F369039

General Info

Members Datasets Scaffolds Average Seq Length
259 155 247 330

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000036|Ga0495585_0000036_100261_101424
Length 387
Sequence MCKYADVQMCGFFSRKLKAKSRKLFLALVASFKKESFQPFAFCFKLFYTKLSALSFLLKNPHICIMILITGATGFLGAELAKLLVSTTGQQIRCTKRTSSVIPKLLLPYQQNIDWVDADMMDVFALADALDGITQVYHCAAWVSLKQADKKPMISTNVTGTANLVNLCNEQGIKLVHVSSIAAIGSAKPGELITENHHLEQSTENDGYAISKLESEMEVWRGIAEGLNAVIVNPSLIIGASASTEGSGALFNTVRKGLKFYTSGTIGFVDVEDVAKCMIGLMNSDITAERYIISAENRDYKGMVTEIANGFGIKPPAIFAKPWMMELVWRGAAVAAALTGGDPAIDKTSAQAASLTREFDNSKIRKAIGFEFKPISKTITEICSALK

Samples

Sample ID Description Type Environment
1 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
7 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
150 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.21
Metatranscriptomes 1.16
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.65
Nodule 0
Rhizoplane 0.77
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030155 3300001989 Bacteria 1881
2 JGI24739J22299_10035801 3300001989 Bacteria 1679
3 JGI24737J22298_10007949 3300001990 Bacteria 3565
4 JGI24735J21928_10000007 3300002067 Bacteria 333510
5 JGI24735J21928_10006019 3300002067 Bacteria 4010
6 JGI25162J39368_1000150 3300002737 Bacteria 75945
7 JGI25164J39214_1001658 3300002772 Bacteria 4589
8 JGI25165J46597_1000456 3300003214 Bacteria 41124
9 rootH1_10002264 3300003316 Bacteria 5229
10 rootH2_10139916 3300003320 Bacteria 4283
11 rootH2_10143544 3300003320 Bacteria 3447
12 rootH2_10295576 3300003320 Bacteria 1477
13 rootH1_10012978 3300003323 Bacteria 27481
14 rootH1_10029695 3300003323 Bacteria 13788
15 Ga0055536_1005678 3300003781 Bacteria 6033
16 Ga0058863_11859864 3300004799 Bacteria 3600
17 Ga0058861_10005061 3300004800 Bacteria 1606
18 Ga0058862_10002974 3300004803 Bacteria 3136
19 Ga0065165_1000396 3300005262 Bacteria 70676
20 Ga0065704_10071274 3300005289 Bacteria 12073
21 Ga0065704_10216113 3300005289 Bacteria 1090
22 Ga0070658_10000290 3300005327 Bacteria 43973
23 Ga0070658_10302263 3300005327 Bacteria 1364
24 Ga0070683_100055508 3300005329 Bacteria 3676
25 Ga0070677_10022807 3300005333 Bacteria 2310
26 Ga0068868_100082833 3300005338 Unclassified 2574
27 Ga0070673_100003034 3300005364 Bacteria 10390
28 Ga0070673_100017110 3300005364 Bacteria 5145
29 Ga0070659_100000090 3300005366 Bacteria 67539
30 Ga0070659_100034870 3300005366 Bacteria 3916
31 Ga0070659_100103894 3300005366 Unclassified 2289
32 Ga0070667_100099528 3300005367 Bacteria 2510
33 Ga0070678_100018215 3300005456 Bacteria 4548
34 Ga0070681_10226176 3300005458 Bacteria 1785
35 Ga0068867_100002365 3300005459 Bacteria 13266
36 Ga0070679_100012874 3300005530 Bacteria 8006
37 Ga0070679_100021503 3300005530 Bacteria 6299
38 Ga0068853_100001650 3300005539 Bacteria 16317
39 Ga0068853_100330694 3300005539 Bacteria 1414
40 Ga0070672_100014302 3300005543 Bacteria 5623
41 Ga0070672_100219245 3300005543 Unclassified 1595
42 Ga0068855_100000060 3300005563 Bacteria 133838
43 Ga0068855_100008647 3300005563 Bacteria 12303
44 Ga0068855_100060218 3300005563 Bacteria 4441
45 Ga0068855_100068372 3300005563 Bacteria 4136
46 Ga0068857_100031261 3300005577 Bacteria 4704
47 Ga0068857_100108703 3300005577 Bacteria 2491
48 Ga0068856_100000040 3300005614 Bacteria 114443
49 Ga0068856_100030534 3300005614 Bacteria 5268
50 Ga0068856_100223027 3300005614 Bacteria 1900
51 Ga0068852_100000452 3300005616 Bacteria 27132
52 Ga0068866_10110980 3300005718 Bacteria 1530
53 Ga0068863_100433005 3300005841 Bacteria 1289
54 Ga0075366_10000248 3300006195 Bacteria 23710
55 Ga0075366_10001601 3300006195 Bacteria 11329
56 Ga0075366_10002675 3300006195 Bacteria 9189
57 Ga0097621_100000652 3300006237 Bacteria 24526
58 Ga0068871_100009169 3300006358 Bacteria 7153
59 Ga0068865_100003763 3300006881 Bacteria 9103
60 Ga0105240_10000277 3300009093 Bacteria 101646
61 Ga0105240_10004869 3300009093 Bacteria 20203
62 Ga0105240_10006425 3300009093 Bacteria 17277
63 Ga0105240_10049244 3300009093 Bacteria 5320
64 Ga0105240_10049898 3300009093 Bacteria 5279
65 Ga0105240_10098627 3300009093 Bacteria 3557
66 Ga0105240_10235633 3300009093 Bacteria 2124
67 Ga0105240_10299112 3300009093 Bacteria 1841
68 Ga0105243_10000003 3300009148 Bacteria 712931
69 Ga0105241_10002359 3300009174 Bacteria 14180
70 Ga0105237_10000109 3300009545 Bacteria 115699
71 Ga0105237_10002243 3300009545 Bacteria 24077
72 Ga0105237_10003032 3300009545 Bacteria 20265
73 Ga0105237_10004759 3300009545 Bacteria 15603
74 Ga0105237_10033367 3300009545 Bacteria 5214
75 Ga0105238_10001074 3300009551 Bacteria 27605
76 Ga0105238_10047439 3300009551 Bacteria 4330
77 Ga0105239_10000015 3300010375 Bacteria 319892
78 Ga0105239_10001267 3300010375 Bacteria 34182
79 Ga0105239_10001661 3300010375 Bacteria 29308
80 Ga0105239_10004591 3300010375 Bacteria 16454
81 Ga0105239_10022807 3300010375 Bacteria 6901
82 Ga0105239_10027328 3300010375 Bacteria 6281
83 Ga0105239_10047290 3300010375 Bacteria 4716
84 Ga0105239_10049382 3300010375 Bacteria 4614
85 Ga0105239_10429475 3300010375 Bacteria 1497
86 Ga0157373_10000063 3300013100 Bacteria 95201
87 Ga0157373_10001353 3300013100 Bacteria 18812
88 Ga0157371_10000342 3300013102 Bacteria 59948
89 Ga0157371_10004024 3300013102 Bacteria 13009
90 Ga0157371_10004504 3300013102 Bacteria 12142
91 Ga0157371_10053058 3300013102 Bacteria 2879
92 Ga0157370_10035633 3300013104 Bacteria 4834
93 Ga0157370_10156019 3300013104 Bacteria 2124
94 Ga0157369_10001079 3300013105 Bacteria 34142
95 Ga0157369_10061067 3300013105 Bacteria 4064
96 Ga0157374_10000450 3300013296 Bacteria 37390
97 Ga0157378_10009974 3300013297 Bacteria 8281
98 Ga0157378_10016996 3300013297 Bacteria 6378
99 Ga0157372_10000039 3300013307 Bacteria 165839
100 Ga0157372_10000789 3300013307 Bacteria 34389
101 Ga0157372_10001250 3300013307 Bacteria 27465
102 Ga0157372_10006598 3300013307 Bacteria 12350
103 Ga0157372_10014817 3300013307 Bacteria 8349
104 Ga0157372_10717046 3300013307 Bacteria 1163
105 Ga0157375_10234054 3300013308 Bacteria 1996
106 Ga0157375_10459583 3300013308 Bacteria 1438
107 Ga0157380_10010298 3300014326 Bacteria 6722
108 Ga0157376_10163481 3300014969 Unclassified 2020
109 Ga0163161_10005857 3300017792 Bacteria 8520
110 Ga0207427_100083 3300025231 Bacteria 142745
111 Ga0209437_100021 3300025233 Bacteria 646400
112 Ga0209437_100119 3300025233 Bacteria 206549
113 Ga0209026_1000309 3300025250 Bacteria 53002
114 Ga0209233_1000035 3300025261 Bacteria 568478
115 Ga0209676_1000390 3300025292 Bacteria 80030
116 Ga0207682_10017546 3300025893 Bacteria 2796
117 Ga0207647_10000079 3300025904 Bacteria 72325
118 Ga0207647_10064637 3300025904 Bacteria 2223
119 Ga0207705_10000317 3300025909 Bacteria 43987
120 Ga0207705_10264925 3300025909 Bacteria 1313
121 Ga0207705_10291189 3300025909 Bacteria 1251
122 Ga0207654_10005879 3300025911 Bacteria 6182
123 Ga0207695_10000375 3300025913 Bacteria 101654
124 Ga0207695_10000863 3300025913 Bacteria 55452
125 Ga0207695_10004034 3300025913 Bacteria 20201
126 Ga0207695_10032339 3300025913 Bacteria 5726
127 Ga0207695_10037078 3300025913 Bacteria 5262
128 Ga0207695_10119068 3300025913 Bacteria 2611
129 Ga0207695_10150963 3300025913 Bacteria 2263
130 Ga0207671_10001824 3300025914 Bacteria 23769
131 Ga0207671_10007863 3300025914 Bacteria 9154
132 Ga0207671_10008275 3300025914 Bacteria 8846
133 Ga0207671_10017056 3300025914 Bacteria 5615
134 Ga0207671_10019967 3300025914 Bacteria 5111
135 Ga0207671_10069857 3300025914 Bacteria 2617
136 Ga0207660_10016026 3300025917 Bacteria 4955
137 Ga0207657_10065261 3300025919 Bacteria 3104
138 Ga0207652_10087617 3300025921 Bacteria 2730
139 Ga0207652_10132566 3300025921 Bacteria 2223
140 Ga0207694_10041539 3300025924 Bacteria 3544
141 Ga0207659_10179178 3300025926 Unclassified 1677
142 Ga0207690_10000235 3300025932 Bacteria 40691
143 Ga0207690_10016708 3300025932 Bacteria 4471
144 Ga0207709_10000008 3300025935 Bacteria 713099
145 Ga0207669_10079627 3300025937 Bacteria 2092
146 Ga0207704_10002123 3300025938 Bacteria 8889
147 Ga0207691_10004686 3300025940 Bacteria 13245
148 Ga0207691_10220066 3300025940 Unclassified 1646
149 Ga0207661_10042822 3300025944 Bacteria 3571
150 Ga0207667_10000033 3300025949 Bacteria 314353
151 Ga0207667_10078309 3300025949 Bacteria 3426
152 Ga0207667_10104571 3300025949 Bacteria 2920
153 Ga0207651_10000703 3300025960 Bacteria 14338
154 Ga0207677_10011718 3300026023 Bacteria 5008
155 Ga0207639_10008952 3300026041 Bacteria 6891
156 Ga0207639_10009858 3300026041 Bacteria 6598
157 Ga0207639_10194207 3300026041 Bacteria 1736
158 Ga0207702_10001166 3300026078 Bacteria 26828
159 Ga0207702_10213793 3300026078 Bacteria 1794
160 Ga0207648_10000081 3300026089 Bacteria 90676
161 Ga0207674_10015637 3300026116 Bacteria 8333
162 Ga0207674_10047380 3300026116 Bacteria 4407
163 Ga0207674_10111060 3300026116 Bacteria 2716
164 Ga0207683_10032196 3300026121 Bacteria 4554
165 Ga0207698_10006764 3300026142 Bacteria 7164
166 Ga0307517_10000207 3300028786 Bacteria 99774
167 Ga0307515_10000081 3300028794 Bacteria 224753
168 Ga0265338_10075541 3300028800 Bacteria 2859
169 Ga0265338_10121608 3300028800 Bacteria 2080
170 Ga0307509_10090264 3300031507 Bacteria 3140
171 Ga0307408_100000380 3300031548 Bacteria 40588
172 Ga0307408_100000889 3300031548 Bacteria 23506
173 Ga0307408_100002824 3300031548 Bacteria 12041
174 Ga0307405_10007607 3300031731 Bacteria 5434
175 Ga0307412_10047193 3300031911 Bacteria 2827
176 Ga0307416_100138433 3300032002 Bacteria 2207
177 Ga0307414_10017978 3300032004 Bacteria 4338
178 Ga0307414_10112138 3300032004 Bacteria 2078
179 Ga0307507_10000225 3300033179 Bacteria 107651
180 Ga0307510_10002075 3300033180 Bacteria 22642
181 Ga0395899_0000027 3300037312 Bacteria 337387
182 Ga0395899_0000325 3300037312 Bacteria 60438
183 Ga0395899_0087906 3300037312 Bacteria 2255
184 Ga0395900_0009378 3300037418 Bacteria 10035
185 Ga0395898_0027718 3300037466 Bacteria 5681
186 Ga0395905_0000993 3300037471 Bacteria 36305
187 Ga0395901_0004457 3300038443 Bacteria 14126
188 Ga0395901_0058423 3300038443 Bacteria 4012
189 Ga0466969_0004818 3300044656 Bacteria 7188
190 Ga0466961_0009665 3300044693 Bacteria 6140
191 Ga0453684_0140675 3300044712 Bacteria 2882
192 Ga0466959_0005764 3300045049 Bacteria 8525
193 Ga0466958_0070332 3300045836 Bacteria 2141
194 Ga0495638_0045296 3300046460 Bacteria 2768
195 Ga0495651_0111521 3300046462 Bacteria 2022
196 Ga0495650_0000081 3300046471 Bacteria 240957
197 Ga0495585_0000036 3300046492 Bacteria 135914
198 Ga0495585_0000323 3300046492 Bacteria 47094
199 Ga0495606_0000034 3300046507 Bacteria 247705
200 Ga0495606_0007621 3300046507 Bacteria 9623
201 Ga0495606_0013164 3300046507 Bacteria 6564
202 Ga0495606_0014321 3300046507 Bacteria 6201
203 Ga0495616_0006382 3300046513 Bacteria 7140
204 Ga0495631_0006584 3300046518 Bacteria 5984
205 Ga0495644_0002328 3300046523 Bacteria 7592
206 Ga0495648_0047205 3300046524 Bacteria 2663
207 Ga0495609_0002041 3300046538 Bacteria 12717
208 Ga0495609_0047772 3300046538 Bacteria 1914
209 Ga0495633_0002891 3300046558 Bacteria 11772
210 Ga0495633_0073239 3300046558 Unclassified 1597
211 Ga0495625_0000049 3300046660 Bacteria 197646
212 Ga0495625_0000462 3300046660 Bacteria 60985
213 Ga0495625_0042346 3300046660 Bacteria 3310
214 Ga0495625_0119925 3300046660 Bacteria 1791
215 Ga0495661_0001536 3300046665 Bacteria 19095
216 Ga0495661_0005633 3300046665 Bacteria 8883
217 Ga0495661_0049744 3300046665 Bacteria 2540
218 Ga0495658_0022373 3300046683 Bacteria 3342
219 Ga0495649_0000014 3300046694 Bacteria 287408
220 Ga0495660_0018533 3300046810 Bacteria 4002
221 Ga0495687_000249 3300047443 Bacteria 72846
222 Ga0495673_0024541 3300047469 Bacteria 2912
223 Ga0495686_0000005 3300047472 Bacteria 827143
224 Ga0495686_0000112 3300047472 Bacteria 168354
225 Ga0495686_0001755 3300047472 Bacteria 22226
226 Ga0496115_0002387 3300048918 Bacteria 13462
227 Ga0496116_0002219 3300048919 Bacteria 20656
228 Ga0496117_0001367 3300048920 Bacteria 35566
229 Ga0496122_0014979 3300048925 Bacteria 7453
230 Ga0496123_0012744 3300048926 Bacteria 7130
231 Ga0496124_0095455 3300048927 Bacteria 2417
232 Ga0495678_005004 3300049459 Bacteria 7467
233 Ga0501034_0091905 3300049571 Bacteria 3032
234 Ga0501034_0583374 3300049571 Bacteria 1025
235 Ga0501047_0266962 3300049581 Unclassified 1558
236 nmdc:mga0k408_244_c1 3300050493 Bacteria 29460
237 nmdc:mga0k408_3234_c1 3300050493 Bacteria 7818
238 nmdc:mga0k408_61_c1 3300050493 Bacteria 53671
239 Ga0500635_0000346 3300053080 Bacteria 15203
240 Ga0500608_032632 3300053122 Bacteria 2475
241 Ga0500608_033742 3300053122 Bacteria 2437
242 Ga0500618_000273 3300053125 Bacteria 39574
243 Ga0500642_0034995 3300053130 Bacteria 2129
244 Ga0500564_086142 3300053138 Bacteria 1403
245 Ga0500622_0005204 3300053156 Bacteria 7871
246 Ga0500622_0023898 3300053156 Bacteria 3235
247 Ga0500624_000406 3300053157 Bacteria 13355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0583374 Ga0501034_0583374_20_985 301
2 3300005289 Ga0065704_10216113 Ga0065704_102161131 306
3 3300003781 Ga0055536_1005678 Ga0055536_10056784 311
4 3300005262 Ga0065165_1000396 Ga0065165_100039640 311
5 3300025292 Ga0209676_1000390 Ga0209676_100039014 311
6 iso_pu_bacteria 2582581873 2585424429 312
7 3300005366 Ga0070659_100103894 Ga0070659_1001038943 313
8 3300005458 Ga0070681_10226176 Ga0070681_102261762 313
9 3300005530 Ga0070679_100012874 Ga0070679_1000128746 313
10 3300005563 Ga0068855_100008647 Ga0068855_1000086472 313
11 3300005577 Ga0068857_100108703 Ga0068857_1001087033 313
12 3300013102 Ga0157371_10004504 Ga0157371_100045043 313
13 3300013104 Ga0157370_10156019 Ga0157370_101560192 313
14 3300013105 Ga0157369_10061067 Ga0157369_100610674 313
15 3300013307 Ga0157372_10717046 Ga0157372_107170461 313
16 3300025917 Ga0207660_10016026 Ga0207660_100160264 313
17 3300025919 Ga0207657_10065261 Ga0207657_100652612 313
18 3300025921 Ga0207652_10132566 Ga0207652_101325662 313
19 3300025949 Ga0207667_10078309 Ga0207667_100783092 313
20 3300026041 Ga0207639_10194207 Ga0207639_101942073 313
21 3300026116 Ga0207674_10015637 Ga0207674_100156375 313
22 3300026116 Ga0207674_10047380 Ga0207674_100473802 313
23 3300049571 Ga0501034_0091905 Ga0501034_0091905_1434_2450 313
24 iso_pu_bacteria 2721755487 2722730979 316
25 iso_pu_bacteria 2904780799 2904783484 316
26 iso_pu_bacteria 2919177583 2919181350 316
27 iso_pu_bacteria 2852623160 2852626290 317
28 iso_pu_bacteria 2884933994 2884934741 317
29 iso_pu_bacteria 2919437846 2919440421 317
30 iso_pu_bacteria 2977232053 2977234196 317
31 3300003316 rootH1_10002264 rootH1_100022644 318
32 3300031731 Ga0307405_10007607 Ga0307405_100076073 318
33 3300032004 Ga0307414_10112138 Ga0307414_101121382 318
34 iso_pu_bacteria 2599185184 2599479912 318
35 iso_pu_bacteria 2928078545 2928081042 318
36 iso_pu_bacteria 2928147474 2928152541 318
37 iso_pu_bacteria 2932082852 2932087407 318
38 3300005333 Ga0070677_10022807 Ga0070677_100228072 319
39 3300005364 Ga0070673_100017110 Ga0070673_1000171102 319
40 3300005539 Ga0068853_100330694 Ga0068853_1003306942 319
41 3300005543 Ga0070672_100014302 Ga0070672_1000143025 319
42 3300005614 Ga0068856_100223027 Ga0068856_1002230273 319
43 3300005841 Ga0068863_100433005 Ga0068863_1004330052 319
44 3300009093 Ga0105240_10049244 Ga0105240_100492446 319
45 3300009545 Ga0105237_10033367 Ga0105237_100333672 319
46 3300010375 Ga0105239_10047290 Ga0105239_100472902 319
47 3300013308 Ga0157375_10459583 Ga0157375_104595831 319
48 3300014326 Ga0157380_10010298 Ga0157380_100102987 319
49 3300025893 Ga0207682_10017546 Ga0207682_100175461 319
50 3300025913 Ga0207695_10150963 Ga0207695_101509633 319
51 3300025914 Ga0207671_10069857 Ga0207671_100698572 319
52 3300025926 Ga0207659_10179178 Ga0207659_101791782 319
53 3300025937 Ga0207669_10079627 Ga0207669_100796271 319
54 3300025940 Ga0207691_10004686 Ga0207691_100046869 319
55 3300031507 Ga0307509_10090264 Ga0307509_100902642 319
56 3300044712 Ga0453684_0140675 Ga0453684_0140675_253_1281 319
57 3300046462 Ga0495651_0111521 Ga0495651_0111521_409_1377 319
58 3300048918 Ga0496115_0002387 Ga0496115_0002387_5368_6342 319
59 3300001990 JGI24737J22298_10007949 JGI24737J22298_100079492 320
60 3300002067 JGI24735J21928_10006019 JGI24735J21928_100060193 320
61 3300002737 JGI25162J39368_1000150 JGI25162J39368_10001505 320
62 3300002772 JGI25164J39214_1001658 JGI25164J39214_10016584 320
63 3300003214 JGI25165J46597_1000456 JGI25165J46597_100045624 320
64 3300003320 rootH2_10143544 rootH2_101435443 320
65 3300003323 rootH1_10012978 rootH1_100129789 320
66 3300003323 rootH1_10029695 rootH1_100296955 320
67 3300005289 Ga0065704_10071274 Ga0065704_100712743 320
68 3300005366 Ga0070659_100000090 Ga0070659_10000009040 320
69 3300005366 Ga0070659_100034870 Ga0070659_1000348703 320
70 3300005367 Ga0070667_100099528 Ga0070667_1000995281 320
71 3300005539 Ga0068853_100001650 Ga0068853_1000016507 320
72 3300005577 Ga0068857_100031261 Ga0068857_1000312614 320
73 3300005614 Ga0068856_100030534 Ga0068856_1000305342 320
74 3300009093 Ga0105240_10004869 Ga0105240_100048693 320
75 3300009093 Ga0105240_10006425 Ga0105240_100064253 320
76 3300009093 Ga0105240_10098627 Ga0105240_100986273 320
77 3300009148 Ga0105243_10000003 Ga0105243_10000003163 320
78 3300009551 Ga0105238_10047439 Ga0105238_100474393 320
79 3300010375 Ga0105239_10000015 Ga0105239_1000001523 320
80 3300010375 Ga0105239_10004591 Ga0105239_100045913 320
81 3300010375 Ga0105239_10027328 Ga0105239_100273283 320
82 3300013100 Ga0157373_10001353 Ga0157373_1000135316 320
83 3300013102 Ga0157371_10000342 Ga0157371_1000034230 320
84 3300013104 Ga0157370_10035633 Ga0157370_100356334 320
85 3300013307 Ga0157372_10000789 Ga0157372_1000078925 320
86 3300013307 Ga0157372_10006598 Ga0157372_100065986 320
87 3300025231 Ga0207427_100083 Ga0207427_10008379 320
88 3300025233 Ga0209437_100021 Ga0209437_100021338 320
89 3300025261 Ga0209233_1000035 Ga0209233_1000035300 320
90 3300025904 Ga0207647_10000079 Ga0207647_1000007946 320
91 3300025913 Ga0207695_10000863 Ga0207695_1000086343 320
92 3300025913 Ga0207695_10004034 Ga0207695_1000403416 320
93 3300025913 Ga0207695_10032339 Ga0207695_100323393 320
94 3300025932 Ga0207690_10000235 Ga0207690_100002352 320
95 3300025932 Ga0207690_10016708 Ga0207690_100167084 320
96 3300025935 Ga0207709_10000008 Ga0207709_10000008409 320
97 3300026041 Ga0207639_10009858 Ga0207639_100098584 320
98 3300026116 Ga0207674_10111060 Ga0207674_101110602 320
99 3300028800 Ga0265338_10121608 Ga0265338_101216082 320
100 3300031548 Ga0307408_100000380 Ga0307408_10000038015 320
101 3300031548 Ga0307408_100000889 Ga0307408_10000088923 320
102 3300031548 Ga0307408_100002824 Ga0307408_10000282415 320
103 3300031911 Ga0307412_10047193 Ga0307412_100471932 320
104 3300032002 Ga0307416_100138433 Ga0307416_1001384332 320
105 3300032004 Ga0307414_10017978 Ga0307414_100179782 320
106 3300038443 Ga0395901_0058423 Ga0395901_0058423_2852_3829 320
107 3300047472 Ga0495686_0000005 Ga0495686_0000005_513211_514233 320
108 3300047472 Ga0495686_0001755 Ga0495686_0001755_11888_12850 320
109 3300048919 Ga0496116_0002219 Ga0496116_0002219_18580_19551 320
110 3300048920 Ga0496117_0001367 Ga0496117_0001367_9011_9982 320
111 3300048925 Ga0496122_0014979 Ga0496122_0014979_203_1174 320
112 3300048926 Ga0496123_0012744 Ga0496123_0012744_5518_6489 320
113 3300048927 Ga0496124_0095455 Ga0496124_0095455_775_1746 320
114 3300053080 Ga0500635_0000346 Ga0500635_0000346_6953_7918 320
115 3300003320 rootH2_10139916 rootH2_101399163 321
116 3300004799 Ga0058863_11859864 Ga0058863_118598642 321
117 3300004800 Ga0058861_10005061 Ga0058861_100050611 321
118 3300004803 Ga0058862_10002974 Ga0058862_100029742 321
119 3300005327 Ga0070658_10000290 Ga0070658_1000029018 321
120 3300005327 Ga0070658_10302263 Ga0070658_103022631 321
121 3300005329 Ga0070683_100055508 Ga0070683_1000555082 321
122 3300005338 Ga0068868_100082833 Ga0068868_1000828332 321
123 3300005364 Ga0070673_100003034 Ga0070673_1000030349 321
124 3300005456 Ga0070678_100018215 Ga0070678_1000182153 321
125 3300005459 Ga0068867_100002365 Ga0068867_10000236511 321
126 3300005530 Ga0070679_100021503 Ga0070679_1000215032 321
127 3300005543 Ga0070672_100219245 Ga0070672_1002192452 321
128 3300005563 Ga0068855_100000060 Ga0068855_10000006075 321
129 3300005563 Ga0068855_100060218 Ga0068855_1000602182 321
130 3300005614 Ga0068856_100000040 Ga0068856_10000004017 321
131 3300005616 Ga0068852_100000452 Ga0068852_10000045223 321
132 3300005718 Ga0068866_10110980 Ga0068866_101109801 321
133 3300006195 Ga0075366_10000248 Ga0075366_100002487 321
134 3300006195 Ga0075366_10001601 Ga0075366_1000160114 321
135 3300006237 Ga0097621_100000652 Ga0097621_1000006527 321
136 3300006358 Ga0068871_100009169 Ga0068871_1000091695 321
137 3300006881 Ga0068865_100003763 Ga0068865_1000037635 321
138 3300009093 Ga0105240_10000277 Ga0105240_1000027763 321
139 3300009093 Ga0105240_10049898 Ga0105240_100498984 321
140 3300009093 Ga0105240_10235633 Ga0105240_102356333 321
141 3300009093 Ga0105240_10299112 Ga0105240_102991123 321
142 3300009174 Ga0105241_10002359 Ga0105241_100023594 321
143 3300009545 Ga0105237_10000109 Ga0105237_1000010970 321
144 3300009545 Ga0105237_10002243 Ga0105237_1000224313 321
145 3300009545 Ga0105237_10003032 Ga0105237_1000303213 321
146 3300009545 Ga0105237_10004759 Ga0105237_100047593 321
147 3300009551 Ga0105238_10001074 Ga0105238_1000107414 321
148 3300010375 Ga0105239_10001267 Ga0105239_100012677 321
149 3300010375 Ga0105239_10001661 Ga0105239_1000166112 321
150 3300010375 Ga0105239_10022807 Ga0105239_100228073 321
151 3300010375 Ga0105239_10049382 Ga0105239_100493824 321
152 3300010375 Ga0105239_10429475 Ga0105239_104294752 321
153 3300013100 Ga0157373_10000063 Ga0157373_1000006374 321
154 3300013102 Ga0157371_10004024 Ga0157371_100040249 321
155 3300013105 Ga0157369_10001079 Ga0157369_1000107931 321
156 3300013296 Ga0157374_10000450 Ga0157374_1000045020 321
157 3300013297 Ga0157378_10009974 Ga0157378_100099745 321
158 3300013297 Ga0157378_10016996 Ga0157378_100169965 321
159 3300013307 Ga0157372_10000039 Ga0157372_10000039147 321
160 3300013307 Ga0157372_10001250 Ga0157372_100012506 321
161 3300013308 Ga0157375_10234054 Ga0157375_102340541 321
162 3300014969 Ga0157376_10163481 Ga0157376_101634811 321
163 3300017792 Ga0163161_10005857 Ga0163161_100058576 321
164 3300025233 Ga0209437_100119 Ga0209437_1001197 321
165 3300025250 Ga0209026_1000309 Ga0209026_100030927 321
166 3300025909 Ga0207705_10000317 Ga0207705_1000031718 321
167 3300025909 Ga0207705_10264925 Ga0207705_102649251 321
168 3300025909 Ga0207705_10291189 Ga0207705_102911892 321
169 3300025911 Ga0207654_10005879 Ga0207654_100058794 321
170 3300025913 Ga0207695_10000375 Ga0207695_1000037562 321
171 3300025913 Ga0207695_10037078 Ga0207695_100370784 321
172 3300025913 Ga0207695_10119068 Ga0207695_101190683 321
173 3300025914 Ga0207671_10001824 Ga0207671_100018249 321
174 3300025914 Ga0207671_10007863 Ga0207671_100078634 321
175 3300025914 Ga0207671_10008275 Ga0207671_100082752 321
176 3300025914 Ga0207671_10017056 Ga0207671_100170566 321
177 3300025914 Ga0207671_10019967 Ga0207671_100199674 321
178 3300025921 Ga0207652_10087617 Ga0207652_100876172 321
179 3300025924 Ga0207694_10041539 Ga0207694_100415394 321
180 3300025938 Ga0207704_10002123 Ga0207704_100021233 321
181 3300025940 Ga0207691_10220066 Ga0207691_102200662 321
182 3300025944 Ga0207661_10042822 Ga0207661_100428224 321
183 3300025949 Ga0207667_10000033 Ga0207667_10000033214 321
184 3300025960 Ga0207651_10000703 Ga0207651_100007033 321
185 3300026023 Ga0207677_10011718 Ga0207677_100117183 321
186 3300026041 Ga0207639_10008952 Ga0207639_100089525 321
187 3300026078 Ga0207702_10001166 Ga0207702_100011668 321
188 3300026078 Ga0207702_10213793 Ga0207702_102137932 321
189 3300026089 Ga0207648_10000081 Ga0207648_1000008168 321
190 3300026121 Ga0207683_10032196 Ga0207683_100321963 321
191 3300026142 Ga0207698_10006764 Ga0207698_100067644 321
192 3300028786 Ga0307517_10000207 Ga0307517_100002073 321
193 3300028794 Ga0307515_10000081 Ga0307515_100000818 321
194 3300028800 Ga0265338_10075541 Ga0265338_100755413 321
195 3300033179 Ga0307507_10000225 Ga0307507_100002257 321
196 3300033180 Ga0307510_10002075 Ga0307510_1000207510 321
197 3300037312 Ga0395899_0000027 Ga0395899_0000027_238788_239756 321
198 3300037312 Ga0395899_0000325 Ga0395899_0000325_1002_1970 321
199 3300037312 Ga0395899_0087906 Ga0395899_0087906_574_1539 321
200 3300037418 Ga0395900_0009378 Ga0395900_0009378_8547_9512 321
201 3300037466 Ga0395898_0027718 Ga0395898_0027718_3522_4487 321
202 3300037471 Ga0395905_0000993 Ga0395905_0000993_13487_14452 321
203 3300038443 Ga0395901_0004457 Ga0395901_0004457_10370_11335 321
204 3300044656 Ga0466969_0004818 Ga0466969_0004818_3820_4788 321
205 3300044693 Ga0466961_0009665 Ga0466961_0009665_3609_4577 321
206 3300045049 Ga0466959_0005764 Ga0466959_0005764_4463_5431 321
207 3300045836 Ga0466958_0070332 Ga0466958_0070332_115_1083 321
208 3300046460 Ga0495638_0045296 Ga0495638_0045296_53_1021 321
209 3300046492 Ga0495585_0000323 Ga0495585_0000323_2591_3559 321
210 3300046507 Ga0495606_0007621 Ga0495606_0007621_4837_5802 321
211 3300046507 Ga0495606_0013164 Ga0495606_0013164_3653_4621 321
212 3300046507 Ga0495606_0014321 Ga0495606_0014321_4064_5029 321
213 3300046513 Ga0495616_0006382 Ga0495616_0006382_1940_2908 321
214 3300046518 Ga0495631_0006584 Ga0495631_0006584_1166_2137 321
215 3300046523 Ga0495644_0002328 Ga0495644_0002328_4074_5051 321
216 3300046524 Ga0495648_0047205 Ga0495648_0047205_192_1160 321
217 3300046538 Ga0495609_0002041 Ga0495609_0002041_11301_12269 321
218 3300046558 Ga0495633_0073239 Ga0495633_0073239_280_1257 321
219 3300046660 Ga0495625_0000462 Ga0495625_0000462_19619_20587 321
220 3300046660 Ga0495625_0042346 Ga0495625_0042346_770_1738 321
221 3300046660 Ga0495625_0119925 Ga0495625_0119925_183_1148 321
222 3300046665 Ga0495661_0001536 Ga0495661_0001536_15563_16591 321
223 3300046665 Ga0495661_0049744 Ga0495661_0049744_178_1167 321
224 3300046683 Ga0495658_0022373 Ga0495658_0022373_196_1164 321
225 3300046810 Ga0495660_0018533 Ga0495660_0018533_2217_3182 321
226 3300047472 Ga0495686_0000112 Ga0495686_0000112_67025_67990 321
227 3300049459 Ga0495678_005004 Ga0495678_005004_1022_1990 321
228 3300049581 Ga0501047_0266962 Ga0501047_0266962_365_1405 321
229 3300050493 nmdc:mga0k408_244_c1 nmdc:mga0k408_244_c1_5510_6478 321
230 3300050493 nmdc:mga0k408_61_c1 nmdc:mga0k408_61_c1_43322_44290 321
231 3300053122 Ga0500608_032632 Ga0500608_032632_1064_2035 321
232 3300053122 Ga0500608_033742 Ga0500608_033742_974_1939 321
233 3300053125 Ga0500618_000273 Ga0500618_000273_8551_9516 321
234 3300053130 Ga0500642_0034995 Ga0500642_0034995_786_1754 321
235 3300053138 Ga0500564_086142 Ga0500564_086142_389_1354 321
236 3300053156 Ga0500622_0005204 Ga0500622_0005204_4235_5203 321
237 3300053157 Ga0500624_000406 Ga0500624_000406_4318_5283 321
238 3300001989 JGI24739J22299_10030155 JGI24739J22299_100301551 322
239 3300001989 JGI24739J22299_10035801 JGI24739J22299_100358012 322
240 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000749 322
241 3300003320 rootH2_10295576 rootH2_102955762 322
242 3300005563 Ga0068855_100068372 Ga0068855_1000683723 322
243 3300006195 Ga0075366_10002675 Ga0075366_100026756 322
244 3300013102 Ga0157371_10053058 Ga0157371_100530582 322
245 3300013307 Ga0157372_10014817 Ga0157372_100148174 322
246 3300025904 Ga0207647_10064637 Ga0207647_100646372 322
247 3300025949 Ga0207667_10104571 Ga0207667_101045712 322
248 3300046471 Ga0495650_0000081 Ga0495650_0000081_197174_198142 322
249 3300046492 Ga0495585_0000036 Ga0495585_0000036_100261_101424 322
250 3300046507 Ga0495606_0000034 Ga0495606_0000034_211662_212630 322
251 3300046538 Ga0495609_0047772 Ga0495609_0047772_362_1330 322
252 3300046558 Ga0495633_0002891 Ga0495633_0002891_9493_10527 322
253 3300046660 Ga0495625_0000049 Ga0495625_0000049_141173_142216 322
254 3300046665 Ga0495661_0005633 Ga0495661_0005633_2937_3905 322
255 3300046694 Ga0495649_0000014 Ga0495649_0000014_54842_55885 322
256 3300047443 Ga0495687_000249 Ga0495687_000249_37759_38727 322
257 3300047469 Ga0495673_0024541 Ga0495673_0024541_1884_2852 322
258 3300050493 nmdc:mga0k408_3234_c1 nmdc:mga0k408_3234_c1_980_1948 322
259 3300053156 Ga0500622_0023898 Ga0500622_0023898_1636_2679 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

67

188

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

68

243

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

67

294

0.82

PF08659

KR

KR domain

66

197

0.82

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

68

318

0.81

PF07993

NAD_binding_4

Male sterility protein

121

289

0.81

PF04321

RmlD_sub_bind

RmlD substrate binding domain

65

256

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

71

285

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly1.cif.gz_B mouse tdh mutant r180k with nad+ bound 0.8669 2 230
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8658 2 320
2pzl-assembly1.cif.gz_B crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp 0.8604 2 320
2q1w-assembly1.cif.gz_B crystal structure of the bordetella bronchiseptica enzyme wbmh in complex with nad+ 0.8599 2 320
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8586 1 320
ID Description Score Start End Superfamily
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8903 2 321 3.40.50.720
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8898 2 321 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8824 2 321 3.40.50.720
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8821 2 321 3.40.50.720
af_O43050_3_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8807 2 321 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V1ZS55-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9899 1 120 GO:0016616
AF-A0A4Q3U4V7-F1-model_v4 deleted 0.9843 1 322
AF-A0A4V1ZS55-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9818 1 120 GO:0016616
AF-A0A4Q3U4V7-F1-model_v4 deleted 0.9813 1 322
AF-A0A519NZM3-F1-model_v4 deleted 0.9709 1 259

Feature Viewer

pLDDT pTM Quality
88.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map