F369304
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 146 | 260 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100011848|Ga0070690_1000118484 |
| Length | 346 |
| Sequence | MQYRKFGSTDLLVSEIGFGAWAIGGGAMIGNTSIGWGDADDTVSLQAIQAALDAGINFFDTADIYGLGHSEEILGKAVQHDRNVIIATKVGNVARNDQFTVDYSKEYILKACGQSLKRLRRETIDYYQLHSARVEHLQNGECIEAIEELQKQGKIRYWGLSLNTFDPFPEAEVLMKHRLGNARPSARAGTDEDDLVGRGFQLVLNILNQRALPILEKANKNGYGVIARMPLQFGLLTGKFDTNSAFPANDHRHNRLTEEVISNSSEALKPVWELCKKYGMTKTQLALSYVLSYPGISTIIPGIRTPEHVTQNTTGLARLDDADMKMIEDLGKGKFVPVMKLIQKQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 116 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 117 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 118 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 123 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 136 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 146 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 96.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10253689 | 3300003323 | Bacteria | 1491 |
| 2 | Ga0065704_10087140 | 3300005289 | Bacteria | 3044 |
| 3 | Ga0065704_10178288 | 3300005289 | Unclassified | 1184 |
| 4 | Ga0065712_10001142 | 3300005290 | Bacteria | 10072 |
| 5 | Ga0065712_10073409 | 3300005290 | Bacteria | 4402 |
| 6 | Ga0065712_10100196 | 3300005290 | Bacteria | 2064 |
| 7 | Ga0065712_10121900 | 3300005290 | Unclassified | 1657 |
| 8 | Ga0070683_100000238 | 3300005329 | Bacteria | 37700 |
| 9 | Ga0070683_100001339 | 3300005329 | Bacteria | 18784 |
| 10 | Ga0070683_100028987 | 3300005329 | Bacteria | 5007 |
| 11 | Ga0070690_100011848 | 3300005330 | Bacteria | 5116 |
| 12 | Ga0070670_100270402 | 3300005331 | Bacteria | 1483 |
| 13 | Ga0068869_100220749 | 3300005334 | Bacteria | 1502 |
| 14 | Ga0070666_10131103 | 3300005335 | Unclassified | 1742 |
| 15 | Ga0070666_10213538 | 3300005335 | Bacteria | 1359 |
| 16 | Ga0070680_100175077 | 3300005336 | Unclassified | 1806 |
| 17 | Ga0068868_100028108 | 3300005338 | Bacteria | 4296 |
| 18 | Ga0070689_100003634 | 3300005340 | Bacteria | 10287 |
| 19 | Ga0070689_100047060 | 3300005340 | Bacteria | 3325 |
| 20 | Ga0070689_100088572 | 3300005340 | Bacteria | 2437 |
| 21 | Ga0070687_100020777 | 3300005343 | Bacteria | 3076 |
| 22 | Ga0070687_100165322 | 3300005343 | Unclassified | 1312 |
| 23 | Ga0070661_100001444 | 3300005344 | Bacteria | 16518 |
| 24 | Ga0070661_100026739 | 3300005344 | Unclassified | 4151 |
| 25 | Ga0070669_100058318 | 3300005353 | Bacteria | 2833 |
| 26 | Ga0070669_100114737 | 3300005353 | Bacteria | 2048 |
| 27 | Ga0070675_100148465 | 3300005354 | Bacteria | 2009 |
| 28 | Ga0070671_100039165 | 3300005355 | Bacteria | 3934 |
| 29 | Ga0070688_100012343 | 3300005365 | Bacteria | 4785 |
| 30 | Ga0070688_100349152 | 3300005365 | Unclassified | 1083 |
| 31 | Ga0070659_100040117 | 3300005366 | Bacteria | 3658 |
| 32 | Ga0070667_100095572 | 3300005367 | Unclassified | 2562 |
| 33 | Ga0070701_10037643 | 3300005438 | Bacteria | 2444 |
| 34 | Ga0070662_100152175 | 3300005457 | Unclassified | 1802 |
| 35 | Ga0070662_100298133 | 3300005457 | Bacteria | 1309 |
| 36 | Ga0070681_10200041 | 3300005458 | Unclassified | 1916 |
| 37 | Ga0070685_10098466 | 3300005466 | Bacteria | 1782 |
| 38 | Ga0070698_100002551 | 3300005471 | Bacteria | 20059 |
| 39 | Ga0070698_100054905 | 3300005471 | Bacteria | 4043 |
| 40 | Ga0070698_100082947 | 3300005471 | Bacteria | 3197 |
| 41 | Ga0070699_100225349 | 3300005518 | Bacteria | 1671 |
| 42 | Ga0070699_100237942 | 3300005518 | Bacteria | 1624 |
| 43 | Ga0070679_100001653 | 3300005530 | Bacteria | 20083 |
| 44 | Ga0070684_100001043 | 3300005535 | Bacteria | 19809 |
| 45 | Ga0070684_100011128 | 3300005535 | Bacteria | 7160 |
| 46 | Ga0070684_100017077 | 3300005535 | Bacteria | 5948 |
| 47 | Ga0068853_100002759 | 3300005539 | Bacteria | 13264 |
| 48 | Ga0070672_100066984 | 3300005543 | Bacteria | 2844 |
| 49 | Ga0070665_100048610 | 3300005548 | Bacteria | 4258 |
| 50 | Ga0070665_100357294 | 3300005548 | Bacteria | 1467 |
| 51 | Ga0070664_100001070 | 3300005564 | Bacteria | 21563 |
| 52 | Ga0070664_100002432 | 3300005564 | Bacteria | 14976 |
| 53 | Ga0070664_100010920 | 3300005564 | Bacteria | 7366 |
| 54 | Ga0070664_100092957 | 3300005564 | Bacteria | 2613 |
| 55 | Ga0068857_100002814 | 3300005577 | Bacteria | 14314 |
| 56 | Ga0068857_100093315 | 3300005577 | Unclassified | 2695 |
| 57 | Ga0068857_100263104 | 3300005577 | Unclassified | 1583 |
| 58 | Ga0068854_100180829 | 3300005578 | Bacteria | 1647 |
| 59 | Ga0068854_100431370 | 3300005578 | Bacteria | 1097 |
| 60 | Ga0068852_100115973 | 3300005616 | Bacteria | 2443 |
| 61 | Ga0068852_100130199 | 3300005616 | Bacteria | 2316 |
| 62 | Ga0068852_100347256 | 3300005616 | Unclassified | 1448 |
| 63 | Ga0068859_100010937 | 3300005617 | Bacteria | 9134 |
| 64 | Ga0068859_100075496 | 3300005617 | Bacteria | 3411 |
| 65 | Ga0068859_100098429 | 3300005617 | Bacteria | 2979 |
| 66 | Ga0068859_100349792 | 3300005617 | Unclassified | 1573 |
| 67 | Ga0068864_100006021 | 3300005618 | Bacteria | 9956 |
| 68 | Ga0068864_100152804 | 3300005618 | Bacteria | 2092 |
| 69 | Ga0068864_100320813 | 3300005618 | Bacteria | 1455 |
| 70 | Ga0068864_100370818 | 3300005618 | Unclassified | 1355 |
| 71 | Ga0068861_100005573 | 3300005719 | Bacteria | 8531 |
| 72 | Ga0068861_100030703 | 3300005719 | Bacteria | 3941 |
| 73 | Ga0068851_10057517 | 3300005834 | Bacteria | 1986 |
| 74 | Ga0068851_10139607 | 3300005834 | Bacteria | 1317 |
| 75 | Ga0068863_100015583 | 3300005841 | Bacteria | 7304 |
| 76 | Ga0068863_100034709 | 3300005841 | Bacteria | 4803 |
| 77 | Ga0068863_100131334 | 3300005841 | Bacteria | 2391 |
| 78 | Ga0068863_100431463 | 3300005841 | Unclassified | 1292 |
| 79 | Ga0068858_100066609 | 3300005842 | Bacteria | 3335 |
| 80 | Ga0068858_100202700 | 3300005842 | Bacteria | 1876 |
| 81 | Ga0068862_100011917 | 3300005844 | Bacteria | 7182 |
| 82 | Ga0081539_10020611 | 3300005985 | Bacteria | 4445 |
| 83 | Ga0097621_100055650 | 3300006237 | Bacteria | 3231 |
| 84 | Ga0068871_100023531 | 3300006358 | Bacteria | 4768 |
| 85 | Ga0068871_100214608 | 3300006358 | Unclassified | 1665 |
| 86 | Ga0075428_100043190 | 3300006844 | Unclassified | 4956 |
| 87 | Ga0075428_100289655 | 3300006844 | Bacteria | 1761 |
| 88 | Ga0075430_100003574 | 3300006846 | Bacteria | 13027 |
| 89 | Ga0075431_100032249 | 3300006847 | Bacteria | 5399 |
| 90 | Ga0075431_100400724 | 3300006847 | Bacteria | 1373 |
| 91 | Ga0075429_100001495 | 3300006880 | Bacteria | 19246 |
| 92 | Ga0075429_100086385 | 3300006880 | Bacteria | 2734 |
| 93 | Ga0068865_100150017 | 3300006881 | Bacteria | 1768 |
| 94 | Ga0097620_100010937 | 3300006931 | Bacteria | 9134 |
| 95 | Ga0097620_100075499 | 3300006931 | Bacteria | 3411 |
| 96 | Ga0097620_100098427 | 3300006931 | Bacteria | 2979 |
| 97 | Ga0097620_100349798 | 3300006931 | Unclassified | 1573 |
| 98 | Ga0114129_10915237 | 3300009147 | Bacteria | 1110 |
| 99 | Ga0105243_10072457 | 3300009148 | Bacteria | 2789 |
| 100 | Ga0105242_10104883 | 3300009176 | Bacteria | 2400 |
| 101 | Ga0105249_10002194 | 3300009553 | Bacteria | 16909 |
| 102 | Ga0105249_10007108 | 3300009553 | Bacteria | 9770 |
| 103 | Ga0105249_10138984 | 3300009553 | Bacteria | 2327 |
| 104 | Ga0105249_10206155 | 3300009553 | Bacteria | 1926 |
| 105 | Ga0105239_10032927 | 3300010375 | Bacteria | 5694 |
| 106 | Ga0157373_10022753 | 3300013100 | Bacteria | 4545 |
| 107 | Ga0157373_10075894 | 3300013100 | Unclassified | 2372 |
| 108 | Ga0157373_10231410 | 3300013100 | Bacteria | 1305 |
| 109 | Ga0157370_10010747 | 3300013104 | Bacteria | 9626 |
| 110 | Ga0157369_10082868 | 3300013105 | Bacteria | 3431 |
| 111 | Ga0157369_10402346 | 3300013105 | Bacteria | 1420 |
| 112 | Ga0157374_10001062 | 3300013296 | Bacteria | 23840 |
| 113 | Ga0157374_10055724 | 3300013296 | Bacteria | 3690 |
| 114 | Ga0157378_10110632 | 3300013297 | Unclassified | 2518 |
| 115 | Ga0157378_10445932 | 3300013297 | Bacteria | 1284 |
| 116 | Ga0163162_10018183 | 3300013306 | Bacteria | 6883 |
| 117 | Ga0163162_10053893 | 3300013306 | Bacteria | 4043 |
| 118 | Ga0163162_10099864 | 3300013306 | Bacteria | 2993 |
| 119 | Ga0163162_10412328 | 3300013306 | Unclassified | 1483 |
| 120 | Ga0157372_10108559 | 3300013307 | Bacteria | 3176 |
| 121 | Ga0157372_10110396 | 3300013307 | Bacteria | 3150 |
| 122 | Ga0157372_10348102 | 3300013307 | Bacteria | 1726 |
| 123 | Ga0157372_10376151 | 3300013307 | Bacteria | 1655 |
| 124 | Ga0157375_10005920 | 3300013308 | Bacteria | 10658 |
| 125 | Ga0157375_10104331 | 3300013308 | Bacteria | 2923 |
| 126 | Ga0157375_10118875 | 3300013308 | Bacteria | 2750 |
| 127 | Ga0157375_10138982 | 3300013308 | Bacteria | 2555 |
| 128 | Ga0157375_10291785 | 3300013308 | Unclassified | 1794 |
| 129 | Ga0157375_10508678 | 3300013308 | Bacteria | 1368 |
| 130 | Ga0163163_10000469 | 3300014325 | Bacteria | 36859 |
| 131 | Ga0163163_10127725 | 3300014325 | Bacteria | 2581 |
| 132 | Ga0163163_10128002 | 3300014325 | Bacteria | 2578 |
| 133 | Ga0157380_10216550 | 3300014326 | Bacteria | 1710 |
| 134 | Ga0157377_10006235 | 3300014745 | Bacteria | 5675 |
| 135 | Ga0157377_10013072 | 3300014745 | Bacteria | 4192 |
| 136 | Ga0157377_10222392 | 3300014745 | Unclassified | 1209 |
| 137 | Ga0157379_10090451 | 3300014968 | Bacteria | 2746 |
| 138 | Ga0157379_10148193 | 3300014968 | Bacteria | 2117 |
| 139 | Ga0157379_10183713 | 3300014968 | Unclassified | 1889 |
| 140 | Ga0157379_10203589 | 3300014968 | Unclassified | 1790 |
| 141 | Ga0157376_10137002 | 3300014969 | Bacteria | 2192 |
| 142 | Ga0157376_10479418 | 3300014969 | Unclassified | 1219 |
| 143 | Ga0207643_10022376 | 3300025908 | Bacteria | 3479 |
| 144 | Ga0207705_10012360 | 3300025909 | Bacteria | 6169 |
| 145 | Ga0207707_10093808 | 3300025912 | Unclassified | 2622 |
| 146 | Ga0207707_10153998 | 3300025912 | Bacteria | 2010 |
| 147 | Ga0207695_10018560 | 3300025913 | Bacteria | 8036 |
| 148 | Ga0207671_10179775 | 3300025914 | Unclassified | 1646 |
| 149 | Ga0207660_10067399 | 3300025917 | Bacteria | 2592 |
| 150 | Ga0207662_10093466 | 3300025918 | Bacteria | 1853 |
| 151 | Ga0207662_10172497 | 3300025918 | Unclassified | 1387 |
| 152 | Ga0207662_10281260 | 3300025918 | Bacteria | 1101 |
| 153 | Ga0207657_10102031 | 3300025919 | Bacteria | 2380 |
| 154 | Ga0207649_10008373 | 3300025920 | Bacteria | 5637 |
| 155 | Ga0207649_10010366 | 3300025920 | Bacteria | 5118 |
| 156 | Ga0207652_10000739 | 3300025921 | Bacteria | 31538 |
| 157 | Ga0207652_10151546 | 3300025921 | Bacteria | 2076 |
| 158 | Ga0207681_10252327 | 3300025923 | Unclassified | 1378 |
| 159 | Ga0207650_10018482 | 3300025925 | Bacteria | 4892 |
| 160 | Ga0207650_10075442 | 3300025925 | Bacteria | 2545 |
| 161 | Ga0207659_10009382 | 3300025926 | Bacteria | 6111 |
| 162 | Ga0207644_10037932 | 3300025931 | Bacteria | 3392 |
| 163 | Ga0207644_10170584 | 3300025931 | Unclassified | 1698 |
| 164 | Ga0207706_10089914 | 3300025933 | Unclassified | 2699 |
| 165 | Ga0207706_10151312 | 3300025933 | Unclassified | 2041 |
| 166 | Ga0207686_10027288 | 3300025934 | Bacteria | 3342 |
| 167 | Ga0207686_10061672 | 3300025934 | Bacteria | 2378 |
| 168 | Ga0207709_10043170 | 3300025935 | Bacteria | 2716 |
| 169 | Ga0207670_10008154 | 3300025936 | Bacteria | 5896 |
| 170 | Ga0207691_10017140 | 3300025940 | Bacteria | 6871 |
| 171 | Ga0207691_10079702 | 3300025940 | Bacteria | 2947 |
| 172 | Ga0207689_10001618 | 3300025942 | Bacteria | 21337 |
| 173 | Ga0207689_10035210 | 3300025942 | Bacteria | 4159 |
| 174 | Ga0207689_10045846 | 3300025942 | Bacteria | 3614 |
| 175 | Ga0207689_10199754 | 3300025942 | Bacteria | 1650 |
| 176 | Ga0207689_10226582 | 3300025942 | Bacteria | 1545 |
| 177 | Ga0207661_10013332 | 3300025944 | Bacteria | 6004 |
| 178 | Ga0207661_10019270 | 3300025944 | Bacteria | 5083 |
| 179 | Ga0207679_10000296 | 3300025945 | Bacteria | 37547 |
| 180 | Ga0207679_10001624 | 3300025945 | Bacteria | 14013 |
| 181 | Ga0207651_10014151 | 3300025960 | Bacteria | 4597 |
| 182 | Ga0207651_10020452 | 3300025960 | Bacteria | 3995 |
| 183 | Ga0207712_10005116 | 3300025961 | Bacteria | 8300 |
| 184 | Ga0207712_10007732 | 3300025961 | Bacteria | 6797 |
| 185 | Ga0207712_10017873 | 3300025961 | Bacteria | 4613 |
| 186 | Ga0207712_10155379 | 3300025961 | Bacteria | 1771 |
| 187 | Ga0207712_10167170 | 3300025961 | Bacteria | 1715 |
| 188 | Ga0207658_10094962 | 3300025986 | Unclassified | 2322 |
| 189 | Ga0207677_10054778 | 3300026023 | Bacteria | 2724 |
| 190 | Ga0207639_10085243 | 3300026041 | Bacteria | 2512 |
| 191 | Ga0207639_10480364 | 3300026041 | Unclassified | 1132 |
| 192 | Ga0207641_10000275 | 3300026088 | Bacteria | 64649 |
| 193 | Ga0207641_10015260 | 3300026088 | Bacteria | 6295 |
| 194 | Ga0207641_10024800 | 3300026088 | Bacteria | 4943 |
| 195 | Ga0207641_10375492 | 3300026088 | Bacteria | 1360 |
| 196 | Ga0207648_10093197 | 3300026089 | Bacteria | 2634 |
| 197 | Ga0207676_10053714 | 3300026095 | Bacteria | 3154 |
| 198 | Ga0207676_10101164 | 3300026095 | Bacteria | 2389 |
| 199 | Ga0207674_10000294 | 3300026116 | Bacteria | 63206 |
| 200 | Ga0207674_10019936 | 3300026116 | Bacteria | 7256 |
| 201 | Ga0207674_10058449 | 3300026116 | Bacteria | 3906 |
| 202 | Ga0207675_100009364 | 3300026118 | Bacteria | 9180 |
| 203 | Ga0207675_100084985 | 3300026118 | Bacteria | 2969 |
| 204 | Ga0207675_100320716 | 3300026118 | Unclassified | 1512 |
| 205 | Ga0207683_10186641 | 3300026121 | Unclassified | 1881 |
| 206 | Ga0207683_10355302 | 3300026121 | Unclassified | 1345 |
| 207 | Ga0207698_10115009 | 3300026142 | Bacteria | 2264 |
| 208 | Ga0207698_10136695 | 3300026142 | Bacteria | 2104 |
| 209 | Ga0207698_10267688 | 3300026142 | Bacteria | 1573 |
| 210 | Ga0268266_10167685 | 3300028379 | Bacteria | 1991 |
| 211 | Ga0268265_10098295 | 3300028380 | Bacteria | 2357 |
| 212 | Ga0268265_10179838 | 3300028380 | Bacteria | 1816 |
| 213 | Ga0265327_10012633 | 3300031251 | Bacteria | 5681 |
| 214 | Ga0307516_10119608 | 3300031730 | Bacteria | 2427 |
| 215 | Ga0307410_10195497 | 3300031852 | Unclassified | 1541 |
| 216 | Ga0307412_10308900 | 3300031911 | Unclassified | 1253 |
| 217 | Ga0307415_100129631 | 3300032126 | Bacteria | 1907 |
| 218 | Ga0316574_0324482 | 3300035398 | Bacteria | 977 |
| 219 | Ga0373925_0070647 | 3300037068 | Bacteria | 2640 |
| 220 | Ga0395900_0083312 | 3300037418 | Bacteria | 3286 |
| 221 | Ga0395905_0012891 | 3300037471 | Bacteria | 8035 |
| 222 | Ga0395905_0226416 | 3300037471 | Bacteria | 1749 |
| 223 | Ga0436365_1642374 | 3300039437 | Bacteria | 37274 |
| 224 | Ga0439441_009860 | 3300042001 | Bacteria | 1591 |
| 225 | Ga0450898_021046 | 3300042134 | Bacteria | 1146 |
| 226 | Ga0439435_0038342 | 3300042436 | Bacteria | 1332 |
| 227 | Ga0439460_0054133 | 3300042461 | Unclassified | 1210 |
| 228 | Ga0451577_0000300 | 3300042876 | Bacteria | 96339 |
| 229 | Ga0451577_0007717 | 3300042876 | Bacteria | 10547 |
| 230 | Ga0453684_0000033 | 3300044712 | Bacteria | 734012 |
| 231 | Ga0495643_0036656 | 3300046522 | Bacteria | 2693 |
| 232 | Ga0496110_0211499 | 3300048913 | Unclassified | 1763 |
| 233 | Ga0496110_0426348 | 3300048913 | Bacteria | 1209 |
| 234 | Ga0501032_0005855 | 3300049569 | Bacteria | 9093 |
| 235 | Ga0501034_0131232 | 3300049571 | Unclassified | 2488 |
| 236 | Ga0501036_0170720 | 3300049572 | Unclassified | 1832 |
| 237 | Ga0501037_0110536 | 3300049573 | Unclassified | 1980 |
| 238 | Ga0501046_0037362 | 3300049580 | Bacteria | 3902 |
| 239 | Ga0501047_0123586 | 3300049581 | Bacteria | 2468 |
| 240 | Ga0501048_0115653 | 3300049582 | Unclassified | 1895 |
| 241 | Ga0501067_0060021 | 3300049583 | Unclassified | 2105 |
| 242 | Ga0501068_0124091 | 3300049584 | Unclassified | 1612 |
| 243 | Ga0501070_0094035 | 3300049586 | Bacteria | 2480 |
| 244 | Ga0501073_0049240 | 3300049589 | Bacteria | 2955 |
| 245 | Ga0501074_0025706 | 3300049590 | Bacteria | 4272 |
| 246 | Ga0501202_019381 | 3300049652 | Unclassified | 1343 |
| 247 | Ga0501079_0044081 | 3300049741 | Bacteria | 3443 |
| 248 | Ga0501035_0080971 | 3300049822 | Bacteria | 2866 |
| 249 | Ga0501044_0174193 | 3300049823 | Unclassified | 2121 |
| 250 | nmdc:mga0k408_16172_c1 | 3300050493 | Bacteria | 4136 |
| 251 | nmdc:mga09592_268185_c1 | 3300050508 | Bacteria | 1481 |
| 252 | nmdc:mga09592_87252_c1 | 3300050508 | Bacteria | 2664 |
| 253 | nmdc:mga0qj67_39472_c1 | 3300050509 | Bacteria | 3708 |
| 254 | nmdc:mga06r32_438012_c1 | 3300050510 | Bacteria | 1287 |
| 255 | nmdc:mga06r32_98534_c1 | 3300050510 | Bacteria | 2866 |
| 256 | nmdc:mga08y16_442496_c1 | 3300050511 | Bacteria | 1326 |
| 257 | nmdc:mga08y16_85245_c1 | 3300050511 | Bacteria | 3292 |
| 258 | nmdc:mga0n895_579451_c1 | 3300050512 | Bacteria | 1126 |
| 259 | Ga0500616_0077009 | 3300053153 | Unclassified | 1685 |
| 260 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0324482 | Ga0316574_0324482_78_935 | 284 |
| 2 | 3300025918 | Ga0207662_10281260 | Ga0207662_102812601 | 285 |
| 3 | 3300013307 | Ga0157372_10376151 | Ga0157372_103761512 | 312 |
| 4 | 3300013104 | Ga0157370_10010747 | Ga0157370_100107472 | 317 |
| 5 | 3300005354 | Ga0070675_100148465 | Ga0070675_1001484652 | 318 |
| 6 | 3300005578 | Ga0068854_100431370 | Ga0068854_1004313702 | 318 |
| 7 | 3300005616 | Ga0068852_100130199 | Ga0068852_1001301992 | 318 |
| 8 | 3300005719 | Ga0068861_100030703 | Ga0068861_1000307033 | 318 |
| 9 | 3300006881 | Ga0068865_100150017 | Ga0068865_1001500172 | 318 |
| 10 | 3300013306 | Ga0163162_10018183 | Ga0163162_100181835 | 318 |
| 11 | 3300013308 | Ga0157375_10118875 | Ga0157375_101188752 | 318 |
| 12 | 3300014745 | Ga0157377_10006235 | Ga0157377_100062352 | 318 |
| 13 | 3300025942 | Ga0207689_10045846 | Ga0207689_100458462 | 318 |
| 14 | 3300026142 | Ga0207698_10136695 | Ga0207698_101366952 | 318 |
| 15 | 3300005618 | Ga0068864_100152804 | Ga0068864_1001528042 | 319 |
| 16 | 3300042876 | Ga0451577_0007717 | Ga0451577_0007717_839_1816 | 324 |
| 17 | 3300005336 | Ga0070680_100175077 | Ga0070680_1001750772 | 326 |
| 18 | 3300005458 | Ga0070681_10200041 | Ga0070681_102000412 | 326 |
| 19 | 3300013100 | Ga0157373_10075894 | Ga0157373_100758942 | 326 |
| 20 | 3300013105 | Ga0157369_10082868 | Ga0157369_100828682 | 326 |
| 21 | 3300025912 | Ga0207707_10093808 | Ga0207707_100938082 | 326 |
| 22 | 3300025917 | Ga0207660_10067399 | Ga0207660_100673991 | 326 |
| 23 | 3300025921 | Ga0207652_10151546 | Ga0207652_101515461 | 326 |
| 24 | 3300026041 | Ga0207639_10480364 | Ga0207639_104803642 | 326 |
| 25 | 3300005290 | Ga0065712_10121900 | Ga0065712_101219002 | 327 |
| 26 | 3300005329 | Ga0070683_100001339 | Ga0070683_1000013395 | 327 |
| 27 | 3300005338 | Ga0068868_100028108 | Ga0068868_1000281081 | 327 |
| 28 | 3300005340 | Ga0070689_100003634 | Ga0070689_1000036344 | 327 |
| 29 | 3300005344 | Ga0070661_100026739 | Ga0070661_1000267392 | 327 |
| 30 | 3300005365 | Ga0070688_100012343 | Ga0070688_1000123432 | 327 |
| 31 | 3300005367 | Ga0070667_100095572 | Ga0070667_1000955722 | 327 |
| 32 | 3300005457 | Ga0070662_100298133 | Ga0070662_1002981332 | 327 |
| 33 | 3300005535 | Ga0070684_100011128 | Ga0070684_1000111285 | 327 |
| 34 | 3300005548 | Ga0070665_100048610 | Ga0070665_1000486103 | 327 |
| 35 | 3300005564 | Ga0070664_100010920 | Ga0070664_1000109202 | 327 |
| 36 | 3300005577 | Ga0068857_100093315 | Ga0068857_1000933152 | 327 |
| 37 | 3300005617 | Ga0068859_100010937 | Ga0068859_1000109375 | 327 |
| 38 | 3300005618 | Ga0068864_100006021 | Ga0068864_1000060215 | 327 |
| 39 | 3300005842 | Ga0068858_100202700 | Ga0068858_1002027002 | 327 |
| 40 | 3300006931 | Ga0097620_100010937 | Ga0097620_1000109375 | 327 |
| 41 | 3300013296 | Ga0157374_10001062 | Ga0157374_100010629 | 327 |
| 42 | 3300013306 | Ga0163162_10053893 | Ga0163162_100538932 | 327 |
| 43 | 3300013308 | Ga0157375_10005920 | Ga0157375_100059207 | 327 |
| 44 | 3300014325 | Ga0163163_10000469 | Ga0163163_100004698 | 327 |
| 45 | 3300014745 | Ga0157377_10013072 | Ga0157377_100130723 | 327 |
| 46 | 3300014968 | Ga0157379_10183713 | Ga0157379_101837132 | 327 |
| 47 | 3300025920 | Ga0207649_10010366 | Ga0207649_100103665 | 327 |
| 48 | 3300025933 | Ga0207706_10089914 | Ga0207706_100899142 | 327 |
| 49 | 3300025940 | Ga0207691_10017140 | Ga0207691_100171402 | 327 |
| 50 | 3300025942 | Ga0207689_10001618 | Ga0207689_1000161814 | 327 |
| 51 | 3300025944 | Ga0207661_10019270 | Ga0207661_100192702 | 327 |
| 52 | 3300025945 | Ga0207679_10001624 | Ga0207679_1000162411 | 327 |
| 53 | 3300025986 | Ga0207658_10094962 | Ga0207658_100949622 | 327 |
| 54 | 3300026116 | Ga0207674_10019936 | Ga0207674_100199362 | 327 |
| 55 | 3300031730 | Ga0307516_10119608 | Ga0307516_101196083 | 327 |
| 56 | 3300048913 | Ga0496110_0211499 | Ga0496110_0211499_716_1699 | 327 |
| 57 | 3300013307 | Ga0157372_10110396 | Ga0157372_101103962 | 328 |
| 58 | 3300013307 | Ga0157372_10348102 | Ga0157372_103481021 | 328 |
| 59 | 3300032126 | Ga0307415_100129631 | Ga0307415_1001296311 | 328 |
| 60 | 3300037418 | Ga0395900_0083312 | Ga0395900_0083312_298_1284 | 328 |
| 61 | 3300037471 | Ga0395905_0012891 | Ga0395905_0012891_921_1907 | 328 |
| 62 | 3300037471 | Ga0395905_0226416 | Ga0395905_0226416_736_1722 | 328 |
| 63 | 3300042876 | Ga0451577_0000300 | Ga0451577_0000300_27981_28970 | 328 |
| 64 | 3300044712 | Ga0453684_0000033 | Ga0453684_0000033_597392_598381 | 328 |
| 65 | 3300003323 | rootH1_10253689 | rootH1_102536891 | 329 |
| 66 | 3300005289 | Ga0065704_10087140 | Ga0065704_100871402 | 329 |
| 67 | 3300005289 | Ga0065704_10178288 | Ga0065704_101782882 | 329 |
| 68 | 3300005290 | Ga0065712_10001142 | Ga0065712_100011427 | 329 |
| 69 | 3300005290 | Ga0065712_10073409 | Ga0065712_100734094 | 329 |
| 70 | 3300005290 | Ga0065712_10100196 | Ga0065712_101001961 | 329 |
| 71 | 3300005329 | Ga0070683_100000238 | Ga0070683_10000023828 | 329 |
| 72 | 3300005329 | Ga0070683_100028987 | Ga0070683_1000289874 | 329 |
| 73 | 3300005330 | Ga0070690_100011848 | Ga0070690_1000118484 | 329 |
| 74 | 3300005331 | Ga0070670_100270402 | Ga0070670_1002704022 | 329 |
| 75 | 3300005334 | Ga0068869_100220749 | Ga0068869_1002207492 | 329 |
| 76 | 3300005335 | Ga0070666_10131103 | Ga0070666_101311032 | 329 |
| 77 | 3300005335 | Ga0070666_10213538 | Ga0070666_102135382 | 329 |
| 78 | 3300005340 | Ga0070689_100047060 | Ga0070689_1000470602 | 329 |
| 79 | 3300005340 | Ga0070689_100088572 | Ga0070689_1000885722 | 329 |
| 80 | 3300005343 | Ga0070687_100020777 | Ga0070687_1000207772 | 329 |
| 81 | 3300005343 | Ga0070687_100165322 | Ga0070687_1001653221 | 329 |
| 82 | 3300005344 | Ga0070661_100001444 | Ga0070661_10000144416 | 329 |
| 83 | 3300005353 | Ga0070669_100058318 | Ga0070669_1000583182 | 329 |
| 84 | 3300005353 | Ga0070669_100114737 | Ga0070669_1001147372 | 329 |
| 85 | 3300005355 | Ga0070671_100039165 | Ga0070671_1000391652 | 329 |
| 86 | 3300005365 | Ga0070688_100349152 | Ga0070688_1003491521 | 329 |
| 87 | 3300005366 | Ga0070659_100040117 | Ga0070659_1000401172 | 329 |
| 88 | 3300005438 | Ga0070701_10037643 | Ga0070701_100376432 | 329 |
| 89 | 3300005457 | Ga0070662_100152175 | Ga0070662_1001521752 | 329 |
| 90 | 3300005466 | Ga0070685_10098466 | Ga0070685_100984662 | 329 |
| 91 | 3300005471 | Ga0070698_100002551 | Ga0070698_1000025513 | 329 |
| 92 | 3300005471 | Ga0070698_100054905 | Ga0070698_1000549052 | 329 |
| 93 | 3300005471 | Ga0070698_100082947 | Ga0070698_1000829472 | 329 |
| 94 | 3300005518 | Ga0070699_100225349 | Ga0070699_1002253491 | 329 |
| 95 | 3300005518 | Ga0070699_100237942 | Ga0070699_1002379422 | 329 |
| 96 | 3300005530 | Ga0070679_100001653 | Ga0070679_1000016535 | 329 |
| 97 | 3300005535 | Ga0070684_100001043 | Ga0070684_1000010439 | 329 |
| 98 | 3300005535 | Ga0070684_100017077 | Ga0070684_1000170774 | 329 |
| 99 | 3300005539 | Ga0068853_100002759 | Ga0068853_1000027598 | 329 |
| 100 | 3300005543 | Ga0070672_100066984 | Ga0070672_1000669842 | 329 |
| 101 | 3300005548 | Ga0070665_100357294 | Ga0070665_1003572942 | 329 |
| 102 | 3300005564 | Ga0070664_100001070 | Ga0070664_10000107014 | 329 |
| 103 | 3300005564 | Ga0070664_100002432 | Ga0070664_10000243211 | 329 |
| 104 | 3300005564 | Ga0070664_100092957 | Ga0070664_1000929572 | 329 |
| 105 | 3300005577 | Ga0068857_100002814 | Ga0068857_10000281410 | 329 |
| 106 | 3300005577 | Ga0068857_100263104 | Ga0068857_1002631042 | 329 |
| 107 | 3300005578 | Ga0068854_100180829 | Ga0068854_1001808292 | 329 |
| 108 | 3300005616 | Ga0068852_100115973 | Ga0068852_1001159732 | 329 |
| 109 | 3300005616 | Ga0068852_100347256 | Ga0068852_1003472562 | 329 |
| 110 | 3300005617 | Ga0068859_100075496 | Ga0068859_1000754962 | 329 |
| 111 | 3300005617 | Ga0068859_100098429 | Ga0068859_1000984293 | 329 |
| 112 | 3300005617 | Ga0068859_100349792 | Ga0068859_1003497922 | 329 |
| 113 | 3300005618 | Ga0068864_100320813 | Ga0068864_1003208132 | 329 |
| 114 | 3300005618 | Ga0068864_100370818 | Ga0068864_1003708181 | 329 |
| 115 | 3300005719 | Ga0068861_100005573 | Ga0068861_1000055735 | 329 |
| 116 | 3300005834 | Ga0068851_10057517 | Ga0068851_100575172 | 329 |
| 117 | 3300005834 | Ga0068851_10139607 | Ga0068851_101396071 | 329 |
| 118 | 3300005841 | Ga0068863_100015583 | Ga0068863_1000155836 | 329 |
| 119 | 3300005841 | Ga0068863_100034709 | Ga0068863_1000347093 | 329 |
| 120 | 3300005841 | Ga0068863_100131334 | Ga0068863_1001313342 | 329 |
| 121 | 3300005841 | Ga0068863_100431463 | Ga0068863_1004314631 | 329 |
| 122 | 3300005842 | Ga0068858_100066609 | Ga0068858_1000666091 | 329 |
| 123 | 3300005844 | Ga0068862_100011917 | Ga0068862_1000119177 | 329 |
| 124 | 3300005985 | Ga0081539_10020611 | Ga0081539_100206114 | 329 |
| 125 | 3300006237 | Ga0097621_100055650 | Ga0097621_1000556502 | 329 |
| 126 | 3300006358 | Ga0068871_100023531 | Ga0068871_1000235313 | 329 |
| 127 | 3300006358 | Ga0068871_100214608 | Ga0068871_1002146082 | 329 |
| 128 | 3300006844 | Ga0075428_100043190 | Ga0075428_1000431901 | 329 |
| 129 | 3300006844 | Ga0075428_100289655 | Ga0075428_1002896552 | 329 |
| 130 | 3300006846 | Ga0075430_100003574 | Ga0075430_1000035746 | 329 |
| 131 | 3300006847 | Ga0075431_100032249 | Ga0075431_1000322493 | 329 |
| 132 | 3300006847 | Ga0075431_100400724 | Ga0075431_1004007242 | 329 |
| 133 | 3300006880 | Ga0075429_100001495 | Ga0075429_1000014952 | 329 |
| 134 | 3300006880 | Ga0075429_100086385 | Ga0075429_1000863852 | 329 |
| 135 | 3300006931 | Ga0097620_100075499 | Ga0097620_1000754992 | 329 |
| 136 | 3300006931 | Ga0097620_100098427 | Ga0097620_1000984273 | 329 |
| 137 | 3300006931 | Ga0097620_100349798 | Ga0097620_1003497982 | 329 |
| 138 | 3300009147 | Ga0114129_10915237 | Ga0114129_109152371 | 329 |
| 139 | 3300009148 | Ga0105243_10072457 | Ga0105243_100724573 | 329 |
| 140 | 3300009176 | Ga0105242_10104883 | Ga0105242_101048832 | 329 |
| 141 | 3300009553 | Ga0105249_10002194 | Ga0105249_1000219411 | 329 |
| 142 | 3300009553 | Ga0105249_10007108 | Ga0105249_100071084 | 329 |
| 143 | 3300009553 | Ga0105249_10138984 | Ga0105249_101389842 | 329 |
| 144 | 3300009553 | Ga0105249_10206155 | Ga0105249_102061552 | 329 |
| 145 | 3300010375 | Ga0105239_10032927 | Ga0105239_100329272 | 329 |
| 146 | 3300013100 | Ga0157373_10022753 | Ga0157373_100227535 | 329 |
| 147 | 3300013100 | Ga0157373_10231410 | Ga0157373_102314102 | 329 |
| 148 | 3300013105 | Ga0157369_10402346 | Ga0157369_104023462 | 329 |
| 149 | 3300013296 | Ga0157374_10055724 | Ga0157374_100557242 | 329 |
| 150 | 3300013297 | Ga0157378_10110632 | Ga0157378_101106322 | 329 |
| 151 | 3300013297 | Ga0157378_10445932 | Ga0157378_104459321 | 329 |
| 152 | 3300013306 | Ga0163162_10099864 | Ga0163162_100998641 | 329 |
| 153 | 3300013306 | Ga0163162_10412328 | Ga0163162_104123282 | 329 |
| 154 | 3300013307 | Ga0157372_10108559 | Ga0157372_101085592 | 329 |
| 155 | 3300013308 | Ga0157375_10104331 | Ga0157375_101043312 | 329 |
| 156 | 3300013308 | Ga0157375_10138982 | Ga0157375_101389822 | 329 |
| 157 | 3300013308 | Ga0157375_10291785 | Ga0157375_102917852 | 329 |
| 158 | 3300013308 | Ga0157375_10508678 | Ga0157375_105086781 | 329 |
| 159 | 3300014325 | Ga0163163_10127725 | Ga0163163_101277252 | 329 |
| 160 | 3300014325 | Ga0163163_10128002 | Ga0163163_101280022 | 329 |
| 161 | 3300014326 | Ga0157380_10216550 | Ga0157380_102165502 | 329 |
| 162 | 3300014745 | Ga0157377_10222392 | Ga0157377_102223921 | 329 |
| 163 | 3300014968 | Ga0157379_10090451 | Ga0157379_100904512 | 329 |
| 164 | 3300014968 | Ga0157379_10148193 | Ga0157379_101481932 | 329 |
| 165 | 3300014968 | Ga0157379_10203589 | Ga0157379_102035892 | 329 |
| 166 | 3300014969 | Ga0157376_10137002 | Ga0157376_101370022 | 329 |
| 167 | 3300014969 | Ga0157376_10479418 | Ga0157376_104794181 | 329 |
| 168 | 3300025908 | Ga0207643_10022376 | Ga0207643_100223761 | 329 |
| 169 | 3300025909 | Ga0207705_10012360 | Ga0207705_100123602 | 329 |
| 170 | 3300025912 | Ga0207707_10153998 | Ga0207707_101539982 | 329 |
| 171 | 3300025913 | Ga0207695_10018560 | Ga0207695_100185608 | 329 |
| 172 | 3300025914 | Ga0207671_10179775 | Ga0207671_101797752 | 329 |
| 173 | 3300025918 | Ga0207662_10093466 | Ga0207662_100934662 | 329 |
| 174 | 3300025918 | Ga0207662_10172497 | Ga0207662_101724972 | 329 |
| 175 | 3300025919 | Ga0207657_10102031 | Ga0207657_101020312 | 329 |
| 176 | 3300025920 | Ga0207649_10008373 | Ga0207649_100083735 | 329 |
| 177 | 3300025921 | Ga0207652_10000739 | Ga0207652_100007393 | 329 |
| 178 | 3300025923 | Ga0207681_10252327 | Ga0207681_102523271 | 329 |
| 179 | 3300025925 | Ga0207650_10018482 | Ga0207650_100184824 | 329 |
| 180 | 3300025925 | Ga0207650_10075442 | Ga0207650_100754422 | 329 |
| 181 | 3300025926 | Ga0207659_10009382 | Ga0207659_100093825 | 329 |
| 182 | 3300025931 | Ga0207644_10037932 | Ga0207644_100379323 | 329 |
| 183 | 3300025931 | Ga0207644_10170584 | Ga0207644_101705842 | 329 |
| 184 | 3300025933 | Ga0207706_10151312 | Ga0207706_101513122 | 329 |
| 185 | 3300025934 | Ga0207686_10027288 | Ga0207686_100272883 | 329 |
| 186 | 3300025934 | Ga0207686_10061672 | Ga0207686_100616722 | 329 |
| 187 | 3300025935 | Ga0207709_10043170 | Ga0207709_100431703 | 329 |
| 188 | 3300025936 | Ga0207670_10008154 | Ga0207670_100081545 | 329 |
| 189 | 3300025940 | Ga0207691_10079702 | Ga0207691_100797022 | 329 |
| 190 | 3300025942 | Ga0207689_10035210 | Ga0207689_100352102 | 329 |
| 191 | 3300025942 | Ga0207689_10199754 | Ga0207689_101997542 | 329 |
| 192 | 3300025942 | Ga0207689_10226582 | Ga0207689_102265822 | 329 |
| 193 | 3300025944 | Ga0207661_10013332 | Ga0207661_100133323 | 329 |
| 194 | 3300025945 | Ga0207679_10000296 | Ga0207679_1000029624 | 329 |
| 195 | 3300025960 | Ga0207651_10014151 | Ga0207651_100141512 | 329 |
| 196 | 3300025960 | Ga0207651_10020452 | Ga0207651_100204522 | 329 |
| 197 | 3300025961 | Ga0207712_10005116 | Ga0207712_100051167 | 329 |
| 198 | 3300025961 | Ga0207712_10007732 | Ga0207712_100077324 | 329 |
| 199 | 3300025961 | Ga0207712_10017873 | Ga0207712_100178732 | 329 |
| 200 | 3300025961 | Ga0207712_10155379 | Ga0207712_101553792 | 329 |
| 201 | 3300025961 | Ga0207712_10167170 | Ga0207712_101671702 | 329 |
| 202 | 3300026023 | Ga0207677_10054778 | Ga0207677_100547782 | 329 |
| 203 | 3300026041 | Ga0207639_10085243 | Ga0207639_100852432 | 329 |
| 204 | 3300026088 | Ga0207641_10000275 | Ga0207641_1000027515 | 329 |
| 205 | 3300026088 | Ga0207641_10015260 | Ga0207641_100152605 | 329 |
| 206 | 3300026088 | Ga0207641_10024800 | Ga0207641_100248004 | 329 |
| 207 | 3300026088 | Ga0207641_10375492 | Ga0207641_103754922 | 329 |
| 208 | 3300026089 | Ga0207648_10093197 | Ga0207648_100931972 | 329 |
| 209 | 3300026095 | Ga0207676_10053714 | Ga0207676_100537142 | 329 |
| 210 | 3300026095 | Ga0207676_10101164 | Ga0207676_101011642 | 329 |
| 211 | 3300026116 | Ga0207674_10000294 | Ga0207674_1000029431 | 329 |
| 212 | 3300026116 | Ga0207674_10058449 | Ga0207674_100584492 | 329 |
| 213 | 3300026118 | Ga0207675_100009364 | Ga0207675_1000093645 | 329 |
| 214 | 3300026118 | Ga0207675_100084985 | Ga0207675_1000849852 | 329 |
| 215 | 3300026118 | Ga0207675_100320716 | Ga0207675_1003207162 | 329 |
| 216 | 3300026121 | Ga0207683_10186641 | Ga0207683_101866412 | 329 |
| 217 | 3300026121 | Ga0207683_10355302 | Ga0207683_103553021 | 329 |
| 218 | 3300026142 | Ga0207698_10115009 | Ga0207698_101150092 | 329 |
| 219 | 3300026142 | Ga0207698_10267688 | Ga0207698_102676882 | 329 |
| 220 | 3300028379 | Ga0268266_10167685 | Ga0268266_101676852 | 329 |
| 221 | 3300028380 | Ga0268265_10098295 | Ga0268265_100982952 | 329 |
| 222 | 3300028380 | Ga0268265_10179838 | Ga0268265_101798382 | 329 |
| 223 | 3300031251 | Ga0265327_10012633 | Ga0265327_100126334 | 329 |
| 224 | 3300031852 | Ga0307410_10195497 | Ga0307410_101954972 | 329 |
| 225 | 3300031911 | Ga0307412_10308900 | Ga0307412_103089002 | 329 |
| 226 | 3300037068 | Ga0373925_0070647 | Ga0373925_0070647_126_1115 | 329 |
| 227 | 3300039437 | Ga0436365_1642374 | Ga0436365_1642374_35245_36240 | 329 |
| 228 | 3300042001 | Ga0439441_009860 | Ga0439441_009860_373_1365 | 329 |
| 229 | 3300042134 | Ga0450898_021046 | Ga0450898_021046_47_1036 | 329 |
| 230 | 3300042436 | Ga0439435_0038342 | Ga0439435_0038342_171_1160 | 329 |
| 231 | 3300042461 | Ga0439460_0054133 | Ga0439460_0054133_86_1075 | 329 |
| 232 | 3300046522 | Ga0495643_0036656 | Ga0495643_0036656_477_1514 | 329 |
| 233 | 3300048913 | Ga0496110_0426348 | Ga0496110_0426348_133_1149 | 329 |
| 234 | 3300049569 | Ga0501032_0005855 | Ga0501032_0005855_2468_3457 | 329 |
| 235 | 3300049571 | Ga0501034_0131232 | Ga0501034_0131232_396_1385 | 329 |
| 236 | 3300049572 | Ga0501036_0170720 | Ga0501036_0170720_129_1118 | 329 |
| 237 | 3300049573 | Ga0501037_0110536 | Ga0501037_0110536_294_1283 | 329 |
| 238 | 3300049580 | Ga0501046_0037362 | Ga0501046_0037362_1388_2377 | 329 |
| 239 | 3300049581 | Ga0501047_0123586 | Ga0501047_0123586_1388_2377 | 329 |
| 240 | 3300049582 | Ga0501048_0115653 | Ga0501048_0115653_586_1575 | 329 |
| 241 | 3300049583 | Ga0501067_0060021 | Ga0501067_0060021_379_1368 | 329 |
| 242 | 3300049584 | Ga0501068_0124091 | Ga0501068_0124091_418_1407 | 329 |
| 243 | 3300049586 | Ga0501070_0094035 | Ga0501070_0094035_801_1790 | 329 |
| 244 | 3300049589 | Ga0501073_0049240 | Ga0501073_0049240_1395_2384 | 329 |
| 245 | 3300049590 | Ga0501074_0025706 | Ga0501074_0025706_145_1134 | 329 |
| 246 | 3300049652 | Ga0501202_019381 | Ga0501202_019381_64_1053 | 329 |
| 247 | 3300049741 | Ga0501079_0044081 | Ga0501079_0044081_241_1230 | 329 |
| 248 | 3300049822 | Ga0501035_0080971 | Ga0501035_0080971_230_1219 | 329 |
| 249 | 3300049823 | Ga0501044_0174193 | Ga0501044_0174193_725_1714 | 329 |
| 250 | 3300050493 | nmdc:mga0k408_16172_c1 | nmdc:mga0k408_16172_c1_258_1247 | 329 |
| 251 | 3300050508 | nmdc:mga09592_268185_c1 | nmdc:mga09592_268185_c1_377_1369 | 329 |
| 252 | 3300050508 | nmdc:mga09592_87252_c1 | nmdc:mga09592_87252_c1_1470_2459 | 329 |
| 253 | 3300050509 | nmdc:mga0qj67_39472_c1 | nmdc:mga0qj67_39472_c1_1784_2773 | 329 |
| 254 | 3300050510 | nmdc:mga06r32_438012_c1 | nmdc:mga06r32_438012_c1_264_1256 | 329 |
| 255 | 3300050510 | nmdc:mga06r32_98534_c1 | nmdc:mga06r32_98534_c1_825_1814 | 329 |
| 256 | 3300050511 | nmdc:mga08y16_442496_c1 | nmdc:mga08y16_442496_c1_28_1017 | 329 |
| 257 | 3300050511 | nmdc:mga08y16_85245_c1 | nmdc:mga08y16_85245_c1_402_1391 | 329 |
| 258 | 3300050512 | nmdc:mga0n895_579451_c1 | nmdc:mga0n895_579451_c1_94_1086 | 329 |
| 259 | 3300053153 | Ga0500616_0077009 | Ga0500616_0077009_624_1613 | 329 |
| 260 | 3300053727 | Ga0500611_000004 | Ga0500611_000004_147891_148880 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ynq-assembly2.cif.gz_B | aldo-keto reductase akr11c1 from bacillus halodurans (holo form) | 0.8869 | 1 | 313 |
| 4exa-assembly1.cif.gz_A | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8834 | 3 | 296 |
| 4exa-assembly2.cif.gz_C | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8692 | 3 | 296 |
| 4exa-assembly2.cif.gz_F | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8663 | 3 | 296 |
| 4exb-assembly2.cif.gz_C | putative aldo-keto reductase from pseudomona aeruginosa | 0.8654 | 3 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ynpB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8884 | 1 | 313 | 3.20.20.100 |
| 1ynpB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8766 | 1 | 313 | 3.20.20.100 |
| af_Q2G0G6_3_309_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8758 | 2 | 313 | 3.20.20.100 |
| af_A0A0P0W8U8_11_146_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8695 | 1 | 132 | 3.20.20.100 |
| af_Q2G0G6_3_309_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8678 | 2 | 313 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D2TJT7-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9857 | 1 | 329 |
|
| AF-A0A1D2TJT7-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9827 | 1 | 329 |
|
| AF-A0A3N5PV67-F1-model_v4 | Aldo/keto reductase | 0.9797 | 1 | 286 |
|
| AF-A0A7J4VDR0-F1-model_v4 | Aldo/keto reductase | 0.9778 | 27 | 329 |
|
| AF-A0A3D4TB24-F1-model_v4 | Aldo/keto reductase | 0.9762 | 1 | 221 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar