F369147

General Info

Members Datasets Scaffolds Average Seq Length
259 157 259 139

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_25184_c1|nmdc:mga0yw44_25184_c1_2876_3295
Length 126
Sequence VEGSDCLFCGIVAGEVPAQIVDSDEHTVAFMDINPATRGHALVVPRTHAADLFARRLARRLRTALKPDGFNVLNSCGAAAWQTVFHFHLHVVPRYEDDPLELPWTPSEGDADDIAAVADRIRGVGE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 0
Rhizoplane 11.58
Rhizosphere 80.69
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100038407 3300005329 Bacteria 4389
2 Ga0070690_100240775 3300005330 Bacteria 1276
3 Ga0070682_100093309 3300005337 Bacteria 1973
4 Ga0070682_100236682 3300005337 Bacteria 1309
5 Ga0068868_100025767 3300005338 Bacteria 4476
6 Ga0068868_100151767 3300005338 Bacteria 1908
7 Ga0070660_100001576 3300005339 Bacteria 15678
8 Ga0070689_100273206 3300005340 Bacteria 1400
9 Ga0070692_10011563 3300005345 Bacteria 4055
10 Ga0070692_10743660 3300005345 Bacteria 664
11 Ga0070675_100110947 3300005354 Bacteria 2320
12 Ga0070675_100405554 3300005354 Bacteria 1217
13 Ga0070674_101633560 3300005356 Bacteria 582
14 Ga0070659_100003244 3300005366 Bacteria 11575
15 Ga0070659_101002186 3300005366 Bacteria 733
16 Ga0070667_100216363 3300005367 Bacteria 1704
17 Ga0070662_100043823 3300005457 Bacteria 3203
18 Ga0068867_101633890 3300005459 Bacteria 603
19 Ga0068853_100005538 3300005539 Bacteria 9905
20 Ga0070686_100017850 3300005544 Bacteria 4153
21 Ga0070686_100022894 3300005544 Bacteria 3727
22 Ga0070695_100697984 3300005545 Bacteria 805
23 Ga0070696_100127182 3300005546 Bacteria 1850
24 Ga0070693_100010104 3300005547 Bacteria 4713
25 Ga0070704_100363800 3300005549 Bacteria 1224
26 Ga0070664_100008941 3300005564 Bacteria 8121
27 Ga0068857_100302464 3300005577 Bacteria 1475
28 Ga0070702_100026057 3300005615 Bacteria 3138
29 Ga0068859_100238102 3300005617 Bacteria 1909
30 Ga0068861_101696117 3300005719 Bacteria 625
31 Ga0068870_10046313 3300005840 Bacteria 2280
32 Ga0068860_100670925 3300005843 Bacteria 1045
33 Ga0081455_10140283 3300005937 Bacteria 1878
34 Ga0081455_10370393 3300005937 Bacteria 1004
35 Ga0081455_10606115 3300005937 Bacteria 713
36 Ga0081538_10000514 3300005981 Bacteria 43252
37 Ga0081538_10077189 3300005981 Bacteria 1795
38 Ga0070717_10262732 3300006028 Bacteria 1527
39 Ga0075365_10001124 3300006038 Bacteria 11686
40 Ga0075365_10006524 3300006038 Bacteria 6427
41 Ga0075365_10009261 3300006038 Bacteria 5649
42 Ga0075365_10180243 3300006038 Bacteria 1477
43 Ga0075365_10260973 3300006038 Bacteria 1218
44 Ga0075363_100008821 3300006048 Bacteria 4715
45 Ga0075363_100310363 3300006048 Bacteria 916
46 Ga0075364_10357178 3300006051 Bacteria 996
47 Ga0070716_100195470 3300006173 Bacteria 1340
48 Ga0070712_100158379 3300006175 Bacteria 1746
49 Ga0075367_10114918 3300006178 Bacteria 1655
50 Ga0075428_100043184 3300006844 Bacteria 4957
51 Ga0075431_100000075 3300006847 Bacteria 57994
52 Ga0075431_100228367 3300006847 Bacteria 1897
53 Ga0075434_100013845 3300006871 Bacteria 7693
54 Ga0075434_100351207 3300006871 Bacteria 1496
55 Ga0068865_100026040 3300006881 Bacteria 3853
56 Ga0097620_100238108 3300006931 Bacteria 1909
57 Ga0075435_100203729 3300007076 Bacteria 1677
58 Ga0111539_10010995 3300009094 Bacteria 11393
59 Ga0111539_10042135 3300009094 Bacteria 5486
60 Ga0105245_10002623 3300009098 Bacteria 16194
61 Ga0105245_11393068 3300009098 Bacteria 751
62 Ga0105247_10075650 3300009101 Bacteria 2113
63 Ga0114129_10029321 3300009147 Bacteria 7795
64 Ga0114129_10209321 3300009147 Bacteria 2637
65 Ga0114129_10936830 3300009147 Unclassified 1095
66 Ga0114129_11021470 3300009147 Bacteria 1040
67 Ga0114129_12421302 3300009147 Bacteria 628
68 Ga0105243_11128486 3300009148 Bacteria 794
69 Ga0105242_10113012 3300009176 Bacteria 2319
70 Ga0105248_10226973 3300009177 Bacteria 2102
71 Ga0105239_10427643 3300010375 Bacteria 1501
72 Ga0105246_10157781 3300011119 Bacteria 1725
73 Ga0105246_11049855 3300011119 Bacteria 741
74 Ga0157375_10080738 3300013308 Bacteria 3291
75 Ga0163163_10116408 3300014325 Bacteria 2704
76 Ga0157377_10125824 3300014745 Bacteria 1559
77 Ga0157379_10195434 3300014968 Bacteria 1828
78 Ga0207688_10011311 3300025901 Bacteria 4858
79 Ga0207688_10104032 3300025901 Bacteria 1642
80 Ga0207685_10215903 3300025905 Bacteria 909
81 Ga0207705_10337828 3300025909 Bacteria 1159
82 Ga0207684_10206745 3300025910 Bacteria 1694
83 Ga0207693_10017208 3300025915 Bacteria 5765
84 Ga0207657_10001445 3300025919 Bacteria 25426
85 Ga0207649_10026746 3300025920 Bacteria 3378
86 Ga0207650_10256779 3300025925 Bacteria 1416
87 Ga0207659_10044561 3300025926 Bacteria 3122
88 Ga0207687_10203875 3300025927 Bacteria 1548
89 Ga0207687_10781459 3300025927 Bacteria 814
90 Ga0207690_10241241 3300025932 Bacteria 1392
91 Ga0207690_11384388 3300025932 Bacteria 588
92 Ga0207706_10002862 3300025933 Bacteria 16746
93 Ga0207686_10488162 3300025934 Bacteria 954
94 Ga0207709_10086030 3300025935 Bacteria 2040
95 Ga0207709_10124705 3300025935 Bacteria 1745
96 Ga0207709_11348165 3300025935 Bacteria 590
97 Ga0207670_10207122 3300025936 Bacteria 1493
98 Ga0207669_10192713 3300025937 Bacteria 1472
99 Ga0207704_10176457 3300025938 Bacteria 1539
100 Ga0207704_10271392 3300025938 Bacteria 1284
101 Ga0207665_11196614 3300025939 Bacteria 606
102 Ga0207661_10068482 3300025944 Bacteria 2890
103 Ga0207712_10810772 3300025961 Bacteria 823
104 Ga0207640_10330246 3300025981 Bacteria 1218
105 Ga0207677_10263842 3300026023 Bacteria 1405
106 Ga0207678_10030478 3300026067 Bacteria 4708
107 Ga0207683_10029603 3300026121 Bacteria 4741
108 Ga0207683_10118778 3300026121 Bacteria 2372
109 Ga0207698_10108034 3300026142 Bacteria 2324
110 Ga0207428_10113271 3300027907 Bacteria 2085
111 Ga0307410_10056106 3300031852 Bacteria 2677
112 Ga0307407_10074286 3300031903 Bacteria 2034
113 Ga0307409_100030603 3300031995 Bacteria 3870
114 Ga0307409_100697514 3300031995 Bacteria 1014
115 Ga0307409_101539436 3300031995 Bacteria 693
116 Ga0307416_100023745 3300032002 Bacteria 4458
117 Ga0307414_11652970 3300032004 Bacteria 597
118 Ga0316574_0123434 3300035398 Bacteria 1664
119 Ga0316574_0833406 3300035398 Bacteria 560
120 Ga0373931_1087080 3300035691 Bacteria 544
121 Ga0373947_0225651 3300035725 Bacteria 1233
122 Ga0316584_0047110 3300036712 Bacteria 3220
123 Ga0316584_0162280 3300036712 Bacteria 1660
124 Ga0395900_0025504 3300037418 Bacteria 6052
125 Ga0395900_0459707 3300037418 Bacteria 1228
126 Ga0395898_0028632 3300037466 Bacteria 5582
127 Ga0395898_0048424 3300037466 Bacteria 4168
128 Ga0395898_1112185 3300037466 Bacteria 723
129 Ga0395905_0020030 3300037471 Bacteria 6338
130 Ga0395905_0267872 3300037471 Bacteria 1594
131 Ga0395905_1409088 3300037471 Bacteria 601
132 Ga0395901_0014051 3300038443 Bacteria 8150
133 Ga0395901_0089195 3300038443 Bacteria 3226
134 Ga0395901_1547318 3300038443 Bacteria 618
135 Ga0451807_1276215 3300041486 Unclassified 558
136 Ga0451853_2929270 3300041512 Bacteria 836
137 Ga0466960_0191891 3300044901 Bacteria 1112
138 Ga0466967_0516061 3300045976 Bacteria 1174
139 Ga0466967_2121856 3300045976 Bacteria 558
140 Ga0495603_0226627 3300046455 Bacteria 1078
141 Ga0495641_0021079 3300046461 Bacteria 3287
142 Ga0495582_0079948 3300046473 Bacteria 1815
143 Ga0495663_0322208 3300046525 Bacteria 559
144 Ga0495668_0440122 3300046616 Bacteria 717
145 Ga0495588_0044125 3300046674 Bacteria 2283
146 Ga0495581_0487055 3300047315 Bacteria 717
147 Ga0495676_0033275 3300047321 Bacteria 4344
148 Ga0496100_0067181 3300048903 Bacteria 2380
149 Ga0496101_0428466 3300048904 Bacteria 1043
150 Ga0496101_1196861 3300048904 Bacteria 595
151 Ga0496102_0323584 3300048905 Bacteria 1452
152 Ga0496103_0921123 3300048906 Bacteria 547
153 Ga0496105_0386845 3300048908 Bacteria 1112
154 Ga0496105_0709156 3300048908 Bacteria 772
155 Ga0496107_0776508 3300048910 Bacteria 702
156 Ga0496108_0068666 3300048911 Bacteria 2990
157 Ga0496109_0021291 3300048912 Bacteria 5732
158 Ga0496109_0059933 3300048912 Bacteria 3477
159 Ga0496110_0016016 3300048913 Bacteria 6253
160 Ga0496110_0048031 3300048913 Bacteria 3740
161 Ga0496110_0221201 3300048913 Bacteria 1722
162 Ga0496110_0302707 3300048913 Bacteria 1456
163 Ga0496110_0501060 3300048913 Bacteria 1105
164 Ga0496110_1061701 3300048913 Bacteria 718
165 Ga0496111_0046106 3300048914 Bacteria 3138
166 Ga0496111_0218665 3300048914 Bacteria 1415
167 Ga0496111_0544599 3300048914 Bacteria 852
168 Ga0496112_0083879 3300048915 Bacteria 3152
169 Ga0496112_0495487 3300048915 Bacteria 1157
170 Ga0496113_0023844 3300048916 Bacteria 4343
171 Ga0496113_0063347 3300048916 Bacteria 2794
172 Ga0496113_0337718 3300048916 Bacteria 1208
173 Ga0496113_0740500 3300048916 Bacteria 783
174 Ga0496114_0142029 3300048917 Bacteria 2079
175 Ga0496114_0348247 3300048917 Bacteria 1310
176 Ga0496115_0115807 3300048918 Bacteria 2204
177 Ga0501032_0968122 3300049569 Bacteria 535
178 Ga0501034_0236547 3300049571 Bacteria 1774
179 Ga0501036_1470017 3300049572 Bacteria 552
180 Ga0501038_0673174 3300049574 Bacteria 777
181 Ga0501039_0586472 3300049575 Bacteria 874
182 Ga0501040_0293895 3300049576 Bacteria 1161
183 Ga0501040_0496188 3300049576 Bacteria 880
184 Ga0501040_0613592 3300049576 Bacteria 786
185 Ga0501041_0045630 3300049577 Bacteria 2665
186 Ga0501041_0210312 3300049577 Bacteria 1220
187 Ga0501041_0382220 3300049577 Bacteria 891
188 Ga0501041_0549456 3300049577 Bacteria 736
189 Ga0501042_0034268 3300049578 Bacteria 3601
190 Ga0501042_0950946 3300049578 Bacteria 626
191 Ga0501067_0486186 3300049583 Bacteria 690
192 Ga0501068_0034696 3300049584 Bacteria 3010
193 Ga0501068_0401182 3300049584 Bacteria 884
194 Ga0501069_0367972 3300049585 Bacteria 848
195 Ga0501070_0060363 3300049586 Bacteria 3143
196 Ga0501070_0152052 3300049586 Bacteria 1909
197 Ga0501070_1350582 3300049586 Bacteria 543
198 Ga0501071_0091101 3300049587 Bacteria 2240
199 Ga0501071_0228690 3300049587 Bacteria 1401
200 Ga0501071_0426700 3300049587 Bacteria 1013
201 Ga0501072_0025253 3300049588 Bacteria 4628
202 Ga0501072_0070634 3300049588 Bacteria 2758
203 Ga0501072_0374875 3300049588 Bacteria 1129
204 Ga0501072_0517661 3300049588 Bacteria 943
205 Ga0501072_0523231 3300049588 Bacteria 938
206 Ga0501073_0049690 3300049589 Bacteria 2940
207 Ga0501074_0120408 3300049590 Bacteria 1877
208 Ga0501074_0182832 3300049590 Bacteria 1495
209 Ga0501074_0439625 3300049590 Bacteria 925
210 Ga0501074_0978302 3300049590 Bacteria 595
211 Ga0501076_0043108 3300049592 Bacteria 3554
212 Ga0501076_0225881 3300049592 Bacteria 1530
213 Ga0501076_0741830 3300049592 Bacteria 810
214 Ga0501077_0454002 3300049593 Bacteria 821
215 Ga0501079_0025894 3300049741 Bacteria 4499
216 Ga0501079_0150802 3300049741 Bacteria 1812
217 Ga0501079_0196360 3300049741 Bacteria 1575
218 Ga0501079_0264973 3300049741 Bacteria 1343
219 Ga0501080_0346167 3300049742 Bacteria 1343
220 Ga0501080_1483044 3300049742 Bacteria 577
221 Ga0501081_0093746 3300049743 Bacteria 2114
222 Ga0501081_0376092 3300049743 Bacteria 1049
223 Ga0501083_0175417 3300049744 Bacteria 1401
224 Ga0501045_0149778 3300049824 Bacteria 1736
225 Ga0501045_0261345 3300049824 Bacteria 1288
226 Ga0501045_0334450 3300049824 Bacteria 1127
227 nmdc:mga03n38_108074_c1 3300050490 Bacteria 1351
228 nmdc:mga00v17_1026267_c1 3300050491 Bacteria 518
229 nmdc:mga0yw44_150527_c1 3300050492 Bacteria 1517
230 nmdc:mga0yw44_25079_c1 3300050492 Bacteria 3384
231 nmdc:mga0yw44_25184_c1 3300050492 Bacteria 3379
232 nmdc:mga0yw44_4920_c1 3300050492 Bacteria 6221
233 nmdc:mga06z11_256169_c1 3300050494 Bacteria 1031
234 nmdc:mga06z11_464045_c1 3300050494 Bacteria 766
235 nmdc:mga06z11_748634_c1 3300050494 Bacteria 595
236 nmdc:mga05p37_1608126_c1 3300050507 Bacteria 640
237 nmdc:mga05p37_28563_c1 3300050507 Bacteria 6802
238 nmdc:mga05p37_650175_c1 3300050507 Bacteria 1181
239 nmdc:mga0qj67_1252545_c1 3300050509 Bacteria 576
240 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
241 nmdc:mga06r32_442404_c1 3300050510 Bacteria 1280
242 nmdc:mga08y16_487444_c1 3300050511 Bacteria 1254
243 nmdc:mga08y16_50983_c1 3300050511 Bacteria 4330
244 nmdc:mga0n895_1557160_c1 3300050512 Bacteria 626
245 nmdc:mga0n895_451519_c1 3300050512 Bacteria 1298
246 nmdc:mga0n895_49947_c1 3300050512 Bacteria 4100
247 nmdc:mga0rr50_721062_c1 3300050513 Bacteria 851
248 nmdc:mga0a205_28868_c1 3300050515 Bacteria 2360
249 Ga0500644_0053511 3300053088 Bacteria 1394
250 Ga0501084_0197049 3300054114 Bacteria 1699
251 Ga0501084_0390311 3300054114 Bacteria 1176
252 Ga0501084_0662727 3300054114 Bacteria 881
253 Ga0501084_0668455 3300054114 Bacteria 876
254 Ga0501082_0823510 3300060353 Bacteria 812
255 Ga0501082_1234714 3300060353 Bacteria 653
256 Ga0530510_0035145 3300061734 Bacteria 3611
257 Ga0530510_0193118 3300061734 Bacteria 1511
258 Ga0530510_0315199 3300061734 Bacteria 1172
259 Ga0530510_0877379 3300061734 Bacteria 685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10009261 Ga0075365_100092613 125
2 3300050492 nmdc:mga0yw44_25184_c1 nmdc:mga0yw44_25184_c1_2876_3295 125
3 3300009147 Ga0114129_10936830 Ga0114129_109368301 134
4 3300006028 Ga0070717_10262732 Ga0070717_102627322 135
5 3300038443 Ga0395901_1547318 Ga0395901_1547318_133_540 135
6 3300045976 Ga0466967_2121856 Ga0466967_2121856_50_457 135
7 3300048913 Ga0496110_0302707 Ga0496110_0302707_387_794 135
8 3300048914 Ga0496111_0218665 Ga0496111_0218665_187_594 135
9 3300048916 Ga0496113_0337718 Ga0496113_0337718_430_837 135
10 3300048917 Ga0496114_0348247 Ga0496114_0348247_566_973 135
11 3300048918 Ga0496115_0115807 Ga0496115_0115807_152_559 135
12 3300049583 Ga0501067_0486186 Ga0501067_0486186_224_631 135
13 3300049584 Ga0501068_0034696 Ga0501068_0034696_685_1092 135
14 3300049824 Ga0501045_0334450 Ga0501045_0334450_404_811 135
15 3300005937 Ga0081455_10370393 Ga0081455_103703932 136
16 3300041486 Ga0451807_1276215 Ga0451807_1276215_18_431 136
17 3300048904 Ga0496101_1196861 Ga0496101_1196861_12_422 136
18 3300049592 Ga0501076_0741830 Ga0501076_0741830_330_740 136
19 3300050512 nmdc:mga0n895_451519_c1 nmdc:mga0n895_451519_c1_759_1169 136
20 3300053088 Ga0500644_0053511 Ga0500644_0053511_653_1066 136
21 3300005356 Ga0070674_101633560 Ga0070674_1016335601 137
22 3300005937 Ga0081455_10140283 Ga0081455_101402833 137
23 3300005937 Ga0081455_10606115 Ga0081455_106061152 137
24 3300005981 Ga0081538_10000514 Ga0081538_100005143 137
25 3300005981 Ga0081538_10077189 Ga0081538_100771892 137
26 3300006038 Ga0075365_10180243 Ga0075365_101802432 137
27 3300009098 Ga0105245_11393068 Ga0105245_113930682 137
28 3300009147 Ga0114129_10209321 Ga0114129_102093212 137
29 3300009147 Ga0114129_11021470 Ga0114129_110214702 137
30 3300009148 Ga0105243_11128486 Ga0105243_111284862 137
31 3300025927 Ga0207687_10781459 Ga0207687_107814592 137
32 3300025935 Ga0207709_11348165 Ga0207709_113481651 137
33 3300025961 Ga0207712_10810772 Ga0207712_108107722 137
34 3300031852 Ga0307410_10056106 Ga0307410_100561062 137
35 3300031903 Ga0307407_10074286 Ga0307407_100742862 137
36 3300031995 Ga0307409_100030603 Ga0307409_1000306034 137
37 3300031995 Ga0307409_101539436 Ga0307409_1015394362 137
38 3300032002 Ga0307416_100023745 Ga0307416_1000237455 137
39 3300032004 Ga0307414_11652970 Ga0307414_116529701 137
40 3300044901 Ga0466960_0191891 Ga0466960_0191891_57_476 137
41 3300046525 Ga0495663_0322208 Ga0495663_0322208_103_516 137
42 3300048910 Ga0496107_0776508 Ga0496107_0776508_37_453 137
43 3300049569 Ga0501032_0968122 Ga0501032_0968122_27_443 137
44 3300049574 Ga0501038_0673174 Ga0501038_0673174_131_547 137
45 3300049575 Ga0501039_0586472 Ga0501039_0586472_369_785 137
46 3300049576 Ga0501040_0496188 Ga0501040_0496188_105_539 137
47 3300049576 Ga0501040_0613592 Ga0501040_0613592_211_627 137
48 3300049577 Ga0501041_0045630 Ga0501041_0045630_1968_2384 137
49 3300049577 Ga0501041_0210312 Ga0501041_0210312_775_1191 137
50 3300049577 Ga0501041_0549456 Ga0501041_0549456_30_446 137
51 3300049578 Ga0501042_0034268 Ga0501042_0034268_1965_2381 137
52 3300049578 Ga0501042_0950946 Ga0501042_0950946_156_572 137
53 3300049586 Ga0501070_1350582 Ga0501070_1350582_100_516 137
54 3300049587 Ga0501071_0228690 Ga0501071_0228690_666_1082 137
55 3300049587 Ga0501071_0426700 Ga0501071_0426700_473_889 137
56 3300049588 Ga0501072_0025253 Ga0501072_0025253_1389_1805 137
57 3300049588 Ga0501072_0070634 Ga0501072_0070634_1810_2226 137
58 3300049588 Ga0501072_0374875 Ga0501072_0374875_19_435 137
59 3300049588 Ga0501072_0517661 Ga0501072_0517661_146_580 137
60 3300049588 Ga0501072_0523231 Ga0501072_0523231_502_915 137
61 3300049590 Ga0501074_0120408 Ga0501074_0120408_1342_1758 137
62 3300049590 Ga0501074_0439625 Ga0501074_0439625_128_544 137
63 3300049590 Ga0501074_0978302 Ga0501074_0978302_137_553 137
64 3300049592 Ga0501076_0043108 Ga0501076_0043108_595_1011 137
65 3300049592 Ga0501076_0225881 Ga0501076_0225881_681_1097 137
66 3300049741 Ga0501079_0025894 Ga0501079_0025894_3724_4140 137
67 3300049741 Ga0501079_0150802 Ga0501079_0150802_439_855 137
68 3300049741 Ga0501079_0196360 Ga0501079_0196360_597_1031 137
69 3300049741 Ga0501079_0264973 Ga0501079_0264973_515_931 137
70 3300049743 Ga0501081_0093746 Ga0501081_0093746_296_712 137
71 3300049743 Ga0501081_0376092 Ga0501081_0376092_70_486 137
72 3300049824 Ga0501045_0149778 Ga0501045_0149778_452_868 137
73 3300049824 Ga0501045_0261345 Ga0501045_0261345_278_694 137
74 3300050507 nmdc:mga05p37_1608126_c1 nmdc:mga05p37_1608126_c1_134_550 137
75 3300050507 nmdc:mga05p37_650175_c1 nmdc:mga05p37_650175_c1_348_764 137
76 3300050509 nmdc:mga0qj67_1252545_c1 nmdc:mga0qj67_1252545_c1_138_554 137
77 3300054114 Ga0501084_0197049 Ga0501084_0197049_701_1117 137
78 3300054114 Ga0501084_0390311 Ga0501084_0390311_355_771 137
79 3300054114 Ga0501084_0662727 Ga0501084_0662727_159_593 137
80 3300054114 Ga0501084_0668455 Ga0501084_0668455_387_803 137
81 3300060353 Ga0501082_0823510 Ga0501082_0823510_180_596 137
82 3300060353 Ga0501082_1234714 Ga0501082_1234714_113_529 137
83 3300061734 Ga0530510_0035145 Ga0530510_0035145_278_694 137
84 3300061734 Ga0530510_0193118 Ga0530510_0193118_603_1019 137
85 3300061734 Ga0530510_0315199 Ga0530510_0315199_205_639 137
86 3300061734 Ga0530510_0877379 Ga0530510_0877379_156_572 137
87 3300005330 Ga0070690_100240775 Ga0070690_1002407752 138
88 3300005337 Ga0070682_100236682 Ga0070682_1002366822 138
89 3300005338 Ga0068868_100025767 Ga0068868_1000257673 138
90 3300005366 Ga0070659_101002186 Ga0070659_1010021862 138
91 3300005459 Ga0068867_101633890 Ga0068867_1016338901 138
92 3300005544 Ga0070686_100017850 Ga0070686_1000178505 138
93 3300005545 Ga0070695_100697984 Ga0070695_1006979842 138
94 3300005546 Ga0070696_100127182 Ga0070696_1001271822 138
95 3300005549 Ga0070704_100363800 Ga0070704_1003638001 138
96 3300006038 Ga0075365_10001124 Ga0075365_100011243 138
97 3300006038 Ga0075365_10006524 Ga0075365_100065244 138
98 3300006038 Ga0075365_10260973 Ga0075365_102609732 138
99 3300006173 Ga0070716_100195470 Ga0070716_1001954702 138
100 3300006175 Ga0070712_100158379 Ga0070712_1001583794 138
101 3300006844 Ga0075428_100043184 Ga0075428_1000431844 138
102 3300006847 Ga0075431_100000075 Ga0075431_10000007541 138
103 3300006871 Ga0075434_100013845 Ga0075434_1000138454 138
104 3300006881 Ga0068865_100026040 Ga0068865_1000260402 138
105 3300007076 Ga0075435_100203729 Ga0075435_1002037292 138
106 3300009094 Ga0111539_10010995 Ga0111539_100109952 138
107 3300009098 Ga0105245_10002623 Ga0105245_1000262313 138
108 3300009147 Ga0114129_10029321 Ga0114129_100293213 138
109 3300009147 Ga0114129_12421302 Ga0114129_124213021 138
110 3300009176 Ga0105242_10113012 Ga0105242_101130124 138
111 3300009177 Ga0105248_10226973 Ga0105248_102269732 138
112 3300011119 Ga0105246_10157781 Ga0105246_101577812 138
113 3300014968 Ga0157379_10195434 Ga0157379_101954342 138
114 3300025901 Ga0207688_10104032 Ga0207688_101040323 138
115 3300025905 Ga0207685_10215903 Ga0207685_102159032 138
116 3300025910 Ga0207684_10206745 Ga0207684_102067452 138
117 3300025915 Ga0207693_10017208 Ga0207693_100172084 138
118 3300025927 Ga0207687_10203875 Ga0207687_102038752 138
119 3300025932 Ga0207690_10241241 Ga0207690_102412412 138
120 3300025934 Ga0207686_10488162 Ga0207686_104881622 138
121 3300025935 Ga0207709_10124705 Ga0207709_101247052 138
122 3300025937 Ga0207669_10192713 Ga0207669_101927132 138
123 3300025938 Ga0207704_10176457 Ga0207704_101764572 138
124 3300025939 Ga0207665_11196614 Ga0207665_111966142 138
125 3300026023 Ga0207677_10263842 Ga0207677_102638422 138
126 3300026121 Ga0207683_10029603 Ga0207683_100296035 138
127 3300027907 Ga0207428_10113271 Ga0207428_101132712 138
128 3300035725 Ga0373947_0225651 Ga0373947_0225651_529_948 138
129 3300037418 Ga0395900_0025504 Ga0395900_0025504_1170_1589 138
130 3300037418 Ga0395900_0459707 Ga0395900_0459707_532_951 138
131 3300037466 Ga0395898_0028632 Ga0395898_0028632_2824_3243 138
132 3300037466 Ga0395898_0048424 Ga0395898_0048424_1284_1703 138
133 3300037466 Ga0395898_1112185 Ga0395898_1112185_21_440 138
134 3300037471 Ga0395905_0020030 Ga0395905_0020030_2729_3148 138
135 3300037471 Ga0395905_0267872 Ga0395905_0267872_304_723 138
136 3300037471 Ga0395905_1409088 Ga0395905_1409088_17_436 138
137 3300038443 Ga0395901_0014051 Ga0395901_0014051_274_693 138
138 3300038443 Ga0395901_0089195 Ga0395901_0089195_1380_1799 138
139 3300041512 Ga0451853_2929270 Ga0451853_2929270_281_700 138
140 3300045976 Ga0466967_0516061 Ga0466967_0516061_343_771 138
141 3300046455 Ga0495603_0226627 Ga0495603_0226627_504_923 138
142 3300046461 Ga0495641_0021079 Ga0495641_0021079_2640_3059 138
143 3300046473 Ga0495582_0079948 Ga0495582_0079948_303_722 138
144 3300046674 Ga0495588_0044125 Ga0495588_0044125_1232_1651 138
145 3300047315 Ga0495581_0487055 Ga0495581_0487055_81_500 138
146 3300047321 Ga0495676_0033275 Ga0495676_0033275_1726_2145 138
147 3300048903 Ga0496100_0067181 Ga0496100_0067181_1184_1603 138
148 3300048905 Ga0496102_0323584 Ga0496102_0323584_291_710 138
149 3300048906 Ga0496103_0921123 Ga0496103_0921123_89_508 138
150 3300048908 Ga0496105_0386845 Ga0496105_0386845_629_1048 138
151 3300048908 Ga0496105_0709156 Ga0496105_0709156_204_659 138
152 3300048912 Ga0496109_0021291 Ga0496109_0021291_3481_3900 138
153 3300048913 Ga0496110_0501060 Ga0496110_0501060_291_710 138
154 3300048913 Ga0496110_1061701 Ga0496110_1061701_77_532 138
155 3300048914 Ga0496111_0544599 Ga0496111_0544599_130_585 138
156 3300048915 Ga0496112_0083879 Ga0496112_0083879_1025_1480 138
157 3300048915 Ga0496112_0495487 Ga0496112_0495487_201_620 138
158 3300048916 Ga0496113_0023844 Ga0496113_0023844_3887_4306 138
159 3300048916 Ga0496113_0740500 Ga0496113_0740500_257_712 138
160 3300048917 Ga0496114_0142029 Ga0496114_0142029_903_1322 138
161 3300049576 Ga0501040_0293895 Ga0501040_0293895_410_829 138
162 3300049577 Ga0501041_0382220 Ga0501041_0382220_384_803 138
163 3300049593 Ga0501077_0454002 Ga0501077_0454002_117_536 138
164 3300049742 Ga0501080_1483044 Ga0501080_1483044_31_450 138
165 3300050491 nmdc:mga00v17_1026267_c1 nmdc:mga00v17_1026267_c1_43_504 138
166 3300050492 nmdc:mga0yw44_150527_c1 nmdc:mga0yw44_150527_c1_460_879 138
167 3300050492 nmdc:mga0yw44_25079_c1 nmdc:mga0yw44_25079_c1_617_1078 138
168 3300050492 nmdc:mga0yw44_4920_c1 nmdc:mga0yw44_4920_c1_374_793 138
169 3300050494 nmdc:mga06z11_464045_c1 nmdc:mga06z11_464045_c1_96_515 138
170 3300050507 nmdc:mga05p37_28563_c1 nmdc:mga05p37_28563_c1_2175_2594 138
171 3300050510 nmdc:mga06r32_244_c1 nmdc:mga06r32_244_c1_4624_5043 138
172 3300050511 nmdc:mga08y16_50983_c1 nmdc:mga08y16_50983_c1_3716_4135 138
173 3300050512 nmdc:mga0n895_1557160_c1 nmdc:mga0n895_1557160_c1_105_560 138
174 3300050512 nmdc:mga0n895_49947_c1 nmdc:mga0n895_49947_c1_77_496 138
175 3300050513 nmdc:mga0rr50_721062_c1 nmdc:mga0rr50_721062_c1_374_793 138
176 3300050515 nmdc:mga0a205_28868_c1 nmdc:mga0a205_28868_c1_977_1396 138
177 3300005345 Ga0070692_10743660 Ga0070692_107436602 139
178 3300005354 Ga0070675_100405554 Ga0070675_1004055542 139
179 3300005719 Ga0068861_101696117 Ga0068861_1016961171 139
180 3300006847 Ga0075431_100228367 Ga0075431_1002283672 139
181 3300006871 Ga0075434_100351207 Ga0075434_1003512073 139
182 3300035691 Ga0373931_1087080 Ga0373931_1087080_69_488 139
183 3300046616 Ga0495668_0440122 Ga0495668_0440122_228_647 139
184 3300048913 Ga0496110_0016016 Ga0496110_0016016_5007_5426 139
185 3300048913 Ga0496110_0221201 Ga0496110_0221201_412_831 139
186 3300048914 Ga0496111_0046106 Ga0496111_0046106_2145_2564 139
187 3300050510 nmdc:mga06r32_442404_c1 nmdc:mga06r32_442404_c1_277_696 139
188 3300005329 Ga0070683_100038407 Ga0070683_1000384072 140
189 3300005337 Ga0070682_100093309 Ga0070682_1000933094 140
190 3300005338 Ga0068868_100151767 Ga0068868_1001517672 140
191 3300005339 Ga0070660_100001576 Ga0070660_1000015765 140
192 3300005340 Ga0070689_100273206 Ga0070689_1002732061 140
193 3300005345 Ga0070692_10011563 Ga0070692_100115633 140
194 3300005354 Ga0070675_100110947 Ga0070675_1001109475 140
195 3300005366 Ga0070659_100003244 Ga0070659_1000032442 140
196 3300005367 Ga0070667_100216363 Ga0070667_1002163632 140
197 3300005457 Ga0070662_100043823 Ga0070662_1000438232 140
198 3300005539 Ga0068853_100005538 Ga0068853_1000055388 140
199 3300005544 Ga0070686_100022894 Ga0070686_1000228944 140
200 3300005547 Ga0070693_100010104 Ga0070693_1000101044 140
201 3300005564 Ga0070664_100008941 Ga0070664_1000089414 140
202 3300005577 Ga0068857_100302464 Ga0068857_1003024642 140
203 3300005615 Ga0070702_100026057 Ga0070702_1000260574 140
204 3300005617 Ga0068859_100238102 Ga0068859_1002381022 140
205 3300005840 Ga0068870_10046313 Ga0068870_100463132 140
206 3300005843 Ga0068860_100670925 Ga0068860_1006709252 140
207 3300006048 Ga0075363_100008821 Ga0075363_1000088214 140
208 3300006048 Ga0075363_100310363 Ga0075363_1003103632 140
209 3300006051 Ga0075364_10357178 Ga0075364_103571782 140
210 3300006178 Ga0075367_10114918 Ga0075367_101149182 140
211 3300006931 Ga0097620_100238108 Ga0097620_1002381082 140
212 3300009094 Ga0111539_10042135 Ga0111539_100421356 140
213 3300009101 Ga0105247_10075650 Ga0105247_100756502 140
214 3300010375 Ga0105239_10427643 Ga0105239_104276433 140
215 3300011119 Ga0105246_11049855 Ga0105246_110498552 140
216 3300013308 Ga0157375_10080738 Ga0157375_100807385 140
217 3300014325 Ga0163163_10116408 Ga0163163_101164083 140
218 3300014745 Ga0157377_10125824 Ga0157377_101258242 140
219 3300025901 Ga0207688_10011311 Ga0207688_100113112 140
220 3300025909 Ga0207705_10337828 Ga0207705_103378282 140
221 3300025919 Ga0207657_10001445 Ga0207657_1000144525 140
222 3300025920 Ga0207649_10026746 Ga0207649_100267462 140
223 3300025925 Ga0207650_10256779 Ga0207650_102567792 140
224 3300025926 Ga0207659_10044561 Ga0207659_100445613 140
225 3300025932 Ga0207690_11384388 Ga0207690_113843881 140
226 3300025933 Ga0207706_10002862 Ga0207706_1000286213 140
227 3300025935 Ga0207709_10086030 Ga0207709_100860302 140
228 3300025936 Ga0207670_10207122 Ga0207670_102071222 140
229 3300025938 Ga0207704_10271392 Ga0207704_102713922 140
230 3300025944 Ga0207661_10068482 Ga0207661_100684823 140
231 3300025981 Ga0207640_10330246 Ga0207640_103302462 140
232 3300026067 Ga0207678_10030478 Ga0207678_100304783 140
233 3300026121 Ga0207683_10118778 Ga0207683_101187782 140
234 3300026142 Ga0207698_10108034 Ga0207698_101080342 140
235 3300031995 Ga0307409_100697514 Ga0307409_1006975142 140
236 3300035398 Ga0316574_0123434 Ga0316574_0123434_558_980 140
237 3300035398 Ga0316574_0833406 Ga0316574_0833406_71_511 140
238 3300036712 Ga0316584_0047110 Ga0316584_0047110_187_609 140
239 3300036712 Ga0316584_0162280 Ga0316584_0162280_288_728 140
240 3300048904 Ga0496101_0428466 Ga0496101_0428466_591_1013 140
241 3300048911 Ga0496108_0068666 Ga0496108_0068666_1523_1945 140
242 3300048912 Ga0496109_0059933 Ga0496109_0059933_1549_1971 140
243 3300048913 Ga0496110_0048031 Ga0496110_0048031_1639_2085 140
244 3300048916 Ga0496113_0063347 Ga0496113_0063347_840_1262 140
245 3300049571 Ga0501034_0236547 Ga0501034_0236547_461_886 140
246 3300049572 Ga0501036_1470017 Ga0501036_1470017_79_510 140
247 3300049584 Ga0501068_0401182 Ga0501068_0401182_449_874 140
248 3300049585 Ga0501069_0367972 Ga0501069_0367972_325_750 140
249 3300049586 Ga0501070_0060363 Ga0501070_0060363_801_1226 140
250 3300049586 Ga0501070_0152052 Ga0501070_0152052_1250_1675 140
251 3300049587 Ga0501071_0091101 Ga0501071_0091101_1464_1889 140
252 3300049589 Ga0501073_0049690 Ga0501073_0049690_2031_2456 140
253 3300049590 Ga0501074_0182832 Ga0501074_0182832_960_1385 140
254 3300049742 Ga0501080_0346167 Ga0501080_0346167_819_1244 140
255 3300049744 Ga0501083_0175417 Ga0501083_0175417_540_965 140
256 3300050490 nmdc:mga03n38_108074_c1 nmdc:mga03n38_108074_c1_75_503 140
257 3300050494 nmdc:mga06z11_256169_c1 nmdc:mga06z11_256169_c1_588_1013 140
258 3300050494 nmdc:mga06z11_748634_c1 nmdc:mga06z11_748634_c1_80_502 140
259 3300050511 nmdc:mga08y16_487444_c1 nmdc:mga08y16_487444_c1_171_593 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

13

97

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

5

100

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bkb-assembly1.cif.gz_A initiation factor 5a from archebacterium pyrobaculum aerophilum 0.7914 20 48
6id1-assembly1.cif.gz_U cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution 0.7812 22 78
6k9z-assembly1.cif.gz_B structure of uridylyltransferase mutant 0.7786 8 77
6k5z-assembly1.cif.gz_B structure of uridylyltransferase 0.7704 8 77
7kb6-assembly1.cif.gz_A co-crystal structure of alpha glucosidase with compound 7 0.7644 18 47
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.78 22 105 3.30.428.10
af_A4I4B7_77_254_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7747 20 88 3.30.428.10
af_Q558W0_227_389_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7733 22 88 3.30.428.10
af_A1Z8J0_315_438_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7648 22 78 3.30.428.10
af_Q8I5K9_256_433_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7451 22 78 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A101F1V2-F1-model_v4 Histidine triad (HIT) protein 0.8973 22 87 GO:0003824
AF-A0A3N9PTR7-F1-model_v4 deleted 0.8928 7 87
AF-A0A3N5K8J2-F1-model_v4 HIT domain-containing protein 0.8898 8 93 GO:0003824
GO:0009117
AF-A0A496AYM7-F1-model_v4 HIT domain-containing protein 0.8856 22 95 GO:0003824
AF-B7FGW6-F1-model_v4 HIT domain-containing protein 0.8837 7 85 GO:0047627

Feature Viewer

pLDDT pTM Quality
74.97 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map