria 2629
121 Ga0207659_10018759 3300025926 Bacteria 4540
122 Ga0207687_10059020 3300025927 Bacteria 2701
123 Ga0207687_10276684 3300025927 Bacteria 1344
124 Ga0207669_10015420 3300025937 Bacteria 3854
125 Ga0207669_10362709 3300025937 Bacteria 1123
126 Ga0207704_10114752 3300025938 Bacteria 1829
127 Ga0207691_10030147 3300025940 Bacteria 5070
128 Ga0207711_10187270 3300025941 Bacteria 1885
129 Ga0207711_10530295 3300025941 Bacteria 1098
130 Ga0207689_10011002 3300025942 Bacteria 7779
131 Ga0207679_10197734 3300025945 Unclassified 1677
132 Ga0207651_10083819 3300025960 Bacteria 2307
133 Ga0207712_10034514 3300025961 Bacteria 3428
134 Ga0207712_10148595 3300025961 Bacteria 1807
135 Ga0207668_10847022 3300025972 Bacteria 811
136 Ga0207640_10471610 3300025981 Bacteria 1039
137 Ga0207658_10590657 3300025986 Bacteria 997
138 Ga0207703_10345262 3300026035 Bacteria 1369
139 Ga0207678_10008470 3300026067 Bacteria 9069
140 Ga0207678_10080002 3300026067 Bacteria 2798
141 Ga0207708_10004550 3300026075 Bacteria 10209
142 Ga0207708_10208772 3300026075 Bacteria 1560
143 Ga0207641_10062324 3300026088 Bacteria 3182
144 Ga0207648_10007462 3300026089 Bacteria 10749
145 Ga0207675_100084134 3300026118 Bacteria 2985
146 Ga0207675_100338624 3300026118 Bacteria 1472
147 Ga0207698_10191921 3300026142 Bacteria 1821
148 Ga0207428_10001146 3300027907 Bacteria 28682
149 Ga0207428_10010255 3300027907 Bacteria 8374
150 Ga0207428_10147748 3300027907 Bacteria 1791
151 Ga0207428_10337962 3300027907 Bacteria 1110
152 Ga0268265_10102176 3300028380 Bacteria 2318
153 Ga0268264_10227128 3300028381 Bacteria 1721
154 Ga0265338_10052621 3300028800 Bacteria 3651
155 Ga0265325_10000018 3300031241 Bacteria 128451
156 Ga0265313_10061352 3300031595 Bacteria 1760
157 Ga0373961_0035253 3300035241 Bacteria 1419
158 Ga0373962_0035388 3300035242 Unclassified 1387
159 Ga0373931_0874808 3300035691 Bacteria 603
160 Ga0395900_0171594 3300037418 Bacteria 2207
161 Ga0395900_1203143 3300037418 Bacteria 673
162 Ga0395898_0026117 3300037466 Bacteria 5878
163 Ga0395898_0134424 3300037466 Bacteria 2368
164 Ga0395905_0324791 3300037471 Bacteria 1429
165 Ga0395901_0023434 3300038443 Bacteria 6329
166 Ga0436361_0996589 3300039447 Bacteria 1736
167 Ga0439465_0056677 3300041413 Bacteria 1292
168 Ga0495606_0001096 3300046507 Bacteria 38817
169 Ga0495632_0014505 3300046519 Bacteria 4453
170 Ga0495643_0159716 3300046522 Bacteria 1110
171 Ga0495644_0118265 3300046523 Bacteria 1007
172 Ga0495648_0038684 3300046524 Bacteria 3046
173 Ga0495609_0005187 3300046538 Bacteria 6934
174 Ga0495633_0238209 3300046558 Bacteria 831
175 Ga0495625_0096725 3300046660 Bacteria 2033
176 Ga0495672_0000303 3300047320 Bacteria 66366
177 Ga0496102_0011523 3300048905 Bacteria 7626
178 Ga0496102_1115491 3300048905 Bacteria 709
179 Ga0496102_1128294 3300048905 Unclassified 704
180 Ga0496103_0357224 3300048906 Bacteria 939
181 Ga0496106_0008583 3300048909 Bacteria 7560
182 Ga0496109_0934478 3300048912 Bacteria 805
183 Ga0496111_0900420 3300048914 Bacteria 637
184 Ga0496112_0000008 3300048915 Bacteria 310323
185 Ga0496115_0001708 3300048918 Bacteria 15743
186 Ga0496115_0062003 3300048918 Bacteria 3016
187 Ga0496116_0183954 3300048919 Bacteria 1115
188 Ga0496117_0006616 3300048920 Bacteria 11647
189 Ga0496118_0007403 3300048921 Bacteria 11647
190 Ga0496119_0006485 3300048922 Bacteria 10807
191 Ga0496120_0030393 3300048923 Bacteria 3284
192 Ga0496121_0001607 3300048924 Bacteria 37512
193 Ga0496121_0006397 3300048924 Bacteria 14645
194 Ga0496124_0000946 3300048927 Bacteria 46483
195 Ga0496124_0007434 3300048927 Bacteria 11642
196 Ga0496125_0118810 3300048928 Bacteria 1892
197 Ga0496126_0190167 3300048929 Bacteria 1739
198 Ga0496126_0398801 3300048929 Bacteria 1116
199 Ga0501034_0074921 3300049571 Bacteria 3392
200 Ga0501036_0017631 3300049572 Bacteria 5974
201 Ga0501036_0072002 3300049572 Bacteria 2922
202 Ga0501037_0036897 3300049573 Bacteria 3602
203 Ga0501037_0052998 3300049573 Bacteria 2967
204 Ga0501038_0019550 3300049574 Bacteria 6103
205 Ga0501038_0066800 3300049574 Bacteria 3061
206 Ga0501039_0019116 3300049575 Bacteria 5256
207 Ga0501041_0018501 3300049577 Bacteria 4150
208 Ga0501042_0016250 3300049578 Bacteria 5107
209 Ga0501043_0035108 3300049579 Bacteria 3944
210 Ga0501043_0083500 3300049579 Unclassified 2511
211 Ga0501047_0098868 3300049581 Bacteria 2796
212 Ga0501048_0028280 3300049582 Bacteria 4069
213 Ga0501070_0040310 3300049586 Bacteria 3894
214 Ga0501070_0187868 3300049586 Bacteria 1699
215 Ga0501071_0065037 3300049587 Bacteria 2647
216 Ga0501072_0025794 3300049588 Bacteria 4579
217 Ga0501074_0113066 3300049590 Bacteria 1943
218 Ga0501075_0022109 3300049591 Bacteria 4643
219 Ga0501076_0026002 3300049592 Bacteria 4531
220 Ga0501077_0509721 3300049593 Bacteria 771
221 Ga0501079_0033501 3300049741 Bacteria 3952
222 Ga0501035_0063070 3300049822 Bacteria 3297
223 Ga0501035_0149913 3300049822 Bacteria 2024
224 Ga0501044_0066949 3300049823 Bacteria 3660
225 Ga0501045_0016832 3300049824 Bacteria 5193
226 nmdc:mga03683_4294_c1 3300050489 Bacteria 4706
227 nmdc:mga00v17_6758_c1 3300050491 Bacteria 6095
228 nmdc:mga0yw44_7072_c1 3300050492 Bacteria 5493
229 nmdc:mga0k408_411_c1 3300050493 Bacteria 23440
230 nmdc:mga06z11_288992_c1 3300050494 Bacteria 972
231 nmdc:mga06z11_508_c1 3300050494 Bacteria 14366
232 nmdc:mga04h51_319782_c1 3300050495 Bacteria 636
233 nmdc:mga07m45_188240_c1 3300050496 Bacteria 1200
234 nmdc:mga05p37_329635_c1 3300050507 Bacteria 1804
235 nmdc:mga05p37_622339_c1 3300050507 Bacteria 1214
236 nmdc:mga05p37_647657_c1 3300050507 Unclassified 1184
237 nmdc:mga06r32_117087_c1 3300050510 Bacteria 2626
238 nmdc:mga08y16_13555_c1 3300050511 Bacteria 8580
239 nmdc:mga08y16_14033_c1 3300050511 Bacteria 8433
240 nmdc:mga08y16_17510_c1 3300050511 Bacteria 7546
241 nmdc:mga0n895_562319_c1 3300050512 Bacteria 1146
242 nmdc:mga0rr50_83613_c1 3300050513 Bacteria 1238
243 nmdc:mga08x19_681884_c1 3300050514 Bacteria 729
244 nmdc:mga0a205_7412_c1 3300050515 Bacteria 9935
245 Ga0500641_0002303 3300053096 Bacteria 6773
246 Ga0500650_0070364 3300053098 Bacteria 1636
247 Ga0500555_016225 3300053103 Bacteria 2146
248 Ga0500556_0006989 3300053104 Bacteria 3219
249 Ga0500562_008315 3300053108 Bacteria 2621
250 Ga0500569_175184 3300053109 Bacteria 728
251 Ga0500559_0002879 3300053136 Bacteria 8687
252 Ga0500568_0001112 3300053139 Bacteria 18049
253 Ga0500604_0002096 3300053151 Bacteria 5493
254 Ga0500604_0031665 3300053151 Bacteria 1554
255 Ga0500616_0014124 3300053153 Bacteria 4601
256 Ga0500616_0014739 3300053153 Bacteria 4485
257 Ga0500645_036879 3300053730 Bacteria 1453
258 Ga0501084_0021093 3300054114 Bacteria 5434
259 Ga0501082_0044007 3300060353 Bacteria 3851
260 Ga0530510_0056041 3300061734 Bacteria 2847

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100500158 Ga0070713_1005001581 167
2 3300014326 Ga0157380_11188293 Ga0157380_111882931 167
3 3300006038 Ga0075365_10011584 Ga0075365_100115843 173
4 3300037418 Ga0395900_1203143 Ga0395900_1203143_95_643 174
5 3300037466 Ga0395898_0134424 Ga0395898_0134424_1005_1553 174
6 3300038443 Ga0395901_0023434 Ga0395901_0023434_4076_4606 176
7 3300050510 nmdc:mga06r32_117087_c1 nmdc:mga06r32_117087_c1_560_1090 176
8 3300005981 Ga0081538_10061536 Ga0081538_100615362 177
9 3300006058 Ga0075432_10038557 Ga0075432_100385572 177
10 3300006847 Ga0075431_100474425 Ga0075431_1004744252 177
11 3300009094 Ga0111539_10552138 Ga0111539_105521382 177
12 3300027907 Ga0207428_10337962 Ga0207428_103379622 177
13 3300050507 nmdc:mga05p37_329635_c1 nmdc:mga05p37_329635_c1_100_633 177
14 3300050507 nmdc:mga05p37_647657_c1 nmdc:mga05p37_647657_c1_40_573 177
15 3300005468 Ga0070707_100002246 Ga0070707_1000022469 178
16 3300006931 Ga0097620_100007111 Ga0097620_1000071119 178
17 3300009101 Ga0105247_10002408 Ga0105247_100024086 178
18 3300025900 Ga0207710_10002630 Ga0207710_100026304 178
19 3300025910 Ga0207684_10000019 Ga0207684_1000001942 178
20 3300025922 Ga0207646_10005434 Ga0207646_100054348 178
21 3300053136 Ga0500559_0002879 Ga0500559_0002879_3344_3883 178
22 3300005330 Ga0070690_100005575 Ga0070690_1000055755 179
23 3300005336 Ga0070680_100923473 Ga0070680_1009234731 179
24 3300005340 Ga0070689_100008344 Ga0070689_1000083444 179
25 3300005343 Ga0070687_100023016 Ga0070687_1000230162 179
26 3300005347 Ga0070668_100273814 Ga0070668_1002738141 179
27 3300005353 Ga0070669_100506668 Ga0070669_1005066682 179
28 3300005354 Ga0070675_100028237 Ga0070675_1000282372 179
29 3300005356 Ga0070674_100090759 Ga0070674_1000907593 179
30 3300005364 Ga0070673_100084104 Ga0070673_1000841042 179
31 3300005366 Ga0070659_100457691 Ga0070659_1004576912 179
32 3300005367 Ga0070667_100488441 Ga0070667_1004884411 179
33 3300005438 Ga0070701_10133903 Ga0070701_101339032 179
34 3300005439 Ga0070711_100368217 Ga0070711_1003682171 179
35 3300005440 Ga0070705_100056825 Ga0070705_1000568252 179
36 3300005441 Ga0070700_100043400 Ga0070700_1000434003 179
37 3300005444 Ga0070694_100441393 Ga0070694_1004413931 179
38 3300005459 Ga0068867_100019404 Ga0068867_1000194042 179
39 3300005544 Ga0070686_100037702 Ga0070686_1000377023 179
40 3300005546 Ga0070696_100085399 Ga0070696_1000853992 179
41 3300005546 Ga0070696_100401697 Ga0070696_1004016972 179
42 3300005546 Ga0070696_100744692 Ga0070696_1007446922 179
43 3300005564 Ga0070664_100182279 Ga0070664_1001822792 179
44 3300005615 Ga0070702_100018457 Ga0070702_1000184572 179
45 3300005616 Ga0068852_100549776 Ga0068852_1005497762 179
46 3300005617 Ga0068859_100060102 Ga0068859_1000601023 179
47 3300005719 Ga0068861_100252163 Ga0068861_1002521632 179
48 3300005840 Ga0068870_10013919 Ga0068870_100139194 179
49 3300005841 Ga0068863_100012608 Ga0068863_1000126086 179
50 3300005842 Ga0068858_100310217 Ga0068858_1003102172 179
51 3300005843 Ga0068860_100114827 Ga0068860_1001148273 179
52 3300006177 Ga0075362_10012081 Ga0075362_100120812 179
53 3300006178 Ga0075367_10000175 Ga0075367_1000017510 179
54 3300006195 Ga0075366_10000180 Ga0075366_1000018014 179
55 3300006353 Ga0075370_10174272 Ga0075370_101742722 179
56 3300006358 Ga0068871_100293331 Ga0068871_1002933312 179
57 3300006881 Ga0068865_100222119 Ga0068865_1002221192 179
58 3300006931 Ga0097620_100060102 Ga0097620_1000601023 179
59 3300009094 Ga0111539_10001286 Ga0111539_1000128610 179
60 3300009098 Ga0105245_10393784 Ga0105245_103937842 179
61 3300009148 Ga0105243_10053976 Ga0105243_100539761 179
62 3300009177 Ga0105248_10007418 Ga0105248_100074186 179
63 3300009553 Ga0105249_10161340 Ga0105249_101613402 179
64 3300013308 Ga0157375_10149103 Ga0157375_101491032 179
65 3300014326 Ga0157380_10045923 Ga0157380_100459233 179
66 3300014968 Ga0157379_10301735 Ga0157379_103017352 179
67 3300025917 Ga0207660_10091363 Ga0207660_100913633 179
68 3300025918 Ga0207662_10060683 Ga0207662_100606832 179
69 3300025921 Ga0207652_10504962 Ga0207652_105049621 179
70 3300025923 Ga0207681_10000012 Ga0207681_1000001275 179
71 3300025923 Ga0207681_10059036 Ga0207681_100590362 179
72 3300025926 Ga0207659_10018759 Ga0207659_100187592 179
73 3300025927 Ga0207687_10276684 Ga0207687_102766842 179
74 3300025937 Ga0207669_10015420 Ga0207669_100154202 179
75 3300025938 Ga0207704_10114752 Ga0207704_101147522 179
76 3300025940 Ga0207691_10030147 Ga0207691_100301472 179
77 3300025941 Ga0207711_10187270 Ga0207711_101872702 179
78 3300025942 Ga0207689_10011002 Ga0207689_100110026 179
79 3300025945 Ga0207679_10197734 Ga0207679_101977342 179
80 3300025960 Ga0207651_10083819 Ga0207651_100838192 179
81 3300025961 Ga0207712_10034514 Ga0207712_100345143 179
82 3300025961 Ga0207712_10148595 Ga0207712_101485952 179
83 3300025972 Ga0207668_10847022 Ga0207668_108470222 179
84 3300025981 Ga0207640_10471610 Ga0207640_104716102 179
85 3300025986 Ga0207658_10590657 Ga0207658_105906572 179
86 3300026035 Ga0207703_10345262 Ga0207703_103452622 179
87 3300026067 Ga0207678_10080002 Ga0207678_100800022 179
88 3300026075 Ga0207708_10004550 Ga0207708_100045502 179
89 3300026088 Ga0207641_10062324 Ga0207641_100623243 179
90 3300026089 Ga0207648_10007462 Ga0207648_100074625 179
91 3300026118 Ga0207675_100084134 Ga0207675_1000841342 179
92 3300026118 Ga0207675_100338624 Ga0207675_1003386242 179
93 3300027907 Ga0207428_10001146 Ga0207428_100011466 179
94 3300028380 Ga0268265_10102176 Ga0268265_101021762 179
95 3300028381 Ga0268264_10227128 Ga0268264_102271281 179
96 3300037418 Ga0395900_0171594 Ga0395900_0171594_421_969 179
97 3300037466 Ga0395898_0026117 Ga0395898_0026117_1079_1627 179
98 3300050489 nmdc:mga03683_4294_c1 nmdc:mga03683_4294_c1_3455_4021 179
99 3300050491 nmdc:mga00v17_6758_c1 nmdc:mga00v17_6758_c1_2661_3227 179
100 3300050492 nmdc:mga0yw44_7072_c1 nmdc:mga0yw44_7072_c1_1724_2290 179
101 3300050493 nmdc:mga0k408_411_c1 nmdc:mga0k408_411_c1_2870_3436 179
102 3300050494 nmdc:mga06z11_508_c1 nmdc:mga06z11_508_c1_4231_4797 179
103 3300050495 nmdc:mga04h51_319782_c1 nmdc:mga04h51_319782_c1_53_619 179
104 3300050496 nmdc:mga07m45_188240_c1 nmdc:mga07m45_188240_c1_278_844 179
105 3300050511 nmdc:mga08y16_14033_c1 nmdc:mga08y16_14033_c1_7023_7589 179
106 3300035242 Ga0373962_0035388 Ga0373962_0035388_574_1137 180
107 3300048905 Ga0496102_1115491 Ga0496102_1115491_116_676 181
108 3300048905 Ga0496102_1128294 Ga0496102_1128294_44_628 181
109 3300048912 Ga0496109_0934478 Ga0496109_0934478_71_631 181
110 3300048914 Ga0496111_0900420 Ga0496111_0900420_61_621 181
111 3300025941 Ga0207711_10530295 Ga0207711_105302952 183
112 3300035691 Ga0373931_0874808 Ga0373931_0874808_26_577 183
113 3300053104 Ga0500556_0006989 Ga0500556_0006989_953_1504 183
114 3300053108 Ga0500562_008315 Ga0500562_008315_845_1396 183
115 3300053153 Ga0500616_0014739 Ga0500616_0014739_3510_4061 183
116 3300053730 Ga0500645_036879 Ga0500645_036879_736_1290 183
117 3300005434 Ga0070709_10163555 Ga0070709_101635553 184
118 3300046519 Ga0495632_0014505 Ga0495632_0014505_838_1395 184
119 3300046522 Ga0495643_0159716 Ga0495643_0159716_117_674 184
120 3300046523 Ga0495644_0118265 Ga0495644_0118265_13_570 184
121 3300046524 Ga0495648_0038684 Ga0495648_0038684_1026_1583 184
122 3300046660 Ga0495625_0096725 Ga0495625_0096725_1457_2014 184
123 3300047320 Ga0495672_0000303 Ga0495672_0000303_39201_39758 184
124 3300053096 Ga0500641_0002303 Ga0500641_0002303_720_1286 184
125 3300053103 Ga0500555_016225 Ga0500555_016225_677_1234 184
126 3300053153 Ga0500616_0014124 Ga0500616_0014124_2959_3516 184
127 3300003771 Ga0055526_1000049 Ga0055526_100004951 185
128 3300005337 Ga0070682_100251632 Ga0070682_1002516322 185
129 3300005341 Ga0070691_10080581 Ga0070691_100805812 185
130 3300005440 Ga0070705_100114590 Ga0070705_1001145901 185
131 3300005455 Ga0070663_100001921 Ga0070663_10000192112 185
132 3300005458 Ga0070681_10012343 Ga0070681_100123435 185
133 3300005530 Ga0070679_100239497 Ga0070679_1002394972 185
134 3300005536 Ga0070697_100315131 Ga0070697_1003151312 185
135 3300005544 Ga0070686_100262993 Ga0070686_1002629931 185
136 3300005545 Ga0070695_100066101 Ga0070695_1000661012 185
137 3300005546 Ga0070696_100011588 Ga0070696_1000115883 185
138 3300005547 Ga0070693_100028577 Ga0070693_1000285773 185
139 3300009098 Ga0105245_10021974 Ga0105245_100219743 185
140 3300009148 Ga0105243_10101331 Ga0105243_101013312 185
141 3300009174 Ga0105241_10007414 Ga0105241_1000741410 185
142 3300009176 Ga0105242_10026917 Ga0105242_100269172 185
143 3300009545 Ga0105237_10101455 Ga0105237_101014552 185
144 3300010375 Ga0105239_10390309 Ga0105239_103903092 185
145 3300011119 Ga0105246_10073926 Ga0105246_100739263 185
146 3300013297 Ga0157378_10000738 Ga0157378_1000073819 185
147 3300013306 Ga0163162_10026308 Ga0163162_100263082 185
148 3300014969 Ga0157376_10044050 Ga0157376_100440503 185
149 3300025295 Ga0209564_1000015 Ga0209564_1000015445 185
150 3300025911 Ga0207654_10006839 Ga0207654_100068398 185
151 3300025912 Ga0207707_10003597 Ga0207707_1000359710 185
152 3300025914 Ga0207671_10131622 Ga0207671_101316222 185
153 3300025927 Ga0207687_10059020 Ga0207687_100590202 185
154 3300025937 Ga0207669_10362709 Ga0207669_103627092 185
155 3300026067 Ga0207678_10008470 Ga0207678_100084708 185
156 3300048905 Ga0496102_0011523 Ga0496102_0011523_4050_4607 185
157 3300048906 Ga0496103_0357224 Ga0496103_0357224_88_645 185
158 3300048909 Ga0496106_0008583 Ga0496106_0008583_3385_3942 185
159 3300048918 Ga0496115_0001708 Ga0496115_0001708_10786_11343 185
160 3300048918 Ga0496115_0062003 Ga0496115_0062003_1763_2332 185
161 3300048929 Ga0496126_0398801 Ga0496126_0398801_108_695 185
162 3300049579 Ga0501043_0083500 Ga0501043_0083500_962_1519 185
163 3300050494 nmdc:mga06z11_288992_c1 nmdc:mga06z11_288992_c1_64_621 185
164 3300053098 Ga0500650_0070364 Ga0500650_0070364_526_1083 185
165 3300005441 Ga0070700_100382334 Ga0070700_1003823341 186
166 3300005444 Ga0070694_100036437 Ga0070694_1000364372 186
167 3300005458 Ga0070681_10126026 Ga0070681_101260262 186
168 3300005549 Ga0070704_100658248 Ga0070704_1006582481 186
169 3300005983 Ga0081540_1004095 Ga0081540_10040954 186
170 3300006844 Ga0075428_100560251 Ga0075428_1005602512 186
171 3300006852 Ga0075433_10001423 Ga0075433_100014239 186
172 3300006871 Ga0075434_100576687 Ga0075434_1005766872 186
173 3300007076 Ga0075435_100179856 Ga0075435_1001798563 186
174 3300009094 Ga0111539_10065612 Ga0111539_100656123 186
175 3300009094 Ga0111539_10542080 Ga0111539_105420801 186
176 3300025912 Ga0207707_10072939 Ga0207707_100729392 186
177 3300026075 Ga0207708_10208772 Ga0207708_102087721 186
178 3300027907 Ga0207428_10010255 Ga0207428_100102551 186
179 3300031241 Ga0265325_10000018 Ga0265325_1000001885 186
180 3300035241 Ga0373961_0035253 Ga0373961_0035253_699_1262 186
181 3300037471 Ga0395905_0324791 Ga0395905_0324791_217_780 186
182 3300041413 Ga0439465_0056677 Ga0439465_0056677_682_1257 186
183 3300048929 Ga0496126_0190167 Ga0496126_0190167_846_1415 186
184 3300049571 Ga0501034_0074921 Ga0501034_0074921_2146_2709 186
185 3300049572 Ga0501036_0017631 Ga0501036_0017631_3331_3948 186
186 3300049572 Ga0501036_0072002 Ga0501036_0072002_818_1381 186
187 3300049573 Ga0501037_0036897 Ga0501037_0036897_1707_2270 186
188 3300049573 Ga0501037_0052998 Ga0501037_0052998_2016_2633 186
189 3300049574 Ga0501038_0019550 Ga0501038_0019550_4677_5240 186
190 3300049574 Ga0501038_0066800 Ga0501038_0066800_2348_2965 186
191 3300049575 Ga0501039_0019116 Ga0501039_0019116_2314_2931 186
192 3300049577 Ga0501041_0018501 Ga0501041_0018501_1803_2420 186
193 3300049578 Ga0501042_0016250 Ga0501042_0016250_2257_2874 186
194 3300049579 Ga0501043_0035108 Ga0501043_0035108_1300_1863 186
195 3300049581 Ga0501047_0098868 Ga0501047_0098868_727_1290 186
196 3300049582 Ga0501048_0028280 Ga0501048_0028280_1316_1933 186
197 3300049586 Ga0501070_0040310 Ga0501070_0040310_2408_2971 186
198 3300049586 Ga0501070_0187868 Ga0501070_0187868_17_634 186
199 3300049587 Ga0501071_0065037 Ga0501071_0065037_1530_2147 186
200 3300049588 Ga0501072_0025794 Ga0501072_0025794_1918_2535 186
201 3300049590 Ga0501074_0113066 Ga0501074_0113066_494_1111 186
202 3300049591 Ga0501075_0022109 Ga0501075_0022109_2137_2754 186
203 3300049592 Ga0501076_0026002 Ga0501076_0026002_1040_1657 186
204 3300049593 Ga0501077_0509721 Ga0501077_0509721_65_682 186
205 3300049741 Ga0501079_0033501 Ga0501079_0033501_1757_2374 186
206 3300049822 Ga0501035_0063070 Ga0501035_0063070_583_1200 186
207 3300049822 Ga0501035_0149913 Ga0501035_0149913_492_1055 186
208 3300049823 Ga0501044_0066949 Ga0501044_0066949_1778_2341 186
209 3300049824 Ga0501045_0016832 Ga0501045_0016832_1923_2540 186
210 3300050511 nmdc:mga08y16_13555_c1 nmdc:mga08y16_13555_c1_6543_7106 186
211 3300050512 nmdc:mga0n895_562319_c1 nmdc:mga0n895_562319_c1_433_996 186
212 3300050513 nmdc:mga0rr50_83613_c1 nmdc:mga0rr50_83613_c1_289_852 186
213 3300050514 nmdc:mga08x19_681884_c1 nmdc:mga08x19_681884_c1_120_683 186
214 3300050515 nmdc:mga0a205_7412_c1 nmdc:mga0a205_7412_c1_835_1398 186
215 3300053109 Ga0500569_175184 Ga0500569_175184_110_679 186
216 3300053139 Ga0500568_0001112 Ga0500568_0001112_10813_11382 186
217 3300053151 Ga0500604_0002096 Ga0500604_0002096_1417_1986 186
218 3300053151 Ga0500604_0031665 Ga0500604_0031665_558_1127 186
219 3300054114 Ga0501084_0021093 Ga0501084_0021093_3054_3671 186
220 3300060353 Ga0501082_0044007 Ga0501082_0044007_1293_1910 186
221 3300061734 Ga0530510_0056041 Ga0530510_0056041_65_682 186
222 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001415 188
223 3300005336 Ga0070680_100246904 Ga0070680_1002469042 188
224 3300005345 Ga0070692_10294754 Ga0070692_102947541 188
225 3300005458 Ga0070681_10179944 Ga0070681_101799442 188
226 3300005471 Ga0070698_100982571 Ga0070698_1009825712 188
227 3300005539 Ga0068853_100285899 Ga0068853_1002858992 188
228 3300005616 Ga0068852_100262023 Ga0068852_1002620232 188
229 3300005985 Ga0081539_10000008 Ga0081539_10000008157 188
230 3300009094 Ga0111539_10050821 Ga0111539_100508214 188
231 3300009094 Ga0111539_11287269 Ga0111539_112872692 188
232 3300009147 Ga0114129_10883767 Ga0114129_108837671 188
233 3300025917 Ga0207660_10488032 Ga0207660_104880321 188
234 3300026142 Ga0207698_10191921 Ga0207698_101919212 188
235 3300027907 Ga0207428_10147748 Ga0207428_101477482 188
236 3300031595 Ga0265313_10061352 Ga0265313_100613522 188
237 3300039447 Ga0436361_0996589 Ga0436361_0996589_509_1117 188
238 3300046507 Ga0495606_0001096 Ga0495606_0001096_28323_28934 188
239 3300046538 Ga0495609_0005187 Ga0495609_0005187_5514_6167 188
240 3300048915 Ga0496112_0000008 Ga0496112_0000008_238321_238914 188
241 3300050507 nmdc:mga05p37_622339_c1 nmdc:mga05p37_622339_c1_604_1176 188
242 3300050511 nmdc:mga08y16_17510_c1 nmdc:mga08y16_17510_c1_4671_5240 188
243 3300028800 Ga0265338_10052621 Ga0265338_100526213 189
244 3300046558 Ga0495633_0238209 Ga0495633_0238209_99_803 191
245 3300002987 JGI25159J45721_1000088 JGI25159J45721_10000886 193
246 3300003354 JGI25160J50197_1000229 JGI25160J50197_10002296 193
247 3300003374 JGI25161J50226_1000277 JGI25161J50226_10002778 193
248 3300004625 Ga0055543_1001461 Ga0055543_10014614 193
249 3300005262 Ga0065165_1000812 Ga0065165_10008125 193
250 3300025914 Ga0207671_10145797 Ga0207671_101457972 193
251 3300048919 Ga0496116_0183954 Ga0496116_0183954_270_944 193
252 3300048920 Ga0496117_0006616 Ga0496117_0006616_10430_11104 193
253 3300048921 Ga0496118_0007403 Ga0496118_0007403_10430_11104 193
254 3300048922 Ga0496119_0006485 Ga0496119_0006485_9775_10449 193
255 3300048923 Ga0496120_0030393 Ga0496120_0030393_538_1212 193
256 3300048924 Ga0496121_0001607 Ga0496121_0001607_32471_33058 193
257 3300048924 Ga0496121_0006397 Ga0496121_0006397_3975_4649 193
258 3300048927 Ga0496124_0000946 Ga0496124_0000946_43398_43985 193
259 3300048927 Ga0496124_0007434 Ga0496124_0007434_10430_11104 193
260 3300048928 Ga0496125_0118810 Ga0496125_0118810_875_1549 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

31

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.97 8 182
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9673 4 193
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9664 8 184
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9628 5 188
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9618 5 188
ID Description Score Start End Superfamily
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9631 9 185 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9605 6 188 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9592 6 182 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.957 9 184 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9503 7 185 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6A1TYN0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9973 9 193 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7K1PXZ3-F1-model_v4 deleted 0.9973 9 152
AF-A0A068SRU5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9938 22 193 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X0CZE8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9919 9 192 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A838N2P6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9909 53 193 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
93.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map