F369014

General Info

Members Datasets Scaffolds Average Seq Length
259 172 519 256

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0002070|Ga0466959_0002070_6622_7473
Length 283
Sequence MRTSKTRALGRFLLAAVVECVLVTGAAALLTPVHAAEDGGGASADKETAKEGWGSDWKTWRAGTDVESIASLQRGARNFANYCLGCHSLKYERWSRMAKDLDIPEEILTKDVLPPGDKPANYILTSMPAADAETWFGKTPPDLSLMARARGKDYLYRFLTTFYIDPTRPTNANNLQLPATAMPAVLSELEGVKRAVYKNQETQGAEGKTTTEPVFDHFEQVAPGRLTRAEYEGFVRDTVNFLDYVGEPAQAARRSLGIWVVLFLLVFTWLAWLMKKEFWKDVH

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0
Rhizoplane 5.79
Rhizosphere 83.01
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0002070 3300045049 Bacteria 12688
2 JGI25406J46586_10066168 3300003203 Unclassified 1149
3 rootH1_10059324 3300003316 Bacteria 3735
4 rootH1_10059324 3300003323 Bacteria 1311
5 rootH1_10155473 3300003323 Unclassified 1155
6 Ga0058863_11975410 3300004799 Bacteria 1707
7 Ga0070658_10307154 3300005327 Bacteria 1353
8 Ga0070683_100351819 3300005329 Bacteria 1403
9 Ga0070670_100131796 3300005331 Bacteria 2159
10 Ga0070666_10017924 3300005335 Bacteria 4543
11 Ga0070680_100124818 3300005336 Bacteria 2150
12 Ga0068868_100261860 3300005338 Bacteria 1458
13 Ga0070661_100057573 3300005344 Bacteria 2848
14 Ga0070668_100235014 3300005347 Bacteria 1517
15 Ga0070671_100002044 3300005355 Bacteria 15550
16 Ga0070671_100014590 3300005355 Bacteria 6354
17 Ga0070671_100139071 3300005355 Bacteria 2048
18 Ga0070673_100076718 3300005364 Bacteria 2699
19 Ga0070659_100172129 3300005366 Bacteria 1774
20 Ga0070667_100026627 3300005367 Bacteria 4810
21 Ga0070714_100203488 3300005435 Bacteria 1812
22 Ga0070713_100050853 3300005436 Bacteria 3425
23 Ga0070713_100121612 3300005436 Bacteria 2291
24 Ga0070711_100007645 3300005439 Bacteria 6581
25 Ga0070663_100079349 3300005455 Bacteria 2408
26 Ga0070678_100017265 3300005456 Bacteria 4642
27 Ga0070681_10002406 3300005458 Bacteria 17107
28 Ga0070681_10011204 3300005458 Bacteria 8871
29 Ga0070681_10022664 3300005458 Bacteria 6309
30 Ga0070681_10030726 3300005458 Bacteria 5390
31 Ga0070681_10162900 3300005458 Bacteria 2154
32 Ga0068867_100242952 3300005459 Bacteria 1461
33 Ga0070699_100019105 3300005518 Bacteria 5896
34 Ga0070699_100057624 3300005518 Bacteria 3365
35 Ga0070679_100007834 3300005530 Bacteria 10016
36 Ga0070679_100064855 3300005530 Bacteria 3641
37 Ga0070679_100150152 3300005530 Bacteria 2307
38 Ga0070679_100172646 3300005530 Bacteria 2135
39 Ga0070684_100374933 3300005535 Bacteria 1310
40 Ga0070697_100577130 3300005536 Bacteria 987
41 Ga0068853_100067000 3300005539 Bacteria 3118
42 Ga0070695_100051540 3300005545 Bacteria 2641
43 Ga0070695_100235803 3300005545 Bacteria 1325
44 Ga0070665_100010229 3300005548 Bacteria 9490
45 Ga0070665_100033266 3300005548 Bacteria 5188
46 Ga0068855_100000693 3300005563 Bacteria 41175
47 Ga0068857_100362261 3300005577 Bacteria 1344
48 Ga0068856_100632813 3300005614 Unclassified 1090
49 Ga0068852_100768612 3300005616 Bacteria 976
50 Ga0068859_100004269 3300005617 Bacteria 14594
51 Ga0068859_100079356 3300005617 Bacteria 3322
52 Ga0068859_100123469 3300005617 Bacteria 2657
53 Ga0068864_100248703 3300005618 Bacteria 1650
54 Ga0068861_100049112 3300005719 Bacteria 3193
55 Ga0068863_100005874 3300005841 Bacteria 12025
56 Ga0068863_100102929 3300005841 Bacteria 2715
57 Ga0068863_100312468 3300005841 Bacteria 1525
58 Ga0068858_100040515 3300005842 Bacteria 4320
59 Ga0068858_100050382 3300005842 Bacteria 3854
60 Ga0068860_100002783 3300005843 Bacteria 18194
61 Ga0068860_100006103 3300005843 Bacteria 12122
62 Ga0068860_100010956 3300005843 Bacteria 8938
63 Ga0068862_100007487 3300005844 Bacteria 9050
64 Ga0081455_10003109 3300005937 Bacteria 19318
65 Ga0081539_10000006 3300005985 Bacteria 534555
66 Ga0070715_10009769 3300006163 Bacteria 3394
67 Ga0070716_100051872 3300006173 Bacteria 2334
68 Ga0097621_100093108 3300006237 Bacteria 2525
69 Ga0097621_100196036 3300006237 Bacteria 1751
70 Ga0068871_100161016 3300006358 Bacteria 1919
71 Ga0068865_100010147 3300006881 Bacteria 5854
72 Ga0097620_100004269 3300006931 Bacteria 14594
73 Ga0097620_100079356 3300006931 Bacteria 3322
74 Ga0097620_100123469 3300006931 Bacteria 2657
75 Ga0105250_10016668 3300009092 Bacteria 2992
76 Ga0105240_10023692 3300009093 Bacteria 8108
77 Ga0105240_10031702 3300009093 Bacteria 6849
78 Ga0105240_10035090 3300009093 Bacteria 6467
79 Ga0105240_10037232 3300009093 Bacteria 6253
80 Ga0105240_10235921 3300009093 Bacteria 2123
81 Ga0105245_10031378 3300009098 Bacteria 4702
82 Ga0105247_10002396 3300009101 Bacteria 12742
83 Ga0105247_10011198 3300009101 Bacteria 5409
84 Ga0105247_10025912 3300009101 Bacteria 3539
85 Ga0105247_10104096 3300009101 Bacteria 1818
86 Ga0105241_10023688 3300009174 Bacteria 4554
87 Ga0105241_10053053 3300009174 Bacteria 3099
88 Ga0105241_10117002 3300009174 Bacteria 2141
89 Ga0105241_10241705 3300009174 Bacteria 1526
90 Ga0105248_10006682 3300009177 Bacteria 12658
91 Ga0105248_10032414 3300009177 Bacteria 5839
92 Ga0105237_10098779 3300009545 Bacteria 2910
93 Ga0105237_10218940 3300009545 Bacteria 1904
94 Ga0105237_10233659 3300009545 Bacteria 1840
95 Ga0105237_10267126 3300009545 Bacteria 1714
96 Ga0105238_10038530 3300009551 Bacteria 4854
97 Ga0105238_10075125 3300009551 Bacteria 3371
98 Ga0105238_10293343 3300009551 Bacteria 1609
99 Ga0105238_10411010 3300009551 Bacteria 1347
100 Ga0105238_10491210 3300009551 Unclassified 1228
101 Ga0099796_10010393 3300010159 Bacteria 2558
102 Ga0105239_10055198 3300010375 Bacteria 4357
103 Ga0105239_10094464 3300010375 Bacteria 3303
104 Ga0105239_10113990 3300010375 Bacteria 2998
105 Ga0105239_10596223 3300010375 Bacteria 1260
106 Ga0105246_10025319 3300011119 Bacteria 3867
107 Ga0157369_10028051 3300013105 Bacteria 6234
108 Ga0157369_10081722 3300013105 Bacteria 3458
109 Ga0157374_10039302 3300013296 Bacteria 4354
110 Ga0157378_10166273 3300013297 Bacteria 2066
111 Ga0163162_10200920 3300013306 Bacteria 2122
112 Ga0163162_10261528 3300013306 Bacteria 1862
113 Ga0157372_10175662 3300013307 Bacteria 2479
114 Ga0157375_10135054 3300013308 Bacteria 2589
115 Ga0163163_10365635 3300014325 Bacteria 1499
116 Ga0157379_10017145 3300014968 Bacteria 6378
117 Ga0157379_10038581 3300014968 Bacteria 4262
118 Ga0157379_10044805 3300014968 Bacteria 3949
119 Ga0157379_10081594 3300014968 Bacteria 2897
120 Ga0157379_10222475 3300014968 Bacteria 1710
121 Ga0207682_10108791 3300025893 Bacteria 1218
122 Ga0207710_10031596 3300025900 Bacteria 2316
123 Ga0207710_10159296 3300025900 Bacteria 1099
124 Ga0207680_10019766 3300025903 Bacteria 3609
125 Ga0207680_10038488 3300025903 Bacteria 2768
126 Ga0207647_10041893 3300025904 Bacteria 2876
127 Ga0207654_10049615 3300025911 Bacteria 2408
128 Ga0207707_10033099 3300025912 Bacteria 4523
129 Ga0207707_10075338 3300025912 Bacteria 2944
130 Ga0207707_10118502 3300025912 Bacteria 2314
131 Ga0207707_10128276 3300025912 Bacteria 2218
132 Ga0207707_10202593 3300025912 Bacteria 1730
133 Ga0207695_10013779 3300025913 Bacteria 9620
134 Ga0207695_10031315 3300025913 Bacteria 5836
135 Ga0207695_10064476 3300025913 Bacteria 3772
136 Ga0207695_10121366 3300025913 Bacteria 2581
137 Ga0207695_10134262 3300025913 Bacteria 2429
138 Ga0207695_10636071 3300025913 Bacteria 948
139 Ga0207671_10050642 3300025914 Bacteria 3075
140 Ga0207693_10013728 3300025915 Bacteria 6526
141 Ga0207663_10150047 3300025916 Bacteria 1634
142 Ga0207660_10081676 3300025917 Bacteria 2376
143 Ga0207652_10121534 3300025921 Bacteria 2324
144 Ga0207652_10151952 3300025921 Bacteria 2073
145 Ga0207652_10183945 3300025921 Bacteria 1879
146 Ga0207694_10081865 3300025924 Bacteria 2537
147 Ga0207694_10284930 3300025924 Bacteria 1358
148 Ga0207650_10119174 3300025925 Bacteria 2052
149 Ga0207687_10027344 3300025927 Bacteria 3827
150 Ga0207700_10104244 3300025928 Bacteria 2269
151 Ga0207664_10048404 3300025929 Bacteria 3342
152 Ga0207644_10000718 3300025931 Bacteria 20967
153 Ga0207690_10105619 3300025932 Bacteria 2020
154 Ga0207686_10099382 3300025934 Bacteria 1939
155 Ga0207704_10147710 3300025938 Bacteria 1654
156 Ga0207665_10014391 3300025939 Bacteria 5210
157 Ga0207711_10031958 3300025941 Bacteria 4447
158 Ga0207661_10149436 3300025944 Bacteria 2018
159 Ga0207661_10280375 3300025944 Bacteria 1489
160 Ga0207679_10127714 3300025945 Bacteria 2035
161 Ga0207667_10001288 3300025949 Bacteria 31396
162 Ga0207651_10268259 3300025960 Bacteria 1405
163 Ga0207658_10018687 3300025986 Bacteria 4791
164 Ga0207658_10354441 3300025986 Unclassified 1278
165 Ga0207677_10055139 3300026023 Bacteria 2716
166 Ga0207703_10002459 3300026035 Bacteria 16067
167 Ga0207703_10003580 3300026035 Bacteria 12982
168 Ga0207703_10359693 3300026035 Bacteria 1342
169 Ga0207639_10044358 3300026041 Bacteria 3344
170 Ga0207702_10141412 3300026078 Bacteria 2178
171 Ga0207641_10001033 3300026088 Bacteria 28219
172 Ga0207641_10022126 3300026088 Bacteria 5231
173 Ga0207641_10201245 3300026088 Bacteria 1836
174 Ga0207641_10387994 3300026088 Bacteria 1339
175 Ga0207648_10044179 3300026089 Bacteria 3909
176 Ga0207676_10256051 3300026095 Bacteria 1578
177 Ga0207676_10649099 3300026095 Bacteria 1018
178 Ga0207674_10140198 3300026116 Bacteria 2377
179 Ga0207675_100355663 3300026118 Bacteria 1436
180 Ga0207683_10029826 3300026121 Bacteria 4723
181 Ga0207698_10470968 3300026142 Bacteria 1216
182 Ga0268266_10002891 3300028379 Bacteria 17806
183 Ga0268266_10009044 3300028379 Bacteria 8805
184 Ga0268266_10030245 3300028379 Bacteria 4602
185 Ga0268265_10006613 3300028380 Bacteria 7847
186 Ga0268264_10000198 3300028381 Bacteria 122906
187 Ga0307511_10000048 3300030521 Bacteria 98665
188 Ga0307511_10051826 3300030521 Bacteria 3282
189 Ga0265331_10032832 3300031250 Bacteria 2569
190 Ga0307509_10000017 3300031507 Bacteria 265012
191 Ga0307509_10167955 3300031507 Bacteria 2079
192 Ga0307508_10051590 3300031616 Bacteria 3656
193 Ga0307416_100217557 3300032002 Bacteria 1829
194 Ga0373923_0037125 3300035111 Bacteria 1992
195 Ga0373923_0073991 3300035111 Bacteria 1468
196 Ga0373936_0032708 3300035113 Bacteria 2058
197 Ga0373943_0067140 3300035170 Bacteria 1808
198 Ga0373955_0065747 3300035172 Bacteria 2014
199 Ga0373927_0013086 3300035695 Bacteria 5519
200 Ga0373925_0105640 3300037068 Bacteria 2170
201 Ga0436365_1228919 3300039437 Bacteria 4161
202 Ga0436360_0308723 3300039438 Bacteria 2114
203 Ga0436363_0375975 3300039450 Bacteria 36949
204 Ga0451793_0943887 3300041452 Bacteria 1092
205 Ga0466969_0007427 3300044656 Bacteria 5820
206 Ga0466966_0001723 3300044684 Bacteria 14140
207 Ga0466961_0024185 3300044693 Bacteria 3906
208 Ga0466964_0002311 3300044706 Bacteria 6759
209 Ga0453684_0234175 3300044712 Bacteria 2118
210 Ga0453684_0512319 3300044712 Bacteria 1327
211 Ga0466971_0018740 3300044719 Bacteria 3068
212 Ga0466970_0003266 3300044765 Bacteria 7881
213 Ga0466957_0087005 3300044842 Bacteria 1953
214 Ga0466959_0000251 3300045049 Bacteria 33248
215 Ga0466959_0013496 3300045049 Bacteria 5920
216 Ga0495580_0041783 3300046472 Bacteria 3268
217 Ga0495618_0095239 3300046514 Bacteria 1904
218 Ga0495628_0145668 3300046516 Bacteria 1806
219 Ga0495632_0007088 3300046519 Bacteria 7100
220 Ga0495667_0290804 3300046559 Bacteria 1036
221 Ga0495611_0091246 3300046648 Bacteria 1408
222 Ga0495671_0112643 3300046692 Bacteria 1328
223 Ga0495684_0510684 3300047471 Bacteria 825
224 Ga0496100_0176763 3300048903 Bacteria 1541
225 Ga0496102_0032481 3300048905 Bacteria 4688
226 Ga0496102_0068177 3300048905 Bacteria 3264
227 Ga0496103_0216056 3300048906 Bacteria 1233
228 Ga0496105_0130108 3300048908 Bacteria 2075
229 Ga0496106_0107207 3300048909 Bacteria 2172
230 Ga0496106_0364414 3300048909 Bacteria 1161
231 Ga0496107_0219113 3300048910 Bacteria 1415
232 Ga0496108_0015061 3300048911 Bacteria 6313
233 Ga0496109_0191042 3300048912 Bacteria 1924
234 Ga0496110_0064656 3300048913 Bacteria 3233
235 Ga0496113_0152657 3300048916 Bacteria 1823
236 Ga0496114_0099255 3300048917 Bacteria 2483
237 Ga0496115_0197624 3300048918 Bacteria 1661
238 Ga0496118_0176477 3300048921 Bacteria 1297
239 Ga0496119_0007919 3300048922 Bacteria 9457
240 Ga0496119_0017487 3300048922 Bacteria 5389
241 Ga0496120_0000543 3300048923 Bacteria 57596
242 Ga0496120_0127510 3300048923 Bacteria 1307
243 Ga0496121_0017445 3300048924 Bacteria 7334
244 Ga0496125_0002765 3300048928 Bacteria 22202
245 Ga0496125_0072194 3300048928 Bacteria 2691
246 Ga0496126_0002846 3300048929 Bacteria 22635
247 Ga0496126_0152494 3300048929 Bacteria 1980
248 Ga0495612_0043484 3300053078 Bacteria 1836
249 Ga0495595_0067417 3300053084 Bacteria 1687
250 Ga0500583_0178979 3300053092 Bacteria 1056
251 Ga0500556_0000455 3300053104 Bacteria 28996
252 Ga0500562_018657 3300053108 Bacteria 1791
253 Ga0500591_033555 3300053115 Bacteria 2470
254 Ga0500614_017904 3300053123 Bacteria 1607
255 Ga0500588_0001866 3300053146 Bacteria 4123
256 Ga0500616_0013880 3300053153 Bacteria 4651
257 Ga0500639_034353 3300053163 Bacteria 2680
258 Ga0500637_0009662 3300053178 Bacteria 4919
259 Ga0500611_004807 3300053727 Bacteria 1851
260 Ga0466962_0008818 3300061719 Bacteria 4832
261 Ga0466959_0002070
262 JGI25406J46586_10066168
263 rootH1_10059324
264 rootH1_10155473
265 Ga0058863_11975410
266 Ga0070658_10307154
267 Ga0070683_100351819
268 Ga0070670_100131796
269 Ga0070666_10017924
270 Ga0070680_100124818
271 Ga0068868_100261860
272 Ga0070661_100057573
273 Ga0070668_100235014
274 Ga0070671_100002044
275 Ga0070671_100014590
276 Ga0070671_100139071
277 Ga0070673_100076718
278 Ga0070659_100172129
279 Ga0070667_100026627
280 Ga0070714_100203488
281 Ga0070713_100050853
282 Ga0070713_100121612
283 Ga0070711_100007645
284 Ga0070663_100079349
285 Ga0070678_100017265
286 Ga0070681_10002406
287 Ga0070681_10011204
288 Ga0070681_10022664
289 Ga0070681_10030726
290 Ga0070681_10162900
291 Ga0068867_100242952
292 Ga0070699_100019105
293 Ga0070699_100057624
294 Ga0070679_100007834
295 Ga0070679_100064855
296 Ga0070679_100150152
297 Ga0070679_100172646
298 Ga0070684_100374933
299 Ga0070697_100577130
300 Ga0068853_100067000
301 Ga0070695_100051540
302 Ga0070695_100235803
303 Ga0070665_100010229
304 Ga0070665_100033266
305 Ga0068855_100000693
306 Ga0068857_100362261
307 Ga0068856_100632813
308 Ga0068852_100768612
309 Ga0068859_100004269
310 Ga0068859_100079356
311 Ga0068859_100123469
312 Ga0068864_100248703
313 Ga0068861_100049112
314 Ga0068863_100005874
315 Ga0068863_100102929
316 Ga0068863_100312468
317 Ga0068858_100040515
318 Ga0068858_100050382
319 Ga0068860_100002783
320 Ga0068860_100006103
321 Ga0068860_100010956
322 Ga0068862_100007487
323 Ga0081455_10003109
324 Ga0081539_10000006
325 Ga0070715_10009769
326 Ga0070716_100051872
327 Ga0097621_100093108
328 Ga0097621_100196036
329 Ga0068871_100161016
330 Ga0068865_100010147
331 Ga0097620_100004269
332 Ga0097620_100079356
333 Ga0097620_100123469
334 Ga0105250_10016668
335 Ga0105240_10023692
336 Ga0105240_10031702
337 Ga0105240_10035090
338 Ga0105240_10037232
339 Ga0105240_10235921
340 Ga0105245_10031378
341 Ga0105247_10002396
342 Ga0105247_10011198
343 Ga0105247_10025912
344 Ga0105247_10104096
345 Ga0105241_10023688
346 Ga0105241_10053053
347 Ga0105241_10117002
348 Ga0105241_10241705
349 Ga0105248_10006682
350 Ga0105248_10032414
351 Ga0105237_10098779
352 Ga0105237_10218940
353 Ga0105237_10233659
354 Ga0105237_10267126
355 Ga0105238_10038530
356 Ga0105238_10075125
357 Ga0105238_10293343
358 Ga0105238_10411010
359 Ga0105238_10491210
360 Ga0099796_10010393
361 Ga0105239_10055198
362 Ga0105239_10094464
363 Ga0105239_10113990
364 Ga0105239_10596223
365 Ga0105246_10025319
366 Ga0157369_10028051
367 Ga0157369_10081722
368 Ga0157374_10039302
369 Ga0157378_10166273
370 Ga0163162_10200920
371 Ga0163162_10261528
372 Ga0157372_10175662
373 Ga0157375_10135054
374 Ga0163163_10365635
375 Ga0157379_10017145
376 Ga0157379_10038581
377 Ga0157379_10044805
378 Ga0157379_10081594
379 Ga0157379_10222475
380 Ga0207682_10108791
381 Ga0207710_10031596
382 Ga0207710_10159296
383 Ga0207680_10019766
384 Ga0207680_10038488
385 Ga0207647_10041893
386 Ga0207654_10049615
387 Ga0207707_10033099
388 Ga0207707_10075338
389 Ga0207707_10118502
390 Ga0207707_10128276
391 Ga0207707_10202593
392 Ga0207695_10013779
393 Ga0207695_10031315
394 Ga0207695_10064476
395 Ga0207695_10121366
396 Ga0207695_10134262
397 Ga0207695_10636071
398 Ga0207671_10050642
399 Ga0207693_10013728
400 Ga0207663_10150047
401 Ga0207660_10081676
402 Ga0207652_10121534
403 Ga0207652_10151952
404 Ga0207652_10183945
405 Ga0207694_10081865
406 Ga0207694_10284930
407 Ga0207650_10119174
408 Ga0207687_10027344
409 Ga0207700_10104244
410 Ga0207664_10048404
411 Ga0207644_10000718
412 Ga0207690_10105619
413 Ga0207686_10099382
414 Ga0207704_10147710
415 Ga0207665_10014391
416 Ga0207711_10031958
417 Ga0207661_10149436
418 Ga0207661_10280375
419 Ga0207679_10127714
420 Ga0207667_10001288
421 Ga0207651_10268259
422 Ga0207658_10018687
423 Ga0207658_10354441
424 Ga0207677_10055139
425 Ga0207703_10002459
426 Ga0207703_10003580
427 Ga0207703_10359693
428 Ga0207639_10044358
429 Ga0207702_10141412
430 Ga0207641_10001033
431 Ga0207641_10022126
432 Ga0207641_10201245
433 Ga0207641_10387994
434 Ga0207648_10044179
435 Ga0207676_10256051
436 Ga0207676_10649099
437 Ga0207674_10140198
438 Ga0207675_100355663
439 Ga0207683_10029826
440 Ga0207698_10470968
441 Ga0268266_10002891
442 Ga0268266_10009044
443 Ga0268266_10030245
444 Ga0268265_10006613
445 Ga0268264_10000198
446 Ga0307511_10000048
447 Ga0307511_10051826
448 Ga0265331_10032832
449 Ga0307509_10000017
450 Ga0307509_10167955
451 Ga0307508_10051590
452 Ga0307416_100217557
453 Ga0373923_0037125
454 Ga0373923_0073991
455 Ga0373936_0032708
456 Ga0373943_0067140
457 Ga0373955_0065747
458 Ga0373927_0013086
459 Ga0373925_0105640
460 Ga0436365_1228919
461 Ga0436360_0308723
462 Ga0436363_0375975
463 Ga0451793_0943887
464 Ga0466969_0007427
465 Ga0466966_0001723
466 Ga0466961_0024185
467 Ga0466964_0002311
468 Ga0453684_0234175
469 Ga0453684_0512319
470 Ga0466971_0018740
471 Ga0466970_0003266
472 Ga0466957_0087005
473 Ga0466959_0000251
474 Ga0466959_0013496
475 Ga0495580_0041783
476 Ga0495618_0095239
477 Ga0495628_0145668
478 Ga0495632_0007088
479 Ga0495667_0290804
480 Ga0495611_0091246
481 Ga0495671_0112643
482 Ga0495684_0510684
483 Ga0496100_0176763
484 Ga0496102_0032481
485 Ga0496102_0068177
486 Ga0496103_0216056
487 Ga0496105_0130108
488 Ga0496106_0107207
489 Ga0496106_0364414
490 Ga0496107_0219113
491 Ga0496108_0015061
492 Ga0496109_0191042
493 Ga0496110_0064656
494 Ga0496113_0152657
495 Ga0496114_0099255
496 Ga0496115_0197624
497 Ga0496118_0176477
498 Ga0496119_0007919
499 Ga0496119_0017487
500 Ga0496120_0000543
501 Ga0496120_0127510
502 Ga0496121_0017445
503 Ga0496125_0002765
504 Ga0496125_0072194
505 Ga0496126_0002846
506 Ga0496126_0152494
507 Ga0495612_0043484
508 Ga0495595_0067417
509 Ga0500583_0178979
510 Ga0500556_0000455
511 Ga0500562_018657
512 Ga0500591_033555
513 Ga0500614_017904
514 Ga0500588_0001866
515 Ga0500616_0013880
516 Ga0500639_034353
517 Ga0500637_0009662
518 Ga0500611_004807
519 Ga0466962_0008818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02167

Cytochrom_C1

Cytochrome C1 family

115

282

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.6342 53 230
8snh-assembly1.cif.gz_J cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.5934 53 230
4rf8-assembly2.cif.gz_B crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with adp 0.5138 146 206
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.5064 53 230
1crk-assembly1.cif.gz_A mitochondrial creatine kinase 0.4823 148 203
ID Description Score Start End Superfamily
af_F4JZX8_484_686_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5878 136 167 1.25.40.10
af_I1NC22_9_183_3.30.1490.80 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.4618 142 190 3.30.1490.80
af_Q4DWG5_663_885_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4558 144 171 2.130.10.10
af_A4HXE5_491_591_3.30.1120.30 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;POLO box domain 0.4523 144 190 3.30.1120.30
6h25E00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.4201 163 208 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A7R8WZW0-F1-model_v4 Uncharacterized protein 0.8426 92 201 GO:0005737
GO:0009055
GO:0020037
AF-D6PKK4-F1-model_v4 Ubiquinol Cytochrome c reductase cytochrome c1 0.74 65 191 GO:0009055
GO:0020037
AF-A0A3G2VQR9-F1-model_v4 Ubiquinol cytochrome C oxidoreductase C1 subunit 0.739 65 199 GO:0009055
GO:0016020
GO:0020037
AF-A0A7K0F4L3-F1-model_v4 deleted 0.7349 63 143
AF-A0A3G2VQR9-F1-model_v4 Ubiquinol cytochrome C oxidoreductase C1 subunit 0.7151 65 199 GO:0009055
GO:0016020
GO:0020037

Map