F369304

General Info

Members Datasets Scaffolds Average Seq Length
260 146 260 330

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100011848|Ga0070690_1000118484
Length 346
Sequence MQYRKFGSTDLLVSEIGFGAWAIGGGAMIGNTSIGWGDADDTVSLQAIQAALDAGINFFDTADIYGLGHSEEILGKAVQHDRNVIIATKVGNVARNDQFTVDYSKEYILKACGQSLKRLRRETIDYYQLHSARVEHLQNGECIEAIEELQKQGKIRYWGLSLNTFDPFPEAEVLMKHRLGNARPSARAGTDEDDLVGRGFQLVLNILNQRALPILEKANKNGYGVIARMPLQFGLLTGKFDTNSAFPANDHRHNRLTEEVISNSSEALKPVWELCKKYGMTKTQLALSYVLSYPGISTIIPGIRTPEHVTQNTTGLARLDDADMKMIEDLGKGKFVPVMKLIQKQG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
116 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 0.77
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10253689 3300003323 Bacteria 1491
2 Ga0065704_10087140 3300005289 Bacteria 3044
3 Ga0065704_10178288 3300005289 Unclassified 1184
4 Ga0065712_10001142 3300005290 Bacteria 10072
5 Ga0065712_10073409 3300005290 Bacteria 4402
6 Ga0065712_10100196 3300005290 Bacteria 2064
7 Ga0065712_10121900 3300005290 Unclassified 1657
8 Ga0070683_100000238 3300005329 Bacteria 37700
9 Ga0070683_100001339 3300005329 Bacteria 18784
10 Ga0070683_100028987 3300005329 Bacteria 5007
11 Ga0070690_100011848 3300005330 Bacteria 5116
12 Ga0070670_100270402 3300005331 Bacteria 1483
13 Ga0068869_100220749 3300005334 Bacteria 1502
14 Ga0070666_10131103 3300005335 Unclassified 1742
15 Ga0070666_10213538 3300005335 Bacteria 1359
16 Ga0070680_100175077 3300005336 Unclassified 1806
17 Ga0068868_100028108 3300005338 Bacteria 4296
18 Ga0070689_100003634 3300005340 Bacteria 10287
19 Ga0070689_100047060 3300005340 Bacteria 3325
20 Ga0070689_100088572 3300005340 Bacteria 2437
21 Ga0070687_100020777 3300005343 Bacteria 3076
22 Ga0070687_100165322 3300005343 Unclassified 1312
23 Ga0070661_100001444 3300005344 Bacteria 16518
24 Ga0070661_100026739 3300005344 Unclassified 4151
25 Ga0070669_100058318 3300005353 Bacteria 2833
26 Ga0070669_100114737 3300005353 Bacteria 2048
27 Ga0070675_100148465 3300005354 Bacteria 2009
28 Ga0070671_100039165 3300005355 Bacteria 3934
29 Ga0070688_100012343 3300005365 Bacteria 4785
30 Ga0070688_100349152 3300005365 Unclassified 1083
31 Ga0070659_100040117 3300005366 Bacteria 3658
32 Ga0070667_100095572 3300005367 Unclassified 2562
33 Ga0070701_10037643 3300005438 Bacteria 2444
34 Ga0070662_100152175 3300005457 Unclassified 1802
35 Ga0070662_100298133 3300005457 Bacteria 1309
36 Ga0070681_10200041 3300005458 Unclassified 1916
37 Ga0070685_10098466 3300005466 Bacteria 1782
38 Ga0070698_100002551 3300005471 Bacteria 20059
39 Ga0070698_100054905 3300005471 Bacteria 4043
40 Ga0070698_100082947 3300005471 Bacteria 3197
41 Ga0070699_100225349 3300005518 Bacteria 1671
42 Ga0070699_100237942 3300005518 Bacteria 1624
43 Ga0070679_100001653 3300005530 Bacteria 20083
44 Ga0070684_100001043 3300005535 Bacteria 19809
45 Ga0070684_100011128 3300005535 Bacteria 7160
46 Ga0070684_100017077 3300005535 Bacteria 5948
47 Ga0068853_100002759 3300005539 Bacteria 13264
48 Ga0070672_100066984 3300005543 Bacteria 2844
49 Ga0070665_100048610 3300005548 Bacteria 4258
50 Ga0070665_100357294 3300005548 Bacteria 1467
51 Ga0070664_100001070 3300005564 Bacteria 21563
52 Ga0070664_100002432 3300005564 Bacteria 14976
53 Ga0070664_100010920 3300005564 Bacteria 7366
54 Ga0070664_100092957 3300005564 Bacteria 2613
55 Ga0068857_100002814 3300005577 Bacteria 14314
56 Ga0068857_100093315 3300005577 Unclassified 2695
57 Ga0068857_100263104 3300005577 Unclassified 1583
58 Ga0068854_100180829 3300005578 Bacteria 1647
59 Ga0068854_100431370 3300005578 Bacteria 1097
60 Ga0068852_100115973 3300005616 Bacteria 2443
61 Ga0068852_100130199 3300005616 Bacteria 2316
62 Ga0068852_100347256 3300005616 Unclassified 1448
63 Ga0068859_100010937 3300005617 Bacteria 9134
64 Ga0068859_100075496 3300005617 Bacteria 3411
65 Ga0068859_100098429 3300005617 Bacteria 2979
66 Ga0068859_100349792 3300005617 Unclassified 1573
67 Ga0068864_100006021 3300005618 Bacteria 9956
68 Ga0068864_100152804 3300005618 Bacteria 2092
69 Ga0068864_100320813 3300005618 Bacteria 1455
70 Ga0068864_100370818 3300005618 Unclassified 1355
71 Ga0068861_100005573 3300005719 Bacteria 8531
72 Ga0068861_100030703 3300005719 Bacteria 3941
73 Ga0068851_10057517 3300005834 Bacteria 1986
74 Ga0068851_10139607 3300005834 Bacteria 1317
75 Ga0068863_100015583 3300005841 Bacteria 7304
76 Ga0068863_100034709 3300005841 Bacteria 4803
77 Ga0068863_100131334 3300005841 Bacteria 2391
78 Ga0068863_100431463 3300005841 Unclassified 1292
79 Ga0068858_100066609 3300005842 Bacteria 3335
80 Ga0068858_100202700 3300005842 Bacteria 1876
81 Ga0068862_100011917 3300005844 Bacteria 7182
82 Ga0081539_10020611 3300005985 Bacteria 4445
83 Ga0097621_100055650 3300006237 Bacteria 3231
84 Ga0068871_100023531 3300006358 Bacteria 4768
85 Ga0068871_100214608 3300006358 Unclassified 1665
86 Ga0075428_100043190 3300006844 Unclassified 4956
87 Ga0075428_100289655 3300006844 Bacteria 1761
88 Ga0075430_100003574 3300006846 Bacteria 13027
89 Ga0075431_100032249 3300006847 Bacteria 5399
90 Ga0075431_100400724 3300006847 Bacteria 1373
91 Ga0075429_100001495 3300006880 Bacteria 19246
92 Ga0075429_100086385 3300006880 Bacteria 2734
93 Ga0068865_100150017 3300006881 Bacteria 1768
94 Ga0097620_100010937 3300006931 Bacteria 9134
95 Ga0097620_100075499 3300006931 Bacteria 3411
96 Ga0097620_100098427 3300006931 Bacteria 2979
97 Ga0097620_100349798 3300006931 Unclassified 1573
98 Ga0114129_10915237 3300009147 Bacteria 1110
99 Ga0105243_10072457 3300009148 Bacteria 2789
100 Ga0105242_10104883 3300009176 Bacteria 2400
101 Ga0105249_10002194 3300009553 Bacteria 16909
102 Ga0105249_10007108 3300009553 Bacteria 9770
103 Ga0105249_10138984 3300009553 Bacteria 2327
104 Ga0105249_10206155 3300009553 Bacteria 1926
105 Ga0105239_10032927 3300010375 Bacteria 5694
106 Ga0157373_10022753 3300013100 Bacteria 4545
107 Ga0157373_10075894 3300013100 Unclassified 2372
108 Ga0157373_10231410 3300013100 Bacteria 1305
109 Ga0157370_10010747 3300013104 Bacteria 9626
110 Ga0157369_10082868 3300013105 Bacteria 3431
111 Ga0157369_10402346 3300013105 Bacteria 1420
112 Ga0157374_10001062 3300013296 Bacteria 23840
113 Ga0157374_10055724 3300013296 Bacteria 3690
114 Ga0157378_10110632 3300013297 Unclassified 2518
115 Ga0157378_10445932 3300013297 Bacteria 1284
116 Ga0163162_10018183 3300013306 Bacteria 6883
117 Ga0163162_10053893 3300013306 Bacteria 4043
118 Ga0163162_10099864 3300013306 Bacteria 2993
119 Ga0163162_10412328 3300013306 Unclassified 1483
120 Ga0157372_10108559 3300013307 Bacteria 3176
121 Ga0157372_10110396 3300013307 Bacteria 3150
122 Ga0157372_10348102 3300013307 Bacteria 1726
123 Ga0157372_10376151 3300013307 Bacteria 1655
124 Ga0157375_10005920 3300013308 Bacteria 10658
125 Ga0157375_10104331 3300013308 Bacteria 2923
126 Ga0157375_10118875 3300013308 Bacteria 2750
127 Ga0157375_10138982 3300013308 Bacteria 2555
128 Ga0157375_10291785 3300013308 Unclassified 1794
129 Ga0157375_10508678 3300013308 Bacteria 1368
130 Ga0163163_10000469 3300014325 Bacteria 36859
131 Ga0163163_10127725 3300014325 Bacteria 2581
132 Ga0163163_10128002 3300014325 Bacteria 2578
133 Ga0157380_10216550 3300014326 Bacteria 1710
134 Ga0157377_10006235 3300014745 Bacteria 5675
135 Ga0157377_10013072 3300014745 Bacteria 4192
136 Ga0157377_10222392 3300014745 Unclassified 1209
137 Ga0157379_10090451 3300014968 Bacteria 2746
138 Ga0157379_10148193 3300014968 Bacteria 2117
139 Ga0157379_10183713 3300014968 Unclassified 1889
140 Ga0157379_10203589 3300014968 Unclassified 1790
141 Ga0157376_10137002 3300014969 Bacteria 2192
142 Ga0157376_10479418 3300014969 Unclassified 1219
143 Ga0207643_10022376 3300025908 Bacteria 3479
144 Ga0207705_10012360 3300025909 Bacteria 6169
145 Ga0207707_10093808 3300025912 Unclassified 2622
146 Ga0207707_10153998 3300025912 Bacteria 2010
147 Ga0207695_10018560 3300025913 Bacteria 8036
148 Ga0207671_10179775 3300025914 Unclassified 1646
149 Ga0207660_10067399 3300025917 Bacteria 2592
150 Ga0207662_10093466 3300025918 Bacteria 1853
151 Ga0207662_10172497 3300025918 Unclassified 1387
152 Ga0207662_10281260 3300025918 Bacteria 1101
153 Ga0207657_10102031 3300025919 Bacteria 2380
154 Ga0207649_10008373 3300025920 Bacteria 5637
155 Ga0207649_10010366 3300025920 Bacteria 5118
156 Ga0207652_10000739 3300025921 Bacteria 31538
157 Ga0207652_10151546 3300025921 Bacteria 2076
158 Ga0207681_10252327 3300025923 Unclassified 1378
159 Ga0207650_10018482 3300025925 Bacteria 4892
160 Ga0207650_10075442 3300025925 Bacteria 2545
161 Ga0207659_10009382 3300025926 Bacteria 6111
162 Ga0207644_10037932 3300025931 Bacteria 3392
163 Ga0207644_10170584 3300025931 Unclassified 1698
164 Ga0207706_10089914 3300025933 Unclassified 2699
165 Ga0207706_10151312 3300025933 Unclassified 2041
166 Ga0207686_10027288 3300025934 Bacteria 3342
167 Ga0207686_10061672 3300025934 Bacteria 2378
168 Ga0207709_10043170 3300025935 Bacteria 2716
169 Ga0207670_10008154 3300025936 Bacteria 5896
170 Ga0207691_10017140 3300025940 Bacteria 6871
171 Ga0207691_10079702 3300025940 Bacteria 2947
172 Ga0207689_10001618 3300025942 Bacteria 21337
173 Ga0207689_10035210 3300025942 Bacteria 4159
174 Ga0207689_10045846 3300025942 Bacteria 3614
175 Ga0207689_10199754 3300025942 Bacteria 1650
176 Ga0207689_10226582 3300025942 Bacteria 1545
177 Ga0207661_10013332 3300025944 Bacteria 6004
178 Ga0207661_10019270 3300025944 Bacteria 5083
179 Ga0207679_10000296 3300025945 Bacteria 37547
180 Ga0207679_10001624 3300025945 Bacteria 14013
181 Ga0207651_10014151 3300025960 Bacteria 4597
182 Ga0207651_10020452 3300025960 Bacteria 3995
183 Ga0207712_10005116 3300025961 Bacteria 8300
184 Ga0207712_10007732 3300025961 Bacteria 6797
185 Ga0207712_10017873 3300025961 Bacteria 4613
186 Ga0207712_10155379 3300025961 Bacteria 1771
187 Ga0207712_10167170 3300025961 Bacteria 1715
188 Ga0207658_10094962 3300025986 Unclassified 2322
189 Ga0207677_10054778 3300026023 Bacteria 2724
190 Ga0207639_10085243 3300026041 Bacteria 2512
191 Ga0207639_10480364 3300026041 Unclassified 1132
192 Ga0207641_10000275 3300026088 Bacteria 64649
193 Ga0207641_10015260 3300026088 Bacteria 6295
194 Ga0207641_10024800 3300026088 Bacteria 4943
195 Ga0207641_10375492 3300026088 Bacteria 1360
196 Ga0207648_10093197 3300026089 Bacteria 2634
197 Ga0207676_10053714 3300026095 Bacteria 3154
198 Ga0207676_10101164 3300026095 Bacteria 2389
199 Ga0207674_10000294 3300026116 Bacteria 63206
200 Ga0207674_10019936 3300026116 Bacteria 7256
201 Ga0207674_10058449 3300026116 Bacteria 3906
202 Ga0207675_100009364 3300026118 Bacteria 9180
203 Ga0207675_100084985 3300026118 Bacteria 2969
204 Ga0207675_100320716 3300026118 Unclassified 1512
205 Ga0207683_10186641 3300026121 Unclassified 1881
206 Ga0207683_10355302 3300026121 Unclassified 1345
207 Ga0207698_10115009 3300026142 Bacteria 2264
208 Ga0207698_10136695 3300026142 Bacteria 2104
209 Ga0207698_10267688 3300026142 Bacteria 1573
210 Ga0268266_10167685 3300028379 Bacteria 1991
211 Ga0268265_10098295 3300028380 Bacteria 2357
212 Ga0268265_10179838 3300028380 Bacteria 1816
213 Ga0265327_10012633 3300031251 Bacteria 5681
214 Ga0307516_10119608 3300031730 Bacteria 2427
215 Ga0307410_10195497 3300031852 Unclassified 1541
216 Ga0307412_10308900 3300031911 Unclassified 1253
217 Ga0307415_100129631 3300032126 Bacteria 1907
218 Ga0316574_0324482 3300035398 Bacteria 977
219 Ga0373925_0070647 3300037068 Bacteria 2640
220 Ga0395900_0083312 3300037418 Bacteria 3286
221 Ga0395905_0012891 3300037471 Bacteria 8035
222 Ga0395905_0226416 3300037471 Bacteria 1749
223 Ga0436365_1642374 3300039437 Bacteria 37274
224 Ga0439441_009860 3300042001 Bacteria 1591
225 Ga0450898_021046 3300042134 Bacteria 1146
226 Ga0439435_0038342 3300042436 Bacteria 1332
227 Ga0439460_0054133 3300042461 Unclassified 1210
228 Ga0451577_0000300 3300042876 Bacteria 96339
229 Ga0451577_0007717 3300042876 Bacteria 10547
230 Ga0453684_0000033 3300044712 Bacteria 734012
231 Ga0495643_0036656 3300046522 Bacteria 2693
232 Ga0496110_0211499 3300048913 Unclassified 1763
233 Ga0496110_0426348 3300048913 Bacteria 1209
234 Ga0501032_0005855 3300049569 Bacteria 9093
235 Ga0501034_0131232 3300049571 Unclassified 2488
236 Ga0501036_0170720 3300049572 Unclassified 1832
237 Ga0501037_0110536 3300049573 Unclassified 1980
238 Ga0501046_0037362 3300049580 Bacteria 3902
239 Ga0501047_0123586 3300049581 Bacteria 2468
240 Ga0501048_0115653 3300049582 Unclassified 1895
241 Ga0501067_0060021 3300049583 Unclassified 2105
242 Ga0501068_0124091 3300049584 Unclassified 1612
243 Ga0501070_0094035 3300049586 Bacteria 2480
244 Ga0501073_0049240 3300049589 Bacteria 2955
245 Ga0501074_0025706 3300049590 Bacteria 4272
246 Ga0501202_019381 3300049652 Unclassified 1343
247 Ga0501079_0044081 3300049741 Bacteria 3443
248 Ga0501035_0080971 3300049822 Bacteria 2866
249 Ga0501044_0174193 3300049823 Unclassified 2121
250 nmdc:mga0k408_16172_c1 3300050493 Bacteria 4136
251 nmdc:mga09592_268185_c1 3300050508 Bacteria 1481
252 nmdc:mga09592_87252_c1 3300050508 Bacteria 2664
253 nmdc:mga0qj67_39472_c1 3300050509 Bacteria 3708
254 nmdc:mga06r32_438012_c1 3300050510 Bacteria 1287
255 nmdc:mga06r32_98534_c1 3300050510 Bacteria 2866
256 nmdc:mga08y16_442496_c1 3300050511 Bacteria 1326
257 nmdc:mga08y16_85245_c1 3300050511 Bacteria 3292
258 nmdc:mga0n895_579451_c1 3300050512 Bacteria 1126
259 Ga0500616_0077009 3300053153 Unclassified 1685
260 Ga0500611_000004 3300053727 Bacteria 253326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0324482 Ga0316574_0324482_78_935 284
2 3300025918 Ga0207662_10281260 Ga0207662_102812601 285
3 3300013307 Ga0157372_10376151 Ga0157372_103761512 312
4 3300013104 Ga0157370_10010747 Ga0157370_100107472 317
5 3300005354 Ga0070675_100148465 Ga0070675_1001484652 318
6 3300005578 Ga0068854_100431370 Ga0068854_1004313702 318
7 3300005616 Ga0068852_100130199 Ga0068852_1001301992 318
8 3300005719 Ga0068861_100030703 Ga0068861_1000307033 318
9 3300006881 Ga0068865_100150017 Ga0068865_1001500172 318
10 3300013306 Ga0163162_10018183 Ga0163162_100181835 318
11 3300013308 Ga0157375_10118875 Ga0157375_101188752 318
12 3300014745 Ga0157377_10006235 Ga0157377_100062352 318
13 3300025942 Ga0207689_10045846 Ga0207689_100458462 318
14 3300026142 Ga0207698_10136695 Ga0207698_101366952 318
15 3300005618 Ga0068864_100152804 Ga0068864_1001528042 319
16 3300042876 Ga0451577_0007717 Ga0451577_0007717_839_1816 324
17 3300005336 Ga0070680_100175077 Ga0070680_1001750772 326
18 3300005458 Ga0070681_10200041 Ga0070681_102000412 326
19 3300013100 Ga0157373_10075894 Ga0157373_100758942 326
20 3300013105 Ga0157369_10082868 Ga0157369_100828682 326
21 3300025912 Ga0207707_10093808 Ga0207707_100938082 326
22 3300025917 Ga0207660_10067399 Ga0207660_100673991 326
23 3300025921 Ga0207652_10151546 Ga0207652_101515461 326
24 3300026041 Ga0207639_10480364 Ga0207639_104803642 326
25 3300005290 Ga0065712_10121900 Ga0065712_101219002 327
26 3300005329 Ga0070683_100001339 Ga0070683_1000013395 327
27 3300005338 Ga0068868_100028108 Ga0068868_1000281081 327
28 3300005340 Ga0070689_100003634 Ga0070689_1000036344 327
29 3300005344 Ga0070661_100026739 Ga0070661_1000267392 327
30 3300005365 Ga0070688_100012343 Ga0070688_1000123432 327
31 3300005367 Ga0070667_100095572 Ga0070667_1000955722 327
32 3300005457 Ga0070662_100298133 Ga0070662_1002981332 327
33 3300005535 Ga0070684_100011128 Ga0070684_1000111285 327
34 3300005548 Ga0070665_100048610 Ga0070665_1000486103 327
35 3300005564 Ga0070664_100010920 Ga0070664_1000109202 327
36 3300005577 Ga0068857_100093315 Ga0068857_1000933152 327
37 3300005617 Ga0068859_100010937 Ga0068859_1000109375 327
38 3300005618 Ga0068864_100006021 Ga0068864_1000060215 327
39 3300005842 Ga0068858_100202700 Ga0068858_1002027002 327
40 3300006931 Ga0097620_100010937 Ga0097620_1000109375 327
41 3300013296 Ga0157374_10001062 Ga0157374_100010629 327
42 3300013306 Ga0163162_10053893 Ga0163162_100538932 327
43 3300013308 Ga0157375_10005920 Ga0157375_100059207 327
44 3300014325 Ga0163163_10000469 Ga0163163_100004698 327
45 3300014745 Ga0157377_10013072 Ga0157377_100130723 327
46 3300014968 Ga0157379_10183713 Ga0157379_101837132 327
47 3300025920 Ga0207649_10010366 Ga0207649_100103665 327
48 3300025933 Ga0207706_10089914 Ga0207706_100899142 327
49 3300025940 Ga0207691_10017140 Ga0207691_100171402 327
50 3300025942 Ga0207689_10001618 Ga0207689_1000161814 327
51 3300025944 Ga0207661_10019270 Ga0207661_100192702 327
52 3300025945 Ga0207679_10001624 Ga0207679_1000162411 327
53 3300025986 Ga0207658_10094962 Ga0207658_100949622 327
54 3300026116 Ga0207674_10019936 Ga0207674_100199362 327
55 3300031730 Ga0307516_10119608 Ga0307516_101196083 327
56 3300048913 Ga0496110_0211499 Ga0496110_0211499_716_1699 327
57 3300013307 Ga0157372_10110396 Ga0157372_101103962 328
58 3300013307 Ga0157372_10348102 Ga0157372_103481021 328
59 3300032126 Ga0307415_100129631 Ga0307415_1001296311 328
60 3300037418 Ga0395900_0083312 Ga0395900_0083312_298_1284 328
61 3300037471 Ga0395905_0012891 Ga0395905_0012891_921_1907 328
62 3300037471 Ga0395905_0226416 Ga0395905_0226416_736_1722 328
63 3300042876 Ga0451577_0000300 Ga0451577_0000300_27981_28970 328
64 3300044712 Ga0453684_0000033 Ga0453684_0000033_597392_598381 328
65 3300003323 rootH1_10253689 rootH1_102536891 329
66 3300005289 Ga0065704_10087140 Ga0065704_100871402 329
67 3300005289 Ga0065704_10178288 Ga0065704_101782882 329
68 3300005290 Ga0065712_10001142 Ga0065712_100011427 329
69 3300005290 Ga0065712_10073409 Ga0065712_100734094 329
70 3300005290 Ga0065712_10100196 Ga0065712_101001961 329
71 3300005329 Ga0070683_100000238 Ga0070683_10000023828 329
72 3300005329 Ga0070683_100028987 Ga0070683_1000289874 329
73 3300005330 Ga0070690_100011848 Ga0070690_1000118484 329
74 3300005331 Ga0070670_100270402 Ga0070670_1002704022 329
75 3300005334 Ga0068869_100220749 Ga0068869_1002207492 329
76 3300005335 Ga0070666_10131103 Ga0070666_101311032 329
77 3300005335 Ga0070666_10213538 Ga0070666_102135382 329
78 3300005340 Ga0070689_100047060 Ga0070689_1000470602 329
79 3300005340 Ga0070689_100088572 Ga0070689_1000885722 329
80 3300005343 Ga0070687_100020777 Ga0070687_1000207772 329
81 3300005343 Ga0070687_100165322 Ga0070687_1001653221 329
82 3300005344 Ga0070661_100001444 Ga0070661_10000144416 329
83 3300005353 Ga0070669_100058318 Ga0070669_1000583182 329
84 3300005353 Ga0070669_100114737 Ga0070669_1001147372 329
85 3300005355 Ga0070671_100039165 Ga0070671_1000391652 329
86 3300005365 Ga0070688_100349152 Ga0070688_1003491521 329
87 3300005366 Ga0070659_100040117 Ga0070659_1000401172 329
88 3300005438 Ga0070701_10037643 Ga0070701_100376432 329
89 3300005457 Ga0070662_100152175 Ga0070662_1001521752 329
90 3300005466 Ga0070685_10098466 Ga0070685_100984662 329
91 3300005471 Ga0070698_100002551 Ga0070698_1000025513 329
92 3300005471 Ga0070698_100054905 Ga0070698_1000549052 329
93 3300005471 Ga0070698_100082947 Ga0070698_1000829472 329
94 3300005518 Ga0070699_100225349 Ga0070699_1002253491 329
95 3300005518 Ga0070699_100237942 Ga0070699_1002379422 329
96 3300005530 Ga0070679_100001653 Ga0070679_1000016535 329
97 3300005535 Ga0070684_100001043 Ga0070684_1000010439 329
98 3300005535 Ga0070684_100017077 Ga0070684_1000170774 329
99 3300005539 Ga0068853_100002759 Ga0068853_1000027598 329
100 3300005543 Ga0070672_100066984 Ga0070672_1000669842 329
101 3300005548 Ga0070665_100357294 Ga0070665_1003572942 329
102 3300005564 Ga0070664_100001070 Ga0070664_10000107014 329
103 3300005564 Ga0070664_100002432 Ga0070664_10000243211 329
104 3300005564 Ga0070664_100092957 Ga0070664_1000929572 329
105 3300005577 Ga0068857_100002814 Ga0068857_10000281410 329
106 3300005577 Ga0068857_100263104 Ga0068857_1002631042 329
107 3300005578 Ga0068854_100180829 Ga0068854_1001808292 329
108 3300005616 Ga0068852_100115973 Ga0068852_1001159732 329
109 3300005616 Ga0068852_100347256 Ga0068852_1003472562 329
110 3300005617 Ga0068859_100075496 Ga0068859_1000754962 329
111 3300005617 Ga0068859_100098429 Ga0068859_1000984293 329
112 3300005617 Ga0068859_100349792 Ga0068859_1003497922 329
113 3300005618 Ga0068864_100320813 Ga0068864_1003208132 329
114 3300005618 Ga0068864_100370818 Ga0068864_1003708181 329
115 3300005719 Ga0068861_100005573 Ga0068861_1000055735 329
116 3300005834 Ga0068851_10057517 Ga0068851_100575172 329
117 3300005834 Ga0068851_10139607 Ga0068851_101396071 329
118 3300005841 Ga0068863_100015583 Ga0068863_1000155836 329
119 3300005841 Ga0068863_100034709 Ga0068863_1000347093 329
120 3300005841 Ga0068863_100131334 Ga0068863_1001313342 329
121 3300005841 Ga0068863_100431463 Ga0068863_1004314631 329
122 3300005842 Ga0068858_100066609 Ga0068858_1000666091 329
123 3300005844 Ga0068862_100011917 Ga0068862_1000119177 329
124 3300005985 Ga0081539_10020611 Ga0081539_100206114 329
125 3300006237 Ga0097621_100055650 Ga0097621_1000556502 329
126 3300006358 Ga0068871_100023531 Ga0068871_1000235313 329
127 3300006358 Ga0068871_100214608 Ga0068871_1002146082 329
128 3300006844 Ga0075428_100043190 Ga0075428_1000431901 329
129 3300006844 Ga0075428_100289655 Ga0075428_1002896552 329
130 3300006846 Ga0075430_100003574 Ga0075430_1000035746 329
131 3300006847 Ga0075431_100032249 Ga0075431_1000322493 329
132 3300006847 Ga0075431_100400724 Ga0075431_1004007242 329
133 3300006880 Ga0075429_100001495 Ga0075429_1000014952 329
134 3300006880 Ga0075429_100086385 Ga0075429_1000863852 329
135 3300006931 Ga0097620_100075499 Ga0097620_1000754992 329
136 3300006931 Ga0097620_100098427 Ga0097620_1000984273 329
137 3300006931 Ga0097620_100349798 Ga0097620_1003497982 329
138 3300009147 Ga0114129_10915237 Ga0114129_109152371 329
139 3300009148 Ga0105243_10072457 Ga0105243_100724573 329
140 3300009176 Ga0105242_10104883 Ga0105242_101048832 329
141 3300009553 Ga0105249_10002194 Ga0105249_1000219411 329
142 3300009553 Ga0105249_10007108 Ga0105249_100071084 329
143 3300009553 Ga0105249_10138984 Ga0105249_101389842 329
144 3300009553 Ga0105249_10206155 Ga0105249_102061552 329
145 3300010375 Ga0105239_10032927 Ga0105239_100329272 329
146 3300013100 Ga0157373_10022753 Ga0157373_100227535 329
147 3300013100 Ga0157373_10231410 Ga0157373_102314102 329
148 3300013105 Ga0157369_10402346 Ga0157369_104023462 329
149 3300013296 Ga0157374_10055724 Ga0157374_100557242 329
150 3300013297 Ga0157378_10110632 Ga0157378_101106322 329
151 3300013297 Ga0157378_10445932 Ga0157378_104459321 329
152 3300013306 Ga0163162_10099864 Ga0163162_100998641 329
153 3300013306 Ga0163162_10412328 Ga0163162_104123282 329
154 3300013307 Ga0157372_10108559 Ga0157372_101085592 329
155 3300013308 Ga0157375_10104331 Ga0157375_101043312 329
156 3300013308 Ga0157375_10138982 Ga0157375_101389822 329
157 3300013308 Ga0157375_10291785 Ga0157375_102917852 329
158 3300013308 Ga0157375_10508678 Ga0157375_105086781 329
159 3300014325 Ga0163163_10127725 Ga0163163_101277252 329
160 3300014325 Ga0163163_10128002 Ga0163163_101280022 329
161 3300014326 Ga0157380_10216550 Ga0157380_102165502 329
162 3300014745 Ga0157377_10222392 Ga0157377_102223921 329
163 3300014968 Ga0157379_10090451 Ga0157379_100904512 329
164 3300014968 Ga0157379_10148193 Ga0157379_101481932 329
165 3300014968 Ga0157379_10203589 Ga0157379_102035892 329
166 3300014969 Ga0157376_10137002 Ga0157376_101370022 329
167 3300014969 Ga0157376_10479418 Ga0157376_104794181 329
168 3300025908 Ga0207643_10022376 Ga0207643_100223761 329
169 3300025909 Ga0207705_10012360 Ga0207705_100123602 329
170 3300025912 Ga0207707_10153998 Ga0207707_101539982 329
171 3300025913 Ga0207695_10018560 Ga0207695_100185608 329
172 3300025914 Ga0207671_10179775 Ga0207671_101797752 329
173 3300025918 Ga0207662_10093466 Ga0207662_100934662 329
174 3300025918 Ga0207662_10172497 Ga0207662_101724972 329
175 3300025919 Ga0207657_10102031 Ga0207657_101020312 329
176 3300025920 Ga0207649_10008373 Ga0207649_100083735 329
177 3300025921 Ga0207652_10000739 Ga0207652_100007393 329
178 3300025923 Ga0207681_10252327 Ga0207681_102523271 329
179 3300025925 Ga0207650_10018482 Ga0207650_100184824 329
180 3300025925 Ga0207650_10075442 Ga0207650_100754422 329
181 3300025926 Ga0207659_10009382 Ga0207659_100093825 329
182 3300025931 Ga0207644_10037932 Ga0207644_100379323 329
183 3300025931 Ga0207644_10170584 Ga0207644_101705842 329
184 3300025933 Ga0207706_10151312 Ga0207706_101513122 329
185 3300025934 Ga0207686_10027288 Ga0207686_100272883 329
186 3300025934 Ga0207686_10061672 Ga0207686_100616722 329
187 3300025935 Ga0207709_10043170 Ga0207709_100431703 329
188 3300025936 Ga0207670_10008154 Ga0207670_100081545 329
189 3300025940 Ga0207691_10079702 Ga0207691_100797022 329
190 3300025942 Ga0207689_10035210 Ga0207689_100352102 329
191 3300025942 Ga0207689_10199754 Ga0207689_101997542 329
192 3300025942 Ga0207689_10226582 Ga0207689_102265822 329
193 3300025944 Ga0207661_10013332 Ga0207661_100133323 329
194 3300025945 Ga0207679_10000296 Ga0207679_1000029624 329
195 3300025960 Ga0207651_10014151 Ga0207651_100141512 329
196 3300025960 Ga0207651_10020452 Ga0207651_100204522 329
197 3300025961 Ga0207712_10005116 Ga0207712_100051167 329
198 3300025961 Ga0207712_10007732 Ga0207712_100077324 329
199 3300025961 Ga0207712_10017873 Ga0207712_100178732 329
200 3300025961 Ga0207712_10155379 Ga0207712_101553792 329
201 3300025961 Ga0207712_10167170 Ga0207712_101671702 329
202 3300026023 Ga0207677_10054778 Ga0207677_100547782 329
203 3300026041 Ga0207639_10085243 Ga0207639_100852432 329
204 3300026088 Ga0207641_10000275 Ga0207641_1000027515 329
205 3300026088 Ga0207641_10015260 Ga0207641_100152605 329
206 3300026088 Ga0207641_10024800 Ga0207641_100248004 329
207 3300026088 Ga0207641_10375492 Ga0207641_103754922 329
208 3300026089 Ga0207648_10093197 Ga0207648_100931972 329
209 3300026095 Ga0207676_10053714 Ga0207676_100537142 329
210 3300026095 Ga0207676_10101164 Ga0207676_101011642 329
211 3300026116 Ga0207674_10000294 Ga0207674_1000029431 329
212 3300026116 Ga0207674_10058449 Ga0207674_100584492 329
213 3300026118 Ga0207675_100009364 Ga0207675_1000093645 329
214 3300026118 Ga0207675_100084985 Ga0207675_1000849852 329
215 3300026118 Ga0207675_100320716 Ga0207675_1003207162 329
216 3300026121 Ga0207683_10186641 Ga0207683_101866412 329
217 3300026121 Ga0207683_10355302 Ga0207683_103553021 329
218 3300026142 Ga0207698_10115009 Ga0207698_101150092 329
219 3300026142 Ga0207698_10267688 Ga0207698_102676882 329
220 3300028379 Ga0268266_10167685 Ga0268266_101676852 329
221 3300028380 Ga0268265_10098295 Ga0268265_100982952 329
222 3300028380 Ga0268265_10179838 Ga0268265_101798382 329
223 3300031251 Ga0265327_10012633 Ga0265327_100126334 329
224 3300031852 Ga0307410_10195497 Ga0307410_101954972 329
225 3300031911 Ga0307412_10308900 Ga0307412_103089002 329
226 3300037068 Ga0373925_0070647 Ga0373925_0070647_126_1115 329
227 3300039437 Ga0436365_1642374 Ga0436365_1642374_35245_36240 329
228 3300042001 Ga0439441_009860 Ga0439441_009860_373_1365 329
229 3300042134 Ga0450898_021046 Ga0450898_021046_47_1036 329
230 3300042436 Ga0439435_0038342 Ga0439435_0038342_171_1160 329
231 3300042461 Ga0439460_0054133 Ga0439460_0054133_86_1075 329
232 3300046522 Ga0495643_0036656 Ga0495643_0036656_477_1514 329
233 3300048913 Ga0496110_0426348 Ga0496110_0426348_133_1149 329
234 3300049569 Ga0501032_0005855 Ga0501032_0005855_2468_3457 329
235 3300049571 Ga0501034_0131232 Ga0501034_0131232_396_1385 329
236 3300049572 Ga0501036_0170720 Ga0501036_0170720_129_1118 329
237 3300049573 Ga0501037_0110536 Ga0501037_0110536_294_1283 329
238 3300049580 Ga0501046_0037362 Ga0501046_0037362_1388_2377 329
239 3300049581 Ga0501047_0123586 Ga0501047_0123586_1388_2377 329
240 3300049582 Ga0501048_0115653 Ga0501048_0115653_586_1575 329
241 3300049583 Ga0501067_0060021 Ga0501067_0060021_379_1368 329
242 3300049584 Ga0501068_0124091 Ga0501068_0124091_418_1407 329
243 3300049586 Ga0501070_0094035 Ga0501070_0094035_801_1790 329
244 3300049589 Ga0501073_0049240 Ga0501073_0049240_1395_2384 329
245 3300049590 Ga0501074_0025706 Ga0501074_0025706_145_1134 329
246 3300049652 Ga0501202_019381 Ga0501202_019381_64_1053 329
247 3300049741 Ga0501079_0044081 Ga0501079_0044081_241_1230 329
248 3300049822 Ga0501035_0080971 Ga0501035_0080971_230_1219 329
249 3300049823 Ga0501044_0174193 Ga0501044_0174193_725_1714 329
250 3300050493 nmdc:mga0k408_16172_c1 nmdc:mga0k408_16172_c1_258_1247 329
251 3300050508 nmdc:mga09592_268185_c1 nmdc:mga09592_268185_c1_377_1369 329
252 3300050508 nmdc:mga09592_87252_c1 nmdc:mga09592_87252_c1_1470_2459 329
253 3300050509 nmdc:mga0qj67_39472_c1 nmdc:mga0qj67_39472_c1_1784_2773 329
254 3300050510 nmdc:mga06r32_438012_c1 nmdc:mga06r32_438012_c1_264_1256 329
255 3300050510 nmdc:mga06r32_98534_c1 nmdc:mga06r32_98534_c1_825_1814 329
256 3300050511 nmdc:mga08y16_442496_c1 nmdc:mga08y16_442496_c1_28_1017 329
257 3300050511 nmdc:mga08y16_85245_c1 nmdc:mga08y16_85245_c1_402_1391 329
258 3300050512 nmdc:mga0n895_579451_c1 nmdc:mga0n895_579451_c1_94_1086 329
259 3300053153 Ga0500616_0077009 Ga0500616_0077009_624_1613 329
260 3300053727 Ga0500611_000004 Ga0500611_000004_147891_148880 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

332

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8869 1 313
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8834 3 296
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8692 3 296
4exa-assembly2.cif.gz_F crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8663 3 296
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8654 3 296
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8884 1 313 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8766 1 313 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8758 2 313 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8695 1 132 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8678 2 313 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1D2TJT7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9857 1 329
AF-A0A1D2TJT7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9827 1 329
AF-A0A3N5PV67-F1-model_v4 Aldo/keto reductase 0.9797 1 286
AF-A0A7J4VDR0-F1-model_v4 Aldo/keto reductase 0.9778 27 329
AF-A0A3D4TB24-F1-model_v4 Aldo/keto reductase 0.9762 1 221

Feature Viewer

pLDDT pTM Quality
91.74 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map