F369186

General Info

Members Datasets Scaffolds Average Seq Length
259 197 518 355

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738543027|2739325421
Length 398
Sequence LPADADPATLPADADPATRPDAATATAAATAAATDADADATADPAVAARRTFHTLTVTDVEQLTDDAAAVTFGLPAGLRDVFDFAAGQSLTLRRTIDGVEHRRTYSICAPAGSAPRIGVREIPEGLFSSWLVREVRPGDQVEVQPPSGSFRADPAEGGRHLCIAAGSGITPMLSIVSTVLGNPDAQVTLLYGNRTTSSVMFAEELADLKDAHHGQLDLVHVLSREPRDVELFSGRLDGERLRELLTRVVPVGDMDHVWLCGPFGMLTEARAVLDELGVPAGRVHFELFWVDAPPPELRHADRVVEGATSEVTVILDGRSTTTAMPQDKRLLDAAQEVRADLPFACKGGVCGTCRAKVRAGEVDMVRNYALEPEEVAAGFVLTCQTFPVSDEVVVDYDA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
115 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
178 2643221576 Nocardioides sp. Root614 Isolate Unclassified
179 2643221590 Nocardioides sp. Root682 Isolate Unclassified
180 2643221604 Nocardioides sp. Root190 Isolate Unclassified
181 2643221617 Nocardioides sp. Root79 Isolate Unclassified
182 2643221620 Nocardioides sp. Root240 Isolate Unclassified
183 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
184 2643221641 Nocardioides sp. Root122 Isolate Unclassified
185 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
186 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
187 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
188 2739367898 Nocardioides sp. CF479 Isolate Unclassified
189 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
190 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
191 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
192 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
193 2919395869 Microbacterium resistens 2980 Isolate Unclassified
194 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
195 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
196 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
197 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 0.77
Isolates 8.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 0.39
Rhizoplane 5.02
Rhizosphere 72.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10109203 3300003322 Bacteria 2593
2 Ga0070658_10324350 3300005327 Bacteria 1315
3 Ga0070683_100244818 3300005329 Bacteria 1705
4 Ga0070690_100137033 3300005330 Bacteria 1658
5 Ga0070670_100094156 3300005331 Bacteria 2576
6 Ga0068869_100002817 3300005334 Bacteria 10541
7 Ga0070666_10183828 3300005335 Bacteria 1467
8 Ga0070680_100002469 3300005336 Bacteria 13703
9 Ga0070682_100087295 3300005337 Bacteria 2033
10 Ga0070682_100166475 3300005337 Bacteria 1528
11 Ga0068868_100070439 3300005338 Bacteria 2788
12 Ga0070691_10020231 3300005341 Bacteria 3074
13 Ga0070692_10001390 3300005345 Bacteria 8755
14 Ga0070692_10003361 3300005345 Bacteria 6478
15 Ga0070675_100079430 3300005354 Bacteria 2733
16 Ga0070674_100010297 3300005356 Bacteria 5647
17 Ga0070673_100044095 3300005364 Bacteria 3451
18 Ga0070709_10008241 3300005434 Bacteria 5724
19 Ga0070714_100019643 3300005435 Bacteria 5509
20 Ga0070713_100010732 3300005436 Bacteria 6633
21 Ga0070710_10000505 3300005437 Bacteria 18330
22 Ga0070710_10000522 3300005437 Bacteria 18074
23 Ga0070701_10004802 3300005438 Bacteria 5525
24 Ga0070711_100023682 3300005439 Bacteria 3997
25 Ga0070700_100001852 3300005441 Bacteria 10666
26 Ga0070663_100040877 3300005455 Bacteria 3249
27 Ga0070663_100248213 3300005455 Bacteria 1408
28 Ga0070678_100037908 3300005456 Bacteria 3389
29 Ga0070678_100210709 3300005456 Bacteria 1610
30 Ga0068867_100041084 3300005459 Bacteria 3379
31 Ga0070707_100021032 3300005468 Bacteria 6162
32 Ga0070698_100006706 3300005471 Bacteria 12489
33 Ga0068853_100048692 3300005539 Bacteria 3641
34 Ga0068853_100056590 3300005539 Bacteria 3383
35 Ga0070672_100064903 3300005543 Bacteria 2886
36 Ga0070693_100019282 3300005547 Bacteria 3572
37 Ga0070665_100127075 3300005548 Bacteria 2552
38 Ga0070664_100139094 3300005564 Bacteria 2137
39 Ga0068854_100064956 3300005578 Bacteria 2652
40 Ga0068856_100008868 3300005614 Bacteria 9788
41 Ga0070702_100002114 3300005615 Bacteria 8435
42 Ga0070702_100048498 3300005615 Bacteria 2418
43 Ga0068852_100042176 3300005616 Bacteria 3861
44 Ga0068859_100076158 3300005617 Bacteria 3395
45 Ga0068864_100108506 3300005618 Bacteria 2470
46 Ga0068861_100019920 3300005719 Bacteria 4796
47 Ga0068861_100358536 3300005719 Bacteria 1282
48 Ga0068851_10011534 3300005834 Bacteria 4146
49 Ga0068863_100132989 3300005841 Bacteria 2375
50 Ga0068860_100169267 3300005843 Bacteria 2110
51 Ga0070717_10232327 3300006028 Bacteria 1624
52 Ga0075365_10022051 3300006038 Bacteria 3983
53 Ga0075365_10041862 3300006038 Bacteria 2993
54 Ga0075365_10111863 3300006038 Bacteria 1877
55 Ga0075365_10229172 3300006038 Bacteria 1304
56 Ga0075368_10006006 3300006042 Bacteria 4213
57 Ga0075363_100030150 3300006048 Bacteria 2806
58 Ga0075363_100086321 3300006048 Bacteria 1723
59 Ga0075364_10002985 3300006051 Bacteria 9554
60 Ga0075364_10019108 3300006051 Bacteria 4299
61 Ga0075364_10027261 3300006051 Bacteria 3648
62 Ga0075364_10032462 3300006051 Bacteria 3357
63 Ga0075364_10077493 3300006051 Bacteria 2194
64 Ga0075362_10003720 3300006177 Bacteria 5392
65 Ga0075370_10001931 3300006353 Bacteria 9351
66 Ga0075370_10048066 3300006353 Bacteria 2417
67 Ga0068871_100095805 3300006358 Bacteria 2479
68 Ga0075428_100081771 3300006844 Bacteria 3525
69 Ga0075433_10007995 3300006852 Bacteria 8418
70 Ga0075434_100013590 3300006871 Bacteria 7757
71 Ga0075429_100086127 3300006880 Bacteria 2739
72 Ga0075436_100006539 3300006914 Bacteria 7981
73 Ga0097620_100076163 3300006931 Bacteria 3395
74 Ga0075435_100067639 3300007076 Bacteria 2909
75 Ga0105245_10049734 3300009098 Bacteria 3755
76 Ga0114129_10138627 3300009147 Bacteria 3337
77 Ga0105243_10037818 3300009148 Bacteria 3755
78 Ga0105241_10019174 3300009174 Bacteria 5044
79 Ga0105242_10041040 3300009176 Bacteria 3730
80 Ga0105248_10074789 3300009177 Bacteria 3807
81 Ga0105238_10132931 3300009551 Bacteria 2467
82 Ga0105239_10184651 3300010375 Bacteria 2334
83 Ga0105246_10043915 3300011119 Bacteria 3035
84 Ga0157373_10023713 3300013100 Bacteria 4446
85 Ga0157370_10044722 3300013104 Bacteria 4253
86 Ga0157374_10021733 3300013296 Bacteria 5714
87 Ga0157372_10251226 3300013307 Bacteria 2053
88 Ga0163163_10160337 3300014325 Bacteria 2295
89 Ga0157377_10004864 3300014745 Bacteria 6246
90 Ga0206356_11065297 3300020070 Bacteria 2524
91 Ga0206353_11740109 3300020082 Bacteria 3804
92 Ga0209051_1021169 3300025303 Bacteria 2778
93 Ga0207656_10043691 3300025321 Bacteria 1911
94 Ga0207692_10000049 3300025898 Bacteria 35853
95 Ga0207692_10012201 3300025898 Bacteria 3684
96 Ga0207642_10064086 3300025899 Bacteria 1721
97 Ga0207699_10037428 3300025906 Bacteria 2774
98 Ga0207643_10000037 3300025908 Bacteria 89297
99 Ga0207643_10001162 3300025908 Bacteria 15647
100 Ga0207707_10005562 3300025912 Bacteria 11024
101 Ga0207662_10044205 3300025918 Bacteria 2629
102 Ga0207657_10009150 3300025919 Bacteria 9992
103 Ga0207657_10039653 3300025919 Bacteria 4183
104 Ga0207649_10096324 3300025920 Bacteria 1949
105 Ga0207650_10048323 3300025925 Bacteria 3138
106 Ga0207687_10239303 3300025927 Bacteria 1438
107 Ga0207700_10026886 3300025928 Bacteria 4020
108 Ga0207664_10030254 3300025929 Bacteria 4134
109 Ga0207706_10151180 3300025933 Bacteria 2042
110 Ga0207686_10150785 3300025934 Bacteria 1618
111 Ga0207709_10022711 3300025935 Bacteria 3562
112 Ga0207691_10000686 3300025940 Bacteria 33446
113 Ga0207691_10122079 3300025940 Bacteria 2308
114 Ga0207689_10005539 3300025942 Bacteria 11275
115 Ga0207661_10018743 3300025944 Bacteria 5147
116 Ga0207661_10052962 3300025944 Bacteria 3245
117 Ga0207661_10257848 3300025944 Bacteria 1552
118 Ga0207679_10008609 3300025945 Bacteria 6504
119 Ga0207667_10412640 3300025949 Bacteria 1374
120 Ga0207712_10017631 3300025961 Bacteria 4642
121 Ga0207640_10011869 3300025981 Bacteria 4946
122 Ga0207640_10049253 3300025981 Bacteria 2727
123 Ga0207658_10132807 3300025986 Bacteria 2003
124 Ga0207677_10020844 3300026023 Bacteria 3992
125 Ga0207677_10078924 3300026023 Bacteria 2352
126 Ga0207639_10247471 3300026041 Bacteria 1553
127 Ga0207678_10000085 3300026067 Bacteria 76854
128 Ga0207678_10138995 3300026067 Bacteria 2073
129 Ga0207708_10000075 3300026075 Bacteria 78540
130 Ga0207708_10112963 3300026075 Bacteria 2110
131 Ga0207702_10001239 3300026078 Bacteria 25818
132 Ga0207702_10030771 3300026078 Bacteria 4471
133 Ga0207641_10037792 3300026088 Bacteria 4034
134 Ga0207648_10065381 3300026089 Bacteria 3171
135 Ga0207676_10000476 3300026095 Bacteria 33717
136 Ga0207674_10131235 3300026116 Bacteria 2468
137 Ga0207675_100014243 3300026118 Bacteria 7412
138 Ga0207675_100356571 3300026118 Bacteria 1434
139 Ga0207683_10000055 3300026121 Bacteria 84901
140 Ga0207683_10063498 3300026121 Bacteria 3253
141 Ga0209813_10009695 3300027866 Bacteria 2472
142 Ga0207428_10027993 3300027907 Bacteria 4686
143 Ga0268264_10020492 3300028381 Bacteria 5403
144 Ga0316177_1218091 3300030731 Bacteria 2401
145 Ga0314311_1072211 3300030733 Bacteria 1904
146 Ga0307513_10001658 3300031456 Bacteria 31815
147 Ga0316583_10022057 3300032133 Bacteria 2282
148 Ga0395900_0028990 3300037418 Bacteria 5676
149 Ga0395901_0233813 3300038443 Bacteria 1918
150 Ga0400483_103552 3300039062 Bacteria 4721
151 Ga0451793_0200154 3300041452 Bacteria 5578
152 Ga0451806_254795 3300041462 Bacteria 1458
153 Ga0451837_1401291 3300041494 Bacteria 3213
154 Ga0439463_029111 3300042016 Bacteria 1392
155 Ga0466965_0005285 3300044683 Bacteria 5808
156 Ga0466965_0009172 3300044683 Bacteria 4596
157 Ga0466965_0019230 3300044683 Bacteria 3280
158 Ga0466965_0024111 3300044683 Bacteria 2942
159 Ga0466966_0036003 3300044684 Bacteria 3197
160 Ga0466966_0111762 3300044684 Bacteria 1684
161 Ga0466963_0179575 3300044694 Bacteria 1477
162 Ga0466970_0064367 3300044765 Bacteria 1966
163 Ga0466957_0224315 3300044842 Bacteria 1242
164 Ga0466960_0023405 3300044901 Bacteria 2774
165 Ga0466960_0057782 3300044901 Bacteria 1893
166 Ga0466959_0116929 3300045049 Bacteria 1898
167 Ga0466967_0127670 3300045976 Bacteria 2357
168 Ga0466967_0155111 3300045976 Bacteria 2144
169 Ga0496102_0070904 3300048905 Bacteria 3200
170 Ga0496102_0321603 3300048905 Bacteria 1457
171 Ga0496104_0005567 3300048907 Bacteria 11028
172 Ga0496105_0014711 3300048908 Bacteria 6229
173 Ga0496107_0068325 3300048910 Bacteria 2579
174 Ga0496108_0103130 3300048911 Bacteria 2434
175 Ga0496108_0288826 3300048911 Bacteria 1428
176 Ga0496110_0022151 3300048913 Bacteria 5391
177 Ga0496112_0151081 3300048915 Bacteria 2289
178 Ga0496114_0005606 3300048917 Bacteria 9844
179 Ga0496114_0061512 3300048917 Bacteria 3141
180 Ga0501034_0032660 3300049571 Bacteria 5285
181 Ga0501036_0003073 3300049572 Bacteria 13310
182 Ga0501036_0014204 3300049572 Bacteria 6625
183 Ga0501037_0017324 3300049573 Bacteria 5307
184 Ga0501037_0019269 3300049573 Bacteria 5030
185 Ga0501038_0006550 3300049574 Bacteria 10769
186 Ga0501038_0011522 3300049574 Bacteria 8067
187 Ga0501039_0028167 3300049575 Bacteria 4322
188 Ga0501039_0208861 3300049575 Bacteria 1535
189 Ga0501041_0105094 3300049577 Bacteria 1750
190 Ga0501042_0008461 3300049578 Bacteria 6794
191 Ga0501042_0051023 3300049578 Bacteria 2951
192 Ga0501043_0016199 3300049579 Bacteria 5847
193 Ga0501046_0018748 3300049580 Bacteria 5751
194 Ga0501046_0219889 3300049580 Bacteria 1407
195 Ga0501047_0009670 3300049581 Bacteria 9115
196 Ga0501047_0034758 3300049581 Bacteria 4866
197 Ga0501048_0008271 3300049582 Bacteria 7870
198 Ga0501048_0017435 3300049582 Bacteria 5288
199 Ga0501048_0131038 3300049582 Bacteria 1773
200 Ga0501068_0035848 3300049584 Bacteria 2963
201 Ga0501069_0056226 3300049585 Bacteria 2192
202 Ga0501070_0020850 3300049586 Bacteria 5498
203 Ga0501071_0204652 3300049587 Bacteria 1483
204 Ga0501072_0189797 3300049588 Bacteria 1639
205 Ga0501073_0026712 3300049589 Bacteria 4134
206 Ga0501074_0008664 3300049590 Bacteria 7367
207 Ga0501074_0034527 3300049590 Bacteria 3666
208 Ga0501074_0078461 3300049590 Bacteria 2370
209 Ga0501080_0031743 3300049742 Bacteria 4922
210 Ga0501035_0164013 3300049822 Bacteria 1922
211 Ga0501044_0020465 3300049823 Bacteria 7065
212 Ga0501044_0042917 3300049823 Bacteria 4700
213 nmdc:mga03n38_27463_c1 3300050490 Bacteria 2362
214 nmdc:mga00v17_150733_c1 3300050491 Bacteria 1494
215 nmdc:mga00v17_15534_c1 3300050491 Bacteria 4273
216 nmdc:mga00v17_6227_c1 3300050491 Bacteria 6327
217 nmdc:mga0yw44_18119_c2 3300050492 Bacteria 3509
218 nmdc:mga0yw44_22359_c1 3300050492 Bacteria 3546
219 nmdc:mga0yw44_28532_c1 3300050492 Bacteria 3211
220 nmdc:mga0yw44_36784_c1 3300050492 Bacteria 2887
221 nmdc:mga0yw44_461_c1 3300050492 Bacteria 14419
222 nmdc:mga06z11_29498_c1 3300050494 Bacteria 2644
223 nmdc:mga04h51_15400_c1 3300050495 Bacteria 2203
224 nmdc:mga04h51_55273_c1 3300050495 Bacteria 1344
225 nmdc:mga07m45_42420_c1 3300050496 Bacteria 2550
226 nmdc:mga07m45_5553_c1 3300050496 Bacteria 6290
227 nmdc:mga07m45_65266_c1 3300050496 Bacteria 2067
228 nmdc:mga05p37_127659_c1 3300050507 Bacteria 3122
229 nmdc:mga08y16_119144_c1 3300050511 Bacteria 2748
230 nmdc:mga08y16_261358_c1 3300050511 Bacteria 1788
231 nmdc:mga0n895_103766_c1 3300050512 Bacteria 2855
232 nmdc:mga08x19_37271_c1 3300050514 Bacteria 3085
233 nmdc:mga0a205_27135_c1 3300050515 Bacteria 5468
234 Ga0495619_0080762 3300053085 Bacteria 2189
235 Ga0500644_0000049 3300053088 Bacteria 72195
236 Ga0500573_0002950 3300053140 Bacteria 8678
237 Ga0590075_005642 3300059424 Bacteria 2957
238 2739325421 2738543027 Bacteria 6409078
239 2643892857 2643221576 Bacteria 5214352
240 2643962306 2643221590 Bacteria 5214697
241 2644031885 2643221604 Bacteria 5014917
242 2644102812 2643221617 Bacteria 5139111
243 2644118474 2643221620 Bacteria 5134593
244 2644138116 2643221624 Bacteria 4384879
245 2644230808 2643221641 Bacteria 4490190
246 2644491466 2643221687 Bacteria 6500351
247 2734972526 2734482000 Bacteria 5525167
248 2738696290 2738541272 Bacteria 6848551
249 2740167562 2739367898 Bacteria 4367674
250 2740169545 2739367898 Bacteria 4367674
251 2760303461 2758568522 Bacteria 5953541
252 2760623855 2758568621 Bacteria 5967089
253 2857485225 2857481737 Bacteria 4761446
254 2895434923 2895427314 Bacteria 13147766
255 2919396276 2919395869 Bacteria 3704152
256 2946025009 2946024296 Bacteria 3508095
257 3002999354 3002998708 Bacteria 11715108
258 8054613136 8054609563 Bacteria 5170090
259 8056582507 8056579771 Bacteria 5840325
260 rootL2_10109203
261 Ga0070658_10324350
262 Ga0070683_100244818
263 Ga0070690_100137033
264 Ga0070670_100094156
265 Ga0068869_100002817
266 Ga0070666_10183828
267 Ga0070680_100002469
268 Ga0070682_100087295
269 Ga0070682_100166475
270 Ga0068868_100070439
271 Ga0070691_10020231
272 Ga0070692_10001390
273 Ga0070692_10003361
274 Ga0070675_100079430
275 Ga0070674_100010297
276 Ga0070673_100044095
277 Ga0070709_10008241
278 Ga0070714_100019643
279 Ga0070713_100010732
280 Ga0070710_10000505
281 Ga0070710_10000522
282 Ga0070701_10004802
283 Ga0070711_100023682
284 Ga0070700_100001852
285 Ga0070663_100040877
286 Ga0070663_100248213
287 Ga0070678_100037908
288 Ga0070678_100210709
289 Ga0068867_100041084
290 Ga0070707_100021032
291 Ga0070698_100006706
292 Ga0068853_100048692
293 Ga0068853_100056590
294 Ga0070672_100064903
295 Ga0070693_100019282
296 Ga0070665_100127075
297 Ga0070664_100139094
298 Ga0068854_100064956
299 Ga0068856_100008868
300 Ga0070702_100002114
301 Ga0070702_100048498
302 Ga0068852_100042176
303 Ga0068859_100076158
304 Ga0068864_100108506
305 Ga0068861_100019920
306 Ga0068861_100358536
307 Ga0068851_10011534
308 Ga0068863_100132989
309 Ga0068860_100169267
310 Ga0070717_10232327
311 Ga0075365_10022051
312 Ga0075365_10041862
313 Ga0075365_10111863
314 Ga0075365_10229172
315 Ga0075368_10006006
316 Ga0075363_100030150
317 Ga0075363_100086321
318 Ga0075364_10002985
319 Ga0075364_10019108
320 Ga0075364_10027261
321 Ga0075364_10032462
322 Ga0075364_10077493
323 Ga0075362_10003720
324 Ga0075370_10001931
325 Ga0075370_10048066
326 Ga0068871_100095805
327 Ga0075428_100081771
328 Ga0075433_10007995
329 Ga0075434_100013590
330 Ga0075429_100086127
331 Ga0075436_100006539
332 Ga0097620_100076163
333 Ga0075435_100067639
334 Ga0105245_10049734
335 Ga0114129_10138627
336 Ga0105243_10037818
337 Ga0105241_10019174
338 Ga0105242_10041040
339 Ga0105248_10074789
340 Ga0105238_10132931
341 Ga0105239_10184651
342 Ga0105246_10043915
343 Ga0157373_10023713
344 Ga0157370_10044722
345 Ga0157374_10021733
346 Ga0157372_10251226
347 Ga0163163_10160337
348 Ga0157377_10004864
349 Ga0206356_11065297
350 Ga0206353_11740109
351 Ga0209051_1021169
352 Ga0207656_10043691
353 Ga0207692_10000049
354 Ga0207692_10012201
355 Ga0207642_10064086
356 Ga0207699_10037428
357 Ga0207643_10000037
358 Ga0207643_10001162
359 Ga0207707_10005562
360 Ga0207662_10044205
361 Ga0207657_10009150
362 Ga0207657_10039653
363 Ga0207649_10096324
364 Ga0207650_10048323
365 Ga0207687_10239303
366 Ga0207700_10026886
367 Ga0207664_10030254
368 Ga0207706_10151180
369 Ga0207686_10150785
370 Ga0207709_10022711
371 Ga0207691_10000686
372 Ga0207691_10122079
373 Ga0207689_10005539
374 Ga0207661_10018743
375 Ga0207661_10052962
376 Ga0207661_10257848
377 Ga0207679_10008609
378 Ga0207667_10412640
379 Ga0207712_10017631
380 Ga0207640_10011869
381 Ga0207640_10049253
382 Ga0207658_10132807
383 Ga0207677_10020844
384 Ga0207677_10078924
385 Ga0207639_10247471
386 Ga0207678_10000085
387 Ga0207678_10138995
388 Ga0207708_10000075
389 Ga0207708_10112963
390 Ga0207702_10001239
391 Ga0207702_10030771
392 Ga0207641_10037792
393 Ga0207648_10065381
394 Ga0207676_10000476
395 Ga0207674_10131235
396 Ga0207675_100014243
397 Ga0207675_100356571
398 Ga0207683_10000055
399 Ga0207683_10063498
400 Ga0209813_10009695
401 Ga0207428_10027993
402 Ga0268264_10020492
403 Ga0316177_1218091
404 Ga0314311_1072211
405 Ga0307513_10001658
406 Ga0316583_10022057
407 Ga0395900_0028990
408 Ga0395901_0233813
409 Ga0400483_103552
410 Ga0451793_0200154
411 Ga0451806_254795
412 Ga0451837_1401291
413 Ga0439463_029111
414 Ga0466965_0005285
415 Ga0466965_0009172
416 Ga0466965_0019230
417 Ga0466965_0024111
418 Ga0466966_0036003
419 Ga0466966_0111762
420 Ga0466963_0179575
421 Ga0466970_0064367
422 Ga0466957_0224315
423 Ga0466960_0023405
424 Ga0466960_0057782
425 Ga0466959_0116929
426 Ga0466967_0127670
427 Ga0466967_0155111
428 Ga0496102_0070904
429 Ga0496102_0321603
430 Ga0496104_0005567
431 Ga0496105_0014711
432 Ga0496107_0068325
433 Ga0496108_0103130
434 Ga0496108_0288826
435 Ga0496110_0022151
436 Ga0496112_0151081
437 Ga0496114_0005606
438 Ga0496114_0061512
439 Ga0501034_0032660
440 Ga0501036_0003073
441 Ga0501036_0014204
442 Ga0501037_0017324
443 Ga0501037_0019269
444 Ga0501038_0006550
445 Ga0501038_0011522
446 Ga0501039_0028167
447 Ga0501039_0208861
448 Ga0501041_0105094
449 Ga0501042_0008461
450 Ga0501042_0051023
451 Ga0501043_0016199
452 Ga0501046_0018748
453 Ga0501046_0219889
454 Ga0501047_0009670
455 Ga0501047_0034758
456 Ga0501048_0008271
457 Ga0501048_0017435
458 Ga0501048_0131038
459 Ga0501068_0035848
460 Ga0501069_0056226
461 Ga0501070_0020850
462 Ga0501071_0204652
463 Ga0501072_0189797
464 Ga0501073_0026712
465 Ga0501074_0008664
466 Ga0501074_0034527
467 Ga0501074_0078461
468 Ga0501080_0031743
469 Ga0501035_0164013
470 Ga0501044_0020465
471 Ga0501044_0042917
472 nmdc:mga03n38_27463_c1
473 nmdc:mga00v17_150733_c1
474 nmdc:mga00v17_15534_c1
475 nmdc:mga00v17_6227_c1
476 nmdc:mga0yw44_18119_c2
477 nmdc:mga0yw44_22359_c1
478 nmdc:mga0yw44_28532_c1
479 nmdc:mga0yw44_36784_c1
480 nmdc:mga0yw44_461_c1
481 nmdc:mga06z11_29498_c1
482 nmdc:mga04h51_15400_c1
483 nmdc:mga04h51_55273_c1
484 nmdc:mga07m45_42420_c1
485 nmdc:mga07m45_5553_c1
486 nmdc:mga07m45_65266_c1
487 nmdc:mga05p37_127659_c1
488 nmdc:mga08y16_119144_c1
489 nmdc:mga08y16_261358_c1
490 nmdc:mga0n895_103766_c1
491 nmdc:mga08x19_37271_c1
492 nmdc:mga0a205_27135_c1
493 Ga0495619_0080762
494 Ga0500644_0000049
495 Ga0500573_0002950
496 Ga0590075_005642
497 2739325421
498 2643892857
499 2643962306
500 2644031885
501 2644102812
502 2644118474
503 2644138116
504 2644230808
505 2644491466
506 2734972526
507 2738696290
508 2740167562
509 2740169545
510 2760303461
511 2760623855
512 2857485225
513 2895434923
514 2919396276
515 2946025009
516 3002999354
517 8054613136
518 8056582507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

162

271

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

313

388

0.92

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

54

151

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1off-assembly1.cif.gz_A 2fe-2s ferredoxin from synechocystis sp. pcc 6803 0.9263 271 358
2pvo-assembly1.cif.gz_D crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase 0.9199 271 358
3p63-assembly2.cif.gz_B structure of m. laminosus ferredoxin with a shorter l1,2 loop 0.9162 271 358
6xtf-assembly1.cif.gz_D crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor 0.9153 271 358
4zho-assembly2.cif.gz_B the crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster 0.9153 271 358
ID Description Score Start End Superfamily
af_P71846_339_440_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9706 15 113 2.40.30.10
af_P71846_588_685_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9676 271 361 3.10.20.30
af_P71846_447_583_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9546 119 252 3.40.50.80
af_P76081_101_242_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9521 114 249 3.40.50.80
af_P76081_2_100_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9485 13 110 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D0RYI8-F1-model_v4 Phenylacetic acid degradation protein 0.9741 14 144 GO:0016491
GO:0050660
GO:0051537
AF-A0A398PXR3-F1-model_v4 deleted 0.9677 15 249
AF-A0A4Q3S0X0-F1-model_v4 Phenylacetic acid degradation protein 0.9672 15 116 GO:0016491
GO:0050660
GO:0051537
AF-A0A7V5VVM9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9644 271 361 GO:0046872
GO:0051537
AF-A0A7Y3A4X0-F1-model_v4 Phenylacetic acid degradation protein 0.963 13 254 GO:0016491
GO:0050660
GO:0051537

Map