F368966
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 259 | 169 | 253 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0265828|Ga0395905_0265828_159_956 |
| Length | 265 |
| Sequence | MVFESRSHFTTALSKKARESNVGLPPIADTTPLAVAPPVVRAADALGPLVREGAVRLPNAALGRLADLADTLREYPSDEAGVRIHGNARLKRLLDREGPIGAIAATALGEHSRPVRAILFNKTPKTNWSLGWHQDRTIAVSEQRDVPGFGPWTVKGGMHHVEPPLELLARMVTLRVHFDDVDAQNAPLLVAPGSHRIGRVKEADIDQVVRRCGTLACLAAAGDVWLYSTPILHASEAARAPRARRVLQVDYAAEDLPNGLEWLGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 5 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 6 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 118 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 119 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 136 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 139 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 140 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 141 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 142 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 143 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 144 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 145 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 146 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 155 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 157 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 158 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 160 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 161 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 162 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 164 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 165 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 166 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 167 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 168 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 169 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.68 |
| Metatranscriptomes | 0 |
| Isolates | 2.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.58 |
| Nodule | 0.39 |
| Rhizoplane | 4.25 |
| Rhizosphere | 71.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10012142 | 3300001989 | Bacteria | 3163 |
| 2 | JGI24737J22298_10017551 | 3300001990 | Unclassified | 2303 |
| 3 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 4 | rootL2_10213732 | 3300003322 | Bacteria | 2268 |
| 5 | Ga0055537_1004554 | 3300003773 | Bacteria | 3944 |
| 6 | Ga0055530_10043239 | 3300003791 | Bacteria | 1088 |
| 7 | Ga0065165_1053434 | 3300005262 | Bacteria | 1137 |
| 8 | Ga0070658_10016463 | 3300005327 | Bacteria | 5918 |
| 9 | Ga0070658_10676438 | 3300005327 | Bacteria | 896 |
| 10 | Ga0070676_10113724 | 3300005328 | Bacteria | 1689 |
| 11 | Ga0070670_100205498 | 3300005331 | Bacteria | 1712 |
| 12 | Ga0070670_100221189 | 3300005331 | Unclassified | 1647 |
| 13 | Ga0070670_100292998 | 3300005331 | Bacteria | 1422 |
| 14 | Ga0068869_100112051 | 3300005334 | Bacteria | 2076 |
| 15 | Ga0070660_100020649 | 3300005339 | Bacteria | 4845 |
| 16 | Ga0070660_100140574 | 3300005339 | Bacteria | 1937 |
| 17 | Ga0070661_100000042 | 3300005344 | Bacteria | 99327 |
| 18 | Ga0070668_100063796 | 3300005347 | Bacteria | 2856 |
| 19 | Ga0070668_100527690 | 3300005347 | Bacteria | 1025 |
| 20 | Ga0070669_100002131 | 3300005353 | Bacteria | 14306 |
| 21 | Ga0070669_100195257 | 3300005353 | Bacteria | 1590 |
| 22 | Ga0070671_100003907 | 3300005355 | Bacteria | 11721 |
| 23 | Ga0070674_100005703 | 3300005356 | Bacteria | 7222 |
| 24 | Ga0070673_100165029 | 3300005364 | Bacteria | 1886 |
| 25 | Ga0070659_100022086 | 3300005366 | Bacteria | 4856 |
| 26 | Ga0070667_100202539 | 3300005367 | Bacteria | 1761 |
| 27 | Ga0070667_100381462 | 3300005367 | Bacteria | 1280 |
| 28 | Ga0070663_100005331 | 3300005455 | Bacteria | 7630 |
| 29 | Ga0070662_100112453 | 3300005457 | Bacteria | 2076 |
| 30 | Ga0068867_100006694 | 3300005459 | Bacteria | 8145 |
| 31 | Ga0070665_100012021 | 3300005548 | Bacteria | 8732 |
| 32 | Ga0070665_100248968 | 3300005548 | Bacteria | 1778 |
| 33 | Ga0070665_100448694 | 3300005548 | Bacteria | 1299 |
| 34 | Ga0068855_100345754 | 3300005563 | Bacteria | 1639 |
| 35 | Ga0070664_100239779 | 3300005564 | Unclassified | 1627 |
| 36 | Ga0068857_100005430 | 3300005577 | Bacteria | 10868 |
| 37 | Ga0068857_100036094 | 3300005577 | Bacteria | 4380 |
| 38 | Ga0068857_100287836 | 3300005577 | Bacteria | 1512 |
| 39 | Ga0068854_100015063 | 3300005578 | Bacteria | 5111 |
| 40 | Ga0068854_100031827 | 3300005578 | Bacteria | 3667 |
| 41 | Ga0068854_100281384 | 3300005578 | Bacteria | 1339 |
| 42 | Ga0068856_100133228 | 3300005614 | Bacteria | 2490 |
| 43 | Ga0068852_100494930 | 3300005616 | Bacteria | 1217 |
| 44 | Ga0068859_100000448 | 3300005617 | Bacteria | 41237 |
| 45 | Ga0068859_100065380 | 3300005617 | Bacteria | 3671 |
| 46 | Ga0068859_100587738 | 3300005617 | Bacteria | 1207 |
| 47 | Ga0068864_100057767 | 3300005618 | Unclassified | 3352 |
| 48 | Ga0068864_100149815 | 3300005618 | Bacteria | 2112 |
| 49 | Ga0068864_100253647 | 3300005618 | Bacteria | 1634 |
| 50 | Ga0068851_10018160 | 3300005834 | Bacteria | 3387 |
| 51 | Ga0068863_100021768 | 3300005841 | Bacteria | 6117 |
| 52 | Ga0068863_100037357 | 3300005841 | Bacteria | 4624 |
| 53 | Ga0068863_100786648 | 3300005841 | Bacteria | 948 |
| 54 | Ga0068863_100807654 | 3300005841 | Unclassified | 936 |
| 55 | Ga0068858_100002043 | 3300005842 | Bacteria | 20565 |
| 56 | Ga0068858_100027453 | 3300005842 | Bacteria | 5288 |
| 57 | Ga0068858_100247841 | 3300005842 | Bacteria | 1692 |
| 58 | Ga0068860_100008590 | 3300005843 | Bacteria | 10181 |
| 59 | Ga0068860_100148141 | 3300005843 | Bacteria | 2259 |
| 60 | Ga0068860_100741329 | 3300005843 | Bacteria | 993 |
| 61 | Ga0068862_100001858 | 3300005844 | Bacteria | 19137 |
| 62 | Ga0068862_100050964 | 3300005844 | Unclassified | 3539 |
| 63 | Ga0075368_10000498 | 3300006042 | Bacteria | 11644 |
| 64 | Ga0075367_10000330 | 3300006178 | Bacteria | 16782 |
| 65 | Ga0075366_10272813 | 3300006195 | Bacteria | 1033 |
| 66 | Ga0097620_100000448 | 3300006931 | Bacteria | 41237 |
| 67 | Ga0097620_100065377 | 3300006931 | Bacteria | 3671 |
| 68 | Ga0097620_100587750 | 3300006931 | Bacteria | 1207 |
| 69 | Ga0105251_10001861 | 3300009011 | Bacteria | 17335 |
| 70 | Ga0105240_10001076 | 3300009093 | Bacteria | 48242 |
| 71 | Ga0105245_10306325 | 3300009098 | Bacteria | 1560 |
| 72 | Ga0105247_10120462 | 3300009101 | Bacteria | 1699 |
| 73 | Ga0105243_10138484 | 3300009148 | Unclassified | 2073 |
| 74 | Ga0105241_10049588 | 3300009174 | Unclassified | 3198 |
| 75 | Ga0105248_10003638 | 3300009177 | Bacteria | 17113 |
| 76 | Ga0105248_10051813 | 3300009177 | Bacteria | 4605 |
| 77 | Ga0105248_10666392 | 3300009177 | Bacteria | 1174 |
| 78 | Ga0105238_10007431 | 3300009551 | Bacteria | 10975 |
| 79 | Ga0105238_10073296 | 3300009551 | Bacteria | 3419 |
| 80 | Ga0105249_10048846 | 3300009553 | Bacteria | 3858 |
| 81 | Ga0105239_10190998 | 3300010375 | Bacteria | 2292 |
| 82 | Ga0105239_10430380 | 3300010375 | Bacteria | 1496 |
| 83 | Ga0105239_10611935 | 3300010375 | Bacteria | 1243 |
| 84 | Ga0105246_10118870 | 3300011119 | Unclassified | 1955 |
| 85 | Ga0157371_10037030 | 3300013102 | Bacteria | 3494 |
| 86 | Ga0157369_10001565 | 3300013105 | Bacteria | 28007 |
| 87 | Ga0157369_10214430 | 3300013105 | Bacteria | 2017 |
| 88 | Ga0157378_10145716 | 3300013297 | Bacteria | 2202 |
| 89 | Ga0163162_10009790 | 3300013306 | Bacteria | 9326 |
| 90 | Ga0163163_10033978 | 3300014325 | Bacteria | 4936 |
| 91 | Ga0163161_10107055 | 3300017792 | Unclassified | 2087 |
| 92 | Ga0163161_10188789 | 3300017792 | Bacteria | 1583 |
| 93 | Ga0163161_10357357 | 3300017792 | Bacteria | 1163 |
| 94 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 95 | Ga0209565_1000044 | 3300025263 | Bacteria | 229969 |
| 96 | Ga0209673_1023642 | 3300025273 | Bacteria | 2087 |
| 97 | Ga0209564_1032016 | 3300025295 | Bacteria | 1592 |
| 98 | Ga0209050_1019153 | 3300025298 | Bacteria | 2616 |
| 99 | Ga0207426_1035347 | 3300025302 | Bacteria | 1595 |
| 100 | Ga0209257_1006725 | 3300025304 | Bacteria | 7267 |
| 101 | Ga0207713_1003490 | 3300025735 | Bacteria | 10679 |
| 102 | Ga0207688_10003457 | 3300025901 | Bacteria | 8615 |
| 103 | Ga0207647_10001132 | 3300025904 | Bacteria | 20537 |
| 104 | Ga0207647_10064303 | 3300025904 | Bacteria | 2230 |
| 105 | Ga0207647_10097331 | 3300025904 | Bacteria | 1750 |
| 106 | Ga0207645_10111275 | 3300025907 | Bacteria | 1773 |
| 107 | Ga0207705_10039553 | 3300025909 | Bacteria | 3381 |
| 108 | Ga0207695_10027305 | 3300025913 | Bacteria | 6359 |
| 109 | Ga0207657_10030907 | 3300025919 | Bacteria | 4855 |
| 110 | Ga0207657_10065260 | 3300025919 | Bacteria | 3104 |
| 111 | Ga0207649_10000047 | 3300025920 | Bacteria | 110856 |
| 112 | Ga0207681_10000503 | 3300025923 | Bacteria | 27243 |
| 113 | Ga0207681_10020828 | 3300025923 | Unclassified | 4162 |
| 114 | Ga0207681_10200064 | 3300025923 | Bacteria | 1533 |
| 115 | Ga0207694_10004494 | 3300025924 | Bacteria | 10884 |
| 116 | Ga0207694_10052732 | 3300025924 | Bacteria | 3153 |
| 117 | Ga0207687_10008468 | 3300025927 | Bacteria | 6724 |
| 118 | Ga0207690_10046586 | 3300025932 | Bacteria | 2872 |
| 119 | Ga0207706_10001910 | 3300025933 | Bacteria | 20460 |
| 120 | Ga0207669_10000252 | 3300025937 | Bacteria | 24461 |
| 121 | Ga0207711_10002908 | 3300025941 | Bacteria | 15009 |
| 122 | Ga0207711_10055105 | 3300025941 | Bacteria | 3413 |
| 123 | Ga0207711_10460558 | 3300025941 | Bacteria | 1184 |
| 124 | Ga0207667_10002702 | 3300025949 | Bacteria | 21955 |
| 125 | Ga0207668_10132329 | 3300025972 | Bacteria | 1906 |
| 126 | Ga0207668_10764797 | 3300025972 | Unclassified | 853 |
| 127 | Ga0207640_10022469 | 3300025981 | Bacteria | 3776 |
| 128 | Ga0207640_10099018 | 3300025981 | Bacteria | 2040 |
| 129 | Ga0207658_10127449 | 3300025986 | Bacteria | 2039 |
| 130 | Ga0207658_10185015 | 3300025986 | Bacteria | 1727 |
| 131 | Ga0207703_10002444 | 3300026035 | Bacteria | 16115 |
| 132 | Ga0207703_10012660 | 3300026035 | Bacteria | 6579 |
| 133 | Ga0207703_10031561 | 3300026035 | Unclassified | 4190 |
| 134 | Ga0207678_10008920 | 3300026067 | Bacteria | 8827 |
| 135 | Ga0207641_10012206 | 3300026088 | Bacteria | 7050 |
| 136 | Ga0207641_10026200 | 3300026088 | Bacteria | 4811 |
| 137 | Ga0207641_10354260 | 3300026088 | Unclassified | 1399 |
| 138 | Ga0207641_10589778 | 3300026088 | Unclassified | 1087 |
| 139 | Ga0207648_10002331 | 3300026089 | Bacteria | 20497 |
| 140 | Ga0207676_10051988 | 3300026095 | Unclassified | 3200 |
| 141 | Ga0207676_10131937 | 3300026095 | Bacteria | 2125 |
| 142 | Ga0207674_10008912 | 3300026116 | Bacteria | 11530 |
| 143 | Ga0207674_10011227 | 3300026116 | Bacteria | 10066 |
| 144 | Ga0207674_10019358 | 3300026116 | Bacteria | 7375 |
| 145 | Ga0207674_10170315 | 3300026116 | Unclassified | 2131 |
| 146 | Ga0207674_10251389 | 3300026116 | Bacteria | 1715 |
| 147 | Ga0207683_10004500 | 3300026121 | Bacteria | 12025 |
| 148 | Ga0207698_10791918 | 3300026142 | Unclassified | 950 |
| 149 | Ga0209813_10000182 | 3300027866 | Bacteria | 20378 |
| 150 | Ga0268266_10130238 | 3300028379 | Bacteria | 2249 |
| 151 | Ga0268266_10352579 | 3300028379 | Bacteria | 1383 |
| 152 | Ga0268265_10001878 | 3300028380 | Bacteria | 16707 |
| 153 | Ga0268264_10029392 | 3300028381 | Bacteria | 4500 |
| 154 | Ga0268264_10679214 | 3300028381 | Bacteria | 1021 |
| 155 | Ga0307408_100011485 | 3300031548 | Bacteria | 5851 |
| 156 | Ga0307405_10298050 | 3300031731 | Bacteria | 1222 |
| 157 | Ga0307406_10343640 | 3300031901 | Unclassified | 1163 |
| 158 | Ga0307407_10058220 | 3300031903 | Bacteria | 2245 |
| 159 | Ga0307412_10237699 | 3300031911 | Bacteria | 1407 |
| 160 | Ga0307409_100082373 | 3300031995 | Bacteria | 2604 |
| 161 | Ga0307416_100127991 | 3300032002 | Bacteria | 2279 |
| 162 | Ga0307414_10012911 | 3300032004 | Bacteria | 4958 |
| 163 | Ga0395899_0055315 | 3300037312 | Bacteria | 2935 |
| 164 | Ga0395899_0143095 | 3300037312 | Bacteria | 1700 |
| 165 | Ga0395899_0262741 | 3300037312 | Bacteria | 1180 |
| 166 | Ga0395900_0033178 | 3300037418 | Bacteria | 5313 |
| 167 | Ga0395900_0102725 | 3300037418 | Bacteria | 2936 |
| 168 | Ga0395900_0214628 | 3300037418 | Bacteria | 1942 |
| 169 | Ga0395900_0291669 | 3300037418 | Bacteria | 1620 |
| 170 | Ga0395898_0006326 | 3300037466 | Bacteria | 12652 |
| 171 | Ga0395898_0953073 | 3300037466 | Bacteria | 795 |
| 172 | Ga0395905_0265828 | 3300037471 | Bacteria | 1601 |
| 173 | Ga0395905_0339267 | 3300037471 | Bacteria | 1394 |
| 174 | Ga0395905_0908812 | 3300037471 | Unclassified | 783 |
| 175 | Ga0395901_0004771 | 3300038443 | Bacteria | 13679 |
| 176 | Ga0395901_0130052 | 3300038443 | Bacteria | 2645 |
| 177 | Ga0395901_0253902 | 3300038443 | Bacteria | 1831 |
| 178 | Ga0436363_0447161 | 3300039450 | Bacteria | 1013 |
| 179 | Ga0450920_004311 | 3300042122 | Bacteria | 2493 |
| 180 | Ga0439458_0000025 | 3300042157 | Bacteria | 23156 |
| 181 | Ga0439435_0030544 | 3300042436 | Bacteria | 1461 |
| 182 | Ga0495638_0000336 | 3300046460 | Bacteria | 59114 |
| 183 | Ga0495639_0071878 | 3300046475 | Bacteria | 1599 |
| 184 | Ga0495606_0004929 | 3300046507 | Bacteria | 13059 |
| 185 | Ga0495633_0043244 | 3300046558 | Bacteria | 2137 |
| 186 | Ga0495625_0280987 | 3300046660 | Bacteria | 1071 |
| 187 | Ga0495671_0000062 | 3300046692 | Bacteria | 106672 |
| 188 | Ga0495683_0008826 | 3300047323 | Bacteria | 5376 |
| 189 | Ga0495681_0006067 | 3300047470 | Bacteria | 7988 |
| 190 | Ga0495686_0139137 | 3300047472 | Bacteria | 1433 |
| 191 | Ga0496101_0620993 | 3300048904 | Bacteria | 854 |
| 192 | Ga0496102_0000828 | 3300048905 | Bacteria | 29896 |
| 193 | Ga0496103_0000636 | 3300048906 | Bacteria | 26810 |
| 194 | Ga0496104_0016879 | 3300048907 | Bacteria | 6639 |
| 195 | Ga0496105_0053057 | 3300048908 | Bacteria | 3348 |
| 196 | Ga0496110_0150078 | 3300048913 | Bacteria | 2110 |
| 197 | Ga0496111_0107975 | 3300048914 | Bacteria | 2049 |
| 198 | Ga0496113_0126127 | 3300048916 | Bacteria | 2005 |
| 199 | Ga0496115_0000624 | 3300048918 | Bacteria | 26823 |
| 200 | Ga0496115_0000906 | 3300048918 | Bacteria | 21502 |
| 201 | Ga0496117_0001766 | 3300048920 | Bacteria | 29764 |
| 202 | Ga0496118_0001902 | 3300048921 | Bacteria | 29748 |
| 203 | Ga0496118_0015051 | 3300048921 | Bacteria | 7191 |
| 204 | Ga0496118_0031960 | 3300048921 | Bacteria | 4348 |
| 205 | Ga0496118_0266004 | 3300048921 | Unclassified | 964 |
| 206 | Ga0496119_0059899 | 3300048922 | Bacteria | 2283 |
| 207 | Ga0496121_0014523 | 3300048924 | Bacteria | 8349 |
| 208 | Ga0496121_0030779 | 3300048924 | Bacteria | 4922 |
| 209 | Ga0496122_0000218 | 3300048925 | Bacteria | 127770 |
| 210 | Ga0496122_0012639 | 3300048925 | Bacteria | 8372 |
| 211 | Ga0496122_0055155 | 3300048925 | Bacteria | 2977 |
| 212 | Ga0496123_0000089 | 3300048926 | Bacteria | 179941 |
| 213 | Ga0496123_0003280 | 3300048926 | Bacteria | 18335 |
| 214 | Ga0496123_0010286 | 3300048926 | Bacteria | 8299 |
| 215 | Ga0496123_0211814 | 3300048926 | Bacteria | 984 |
| 216 | Ga0496123_0230308 | 3300048926 | Bacteria | 928 |
| 217 | Ga0496124_0001562 | 3300048927 | Bacteria | 33102 |
| 218 | Ga0496124_0009604 | 3300048927 | Bacteria | 9915 |
| 219 | Ga0496124_0011763 | 3300048927 | Bacteria | 8725 |
| 220 | Ga0496124_0096260 | 3300048927 | Bacteria | 2405 |
| 221 | Ga0496124_0151482 | 3300048927 | Bacteria | 1818 |
| 222 | Ga0496125_0000663 | 3300048928 | Bacteria | 57400 |
| 223 | Ga0496125_0001758 | 3300048928 | Bacteria | 30058 |
| 224 | Ga0496125_0007697 | 3300048928 | Bacteria | 11417 |
| 225 | Ga0496125_0011023 | 3300048928 | Bacteria | 9075 |
| 226 | Ga0496125_0030926 | 3300048928 | Bacteria | 4779 |
| 227 | Ga0496126_0001769 | 3300048929 | Bacteria | 31972 |
| 228 | Ga0496126_0001925 | 3300048929 | Bacteria | 29687 |
| 229 | Ga0501034_0017856 | 3300049571 | Bacteria | 7277 |
| 230 | Ga0501038_0426554 | 3300049574 | Bacteria | 1022 |
| 231 | Ga0501047_0047272 | 3300049581 | Bacteria | 4158 |
| 232 | Ga0501070_0030337 | 3300049586 | Unclassified | 4530 |
| 233 | Ga0501282_002406 | 3300049778 | Bacteria | 2038 |
| 234 | Ga0501035_0019183 | 3300049822 | Bacteria | 6296 |
| 235 | Ga0501044_0120349 | 3300049823 | Bacteria | 2627 |
| 236 | Ga0501044_0528057 | 3300049823 | Bacteria | 1079 |
| 237 | Ga0501204_009859 | 3300049850 | Bacteria | 1111 |
| 238 | Ga0501226_012046 | 3300049853 | Unclassified | 958 |
| 239 | nmdc:mga03683_1742_c2 | 3300050489 | Bacteria | 3912 |
| 240 | nmdc:mga03n38_22734_c1 | 3300050490 | Bacteria | 2542 |
| 241 | nmdc:mga06z11_443_c1 | 3300050494 | Bacteria | 15505 |
| 242 | nmdc:mga04h51_151_c1 | 3300050495 | Bacteria | 20376 |
| 243 | Ga0500562_001980 | 3300053108 | Bacteria | 5137 |
| 244 | Ga0500658_0000979 | 3300053134 | Bacteria | 11665 |
| 245 | Ga0500658_0030191 | 3300053134 | Bacteria | 2112 |
| 246 | Ga0500559_0013100 | 3300053136 | Bacteria | 3517 |
| 247 | Ga0500564_026050 | 3300053138 | Bacteria | 2687 |
| 248 | Ga0500568_0002126 | 3300053139 | Bacteria | 11964 |
| 249 | Ga0500573_0000040 | 3300053140 | Bacteria | 105074 |
| 250 | Ga0500604_0131255 | 3300053151 | Archaea | 842 |
| 251 | Ga0500624_000019 | 3300053157 | Bacteria | 125903 |
| 252 | Ga0500567_006198 | 3300053723 | Bacteria | 5572 |
| 253 | Ga0500609_010791 | 3300053731 | Bacteria | 1233 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100020649 | Ga0070660_1000206493 | 211 |
| 2 | 3300005344 | Ga0070661_100000042 | Ga0070661_10000004261 | 211 |
| 3 | 3300025919 | Ga0207657_10030907 | Ga0207657_100309073 | 211 |
| 4 | 3300025920 | Ga0207649_10000047 | Ga0207649_1000004765 | 211 |
| 5 | 3300013306 | Ga0163162_10009790 | Ga0163162_100097902 | 212 |
| 6 | 3300025927 | Ga0207687_10008468 | Ga0207687_100084682 | 213 |
| 7 | 3300053134 | Ga0500658_0030191 | Ga0500658_0030191_101_745 | 213 |
| 8 | 3300037466 | Ga0395898_0953073 | Ga0395898_0953073_31_681 | 215 |
| 9 | iso_pu_bacteria | 2599185359 | 2600227007 | 215 |
| 10 | iso_pu_bacteria | 2879163058 | 2879163444 | 215 |
| 11 | iso_pu_bacteria | 2928968154 | 2928970952 | 215 |
| 12 | 3300025302 | Ga0207426_1035347 | Ga0207426_10353473 | 216 |
| 13 | 3300037312 | Ga0395899_0055315 | Ga0395899_0055315_1851_2612 | 216 |
| 14 | 3300037312 | Ga0395899_0143095 | Ga0395899_0143095_205_879 | 216 |
| 15 | 3300037418 | Ga0395900_0033178 | Ga0395900_0033178_2610_3284 | 216 |
| 16 | 3300037418 | Ga0395900_0102725 | Ga0395900_0102725_408_1085 | 216 |
| 17 | 3300037418 | Ga0395900_0291669 | Ga0395900_0291669_634_1287 | 216 |
| 18 | 3300037466 | Ga0395898_0006326 | Ga0395898_0006326_3235_3996 | 216 |
| 19 | 3300037471 | Ga0395905_0339267 | Ga0395905_0339267_247_924 | 216 |
| 20 | 3300038443 | Ga0395901_0004771 | Ga0395901_0004771_11631_12308 | 216 |
| 21 | 3300038443 | Ga0395901_0130052 | Ga0395901_0130052_828_1502 | 216 |
| 22 | 3300042157 | Ga0439458_0000025 | Ga0439458_0000025_10108_10770 | 216 |
| 23 | 3300005328 | Ga0070676_10113724 | Ga0070676_101137242 | 217 |
| 24 | 3300005364 | Ga0070673_100165029 | Ga0070673_1001650292 | 217 |
| 25 | 3300042122 | Ga0450920_004311 | Ga0450920_004311_1230_1892 | 217 |
| 26 | 3300005327 | Ga0070658_10676438 | Ga0070658_106764382 | 218 |
| 27 | 3300005331 | Ga0070670_100221189 | Ga0070670_1002211892 | 218 |
| 28 | 3300005455 | Ga0070663_100005331 | Ga0070663_1000053313 | 218 |
| 29 | 3300005548 | Ga0070665_100012021 | Ga0070665_1000120218 | 218 |
| 30 | 3300005564 | Ga0070664_100239779 | Ga0070664_1002397792 | 218 |
| 31 | 3300005577 | Ga0068857_100005430 | Ga0068857_1000054309 | 218 |
| 32 | 3300005577 | Ga0068857_100287836 | Ga0068857_1002878361 | 218 |
| 33 | 3300005614 | Ga0068856_100133228 | Ga0068856_1001332283 | 218 |
| 34 | 3300005617 | Ga0068859_100065380 | Ga0068859_1000653802 | 218 |
| 35 | 3300005618 | Ga0068864_100057767 | Ga0068864_1000577674 | 218 |
| 36 | 3300005841 | Ga0068863_100021768 | Ga0068863_1000217683 | 218 |
| 37 | 3300005841 | Ga0068863_100786648 | Ga0068863_1007866482 | 218 |
| 38 | 3300005841 | Ga0068863_100807654 | Ga0068863_1008076541 | 218 |
| 39 | 3300005842 | Ga0068858_100027453 | Ga0068858_1000274535 | 218 |
| 40 | 3300005843 | Ga0068860_100008590 | Ga0068860_1000085904 | 218 |
| 41 | 3300005844 | Ga0068862_100050964 | Ga0068862_1000509642 | 218 |
| 42 | 3300006931 | Ga0097620_100065377 | Ga0097620_1000653775 | 218 |
| 43 | 3300009093 | Ga0105240_10001076 | Ga0105240_1000107611 | 218 |
| 44 | 3300009148 | Ga0105243_10138484 | Ga0105243_101384841 | 218 |
| 45 | 3300009174 | Ga0105241_10049588 | Ga0105241_100495884 | 218 |
| 46 | 3300009553 | Ga0105249_10048846 | Ga0105249_100488465 | 218 |
| 47 | 3300011119 | Ga0105246_10118870 | Ga0105246_101188702 | 218 |
| 48 | 3300013105 | Ga0157369_10001565 | Ga0157369_1000156518 | 218 |
| 49 | 3300025923 | Ga0207681_10020828 | Ga0207681_100208282 | 218 |
| 50 | 3300026035 | Ga0207703_10031561 | Ga0207703_100315615 | 218 |
| 51 | 3300026067 | Ga0207678_10008920 | Ga0207678_100089203 | 218 |
| 52 | 3300026088 | Ga0207641_10012206 | Ga0207641_100122062 | 218 |
| 53 | 3300026088 | Ga0207641_10354260 | Ga0207641_103542602 | 218 |
| 54 | 3300026088 | Ga0207641_10589778 | Ga0207641_105897781 | 218 |
| 55 | 3300026095 | Ga0207676_10051988 | Ga0207676_100519882 | 218 |
| 56 | 3300026116 | Ga0207674_10008912 | Ga0207674_1000891210 | 218 |
| 57 | 3300026116 | Ga0207674_10170315 | Ga0207674_101703152 | 218 |
| 58 | 3300026116 | Ga0207674_10251389 | Ga0207674_102513892 | 218 |
| 59 | 3300026142 | Ga0207698_10791918 | Ga0207698_107919181 | 218 |
| 60 | 3300028379 | Ga0268266_10130238 | Ga0268266_101302382 | 218 |
| 61 | 3300028381 | Ga0268264_10029392 | Ga0268264_100293923 | 218 |
| 62 | 3300031731 | Ga0307405_10298050 | Ga0307405_102980501 | 218 |
| 63 | 3300037471 | Ga0395905_0908812 | Ga0395905_0908812_25_687 | 218 |
| 64 | 3300047472 | Ga0495686_0139137 | Ga0495686_0139137_688_1368 | 218 |
| 65 | 3300053108 | Ga0500562_001980 | Ga0500562_001980_4140_4802 | 218 |
| 66 | 3300003214 | JGI25165J46597_1000012 | JGI25165J46597_1000012347 | 219 |
| 67 | 3300005577 | Ga0068857_100036094 | Ga0068857_1000360945 | 219 |
| 68 | 3300005617 | Ga0068859_100000448 | Ga0068859_1000004488 | 219 |
| 69 | 3300005618 | Ga0068864_100253647 | Ga0068864_1002536472 | 219 |
| 70 | 3300006931 | Ga0097620_100000448 | Ga0097620_1000004488 | 219 |
| 71 | 3300009551 | Ga0105238_10073296 | Ga0105238_100732964 | 219 |
| 72 | 3300010375 | Ga0105239_10611935 | Ga0105239_106119352 | 219 |
| 73 | 3300025261 | Ga0209233_1000058 | Ga0209233_100005871 | 219 |
| 74 | 3300025304 | Ga0209257_1006725 | Ga0209257_10067258 | 219 |
| 75 | 3300025924 | Ga0207694_10052732 | Ga0207694_100527322 | 219 |
| 76 | 3300026116 | Ga0207674_10011227 | Ga0207674_100112277 | 219 |
| 77 | 3300048926 | Ga0496123_0010286 | Ga0496123_0010286_1665_2327 | 219 |
| 78 | 3300048927 | Ga0496124_0011763 | Ga0496124_0011763_5116_5778 | 219 |
| 79 | 3300053136 | Ga0500559_0013100 | Ga0500559_0013100_1412_2074 | 219 |
| 80 | 3300017792 | Ga0163161_10188789 | Ga0163161_101887892 | 220 |
| 81 | 3300046558 | Ga0495633_0043244 | Ga0495633_0043244_606_1280 | 220 |
| 82 | 3300046692 | Ga0495671_0000062 | Ga0495671_0000062_76270_76944 | 220 |
| 83 | 3300047470 | Ga0495681_0006067 | Ga0495681_0006067_5629_6303 | 220 |
| 84 | 3300048927 | Ga0496124_0096260 | Ga0496124_0096260_30_743 | 220 |
| 85 | 3300031903 | Ga0307407_10058220 | Ga0307407_100582201 | 221 |
| 86 | 3300031995 | Ga0307409_100082373 | Ga0307409_1000823733 | 221 |
| 87 | 3300032002 | Ga0307416_100127991 | Ga0307416_1001279912 | 221 |
| 88 | 3300032004 | Ga0307414_10012911 | Ga0307414_100129116 | 221 |
| 89 | 3300042436 | Ga0439435_0030544 | Ga0439435_0030544_22_699 | 221 |
| 90 | 3300048921 | Ga0496118_0266004 | Ga0496118_0266004_17_691 | 221 |
| 91 | 3300005548 | Ga0070665_100448694 | Ga0070665_1004486942 | 222 |
| 92 | 3300046460 | Ga0495638_0000336 | Ga0495638_0000336_18126_18797 | 222 |
| 93 | 3300053134 | Ga0500658_0000979 | Ga0500658_0000979_3479_4150 | 222 |
| 94 | 3300003773 | Ga0055537_1004554 | Ga0055537_10045542 | 223 |
| 95 | 3300003791 | Ga0055530_10043239 | Ga0055530_100432392 | 223 |
| 96 | 3300005262 | Ga0065165_1053434 | Ga0065165_10534342 | 223 |
| 97 | 3300005617 | Ga0068859_100587738 | Ga0068859_1005877382 | 223 |
| 98 | 3300005842 | Ga0068858_100002043 | Ga0068858_1000020433 | 223 |
| 99 | 3300006931 | Ga0097620_100587750 | Ga0097620_1005877502 | 223 |
| 100 | 3300009177 | Ga0105248_10003638 | Ga0105248_1000363815 | 223 |
| 101 | 3300017792 | Ga0163161_10107055 | Ga0163161_101070552 | 223 |
| 102 | 3300025263 | Ga0209565_1000044 | Ga0209565_1000044175 | 223 |
| 103 | 3300025273 | Ga0209673_1023642 | Ga0209673_10236423 | 223 |
| 104 | 3300025295 | Ga0209564_1032016 | Ga0209564_10320162 | 223 |
| 105 | 3300025298 | Ga0209050_1019153 | Ga0209050_10191533 | 223 |
| 106 | 3300025941 | Ga0207711_10002908 | Ga0207711_1000290810 | 223 |
| 107 | 3300026035 | Ga0207703_10002444 | Ga0207703_100024443 | 223 |
| 108 | 3300046507 | Ga0495606_0004929 | Ga0495606_0004929_5994_6668 | 223 |
| 109 | 3300048925 | Ga0496122_0012639 | Ga0496122_0012639_4623_5297 | 223 |
| 110 | 3300048926 | Ga0496123_0003280 | Ga0496123_0003280_5180_5854 | 223 |
| 111 | iso_pu_bacteria | 2510917021 | 2511131063 | 223 |
| 112 | iso_pu_bacteria | 2852653556 | 2852655616 | 223 |
| 113 | 3300005327 | Ga0070658_10016463 | Ga0070658_100164636 | 224 |
| 114 | 3300005331 | Ga0070670_100292998 | Ga0070670_1002929982 | 224 |
| 115 | 3300006042 | Ga0075368_10000498 | Ga0075368_1000049810 | 224 |
| 116 | 3300006178 | Ga0075367_10000330 | Ga0075367_100003307 | 224 |
| 117 | 3300025909 | Ga0207705_10039553 | Ga0207705_100395531 | 224 |
| 118 | 3300027866 | Ga0209813_10000182 | Ga0209813_1000018221 | 224 |
| 119 | 3300037312 | Ga0395899_0262741 | Ga0395899_0262741_200_880 | 224 |
| 120 | 3300037418 | Ga0395900_0214628 | Ga0395900_0214628_987_1667 | 224 |
| 121 | 3300038443 | Ga0395901_0253902 | Ga0395901_0253902_80_760 | 224 |
| 122 | 3300046475 | Ga0495639_0071878 | Ga0495639_0071878_584_1261 | 224 |
| 123 | 3300048918 | Ga0496115_0000906 | Ga0496115_0000906_17678_18355 | 224 |
| 124 | 3300049823 | Ga0501044_0528057 | Ga0501044_0528057_183_860 | 224 |
| 125 | 3300050490 | nmdc:mga03n38_22734_c1 | nmdc:mga03n38_22734_c1_1424_2104 | 224 |
| 126 | 3300050494 | nmdc:mga06z11_443_c1 | nmdc:mga06z11_443_c1_14116_14796 | 224 |
| 127 | 3300050495 | nmdc:mga04h51_151_c1 | nmdc:mga04h51_151_c1_5581_6261 | 224 |
| 128 | 3300053138 | Ga0500564_026050 | Ga0500564_026050_716_1393 | 224 |
| 129 | 3300053723 | Ga0500567_006198 | Ga0500567_006198_3517_4194 | 224 |
| 130 | 3300005578 | Ga0068854_100031827 | Ga0068854_1000318272 | 225 |
| 131 | 3300025981 | Ga0207640_10022469 | Ga0207640_100224693 | 225 |
| 132 | 3300026116 | Ga0207674_10019358 | Ga0207674_100193588 | 225 |
| 133 | 3300031911 | Ga0307412_10237699 | Ga0307412_102376991 | 225 |
| 134 | 3300048921 | Ga0496118_0015051 | Ga0496118_0015051_3018_3698 | 225 |
| 135 | 3300048924 | Ga0496121_0014523 | Ga0496121_0014523_5030_5713 | 225 |
| 136 | 3300048928 | Ga0496125_0011023 | Ga0496125_0011023_65_748 | 226 |
| 137 | 3300005353 | Ga0070669_100002131 | Ga0070669_1000021314 | 227 |
| 138 | 3300005367 | Ga0070667_100381462 | Ga0070667_1003814622 | 227 |
| 139 | 3300005578 | Ga0068854_100281384 | Ga0068854_1002813842 | 227 |
| 140 | 3300005616 | Ga0068852_100494930 | Ga0068852_1004949302 | 227 |
| 141 | 3300005834 | Ga0068851_10018160 | Ga0068851_100181604 | 227 |
| 142 | 3300005841 | Ga0068863_100037357 | Ga0068863_1000373572 | 227 |
| 143 | 3300005843 | Ga0068860_100741329 | Ga0068860_1007413291 | 227 |
| 144 | 3300009011 | Ga0105251_10001861 | Ga0105251_1000186115 | 227 |
| 145 | 3300009101 | Ga0105247_10120462 | Ga0105247_101204622 | 227 |
| 146 | 3300009177 | Ga0105248_10666392 | Ga0105248_106663922 | 227 |
| 147 | 3300013102 | Ga0157371_10037030 | Ga0157371_100370302 | 227 |
| 148 | 3300013105 | Ga0157369_10214430 | Ga0157369_102144302 | 227 |
| 149 | 3300025735 | Ga0207713_1003490 | Ga0207713_100349012 | 227 |
| 150 | 3300025904 | Ga0207647_10097331 | Ga0207647_100973313 | 227 |
| 151 | 3300025923 | Ga0207681_10000503 | Ga0207681_1000050325 | 227 |
| 152 | 3300025941 | Ga0207711_10460558 | Ga0207711_104605582 | 227 |
| 153 | 3300025986 | Ga0207658_10127449 | Ga0207658_101274492 | 227 |
| 154 | 3300026088 | Ga0207641_10026200 | Ga0207641_100262006 | 227 |
| 155 | 3300028381 | Ga0268264_10679214 | Ga0268264_106792141 | 227 |
| 156 | 3300031548 | Ga0307408_100011485 | Ga0307408_10001148510 | 227 |
| 157 | 3300031901 | Ga0307406_10343640 | Ga0307406_103436401 | 227 |
| 158 | 3300039450 | Ga0436363_0447161 | Ga0436363_0447161_151_837 | 227 |
| 159 | 3300046660 | Ga0495625_0280987 | Ga0495625_0280987_87_773 | 227 |
| 160 | 3300048924 | Ga0496121_0030779 | Ga0496121_0030779_2558_3244 | 227 |
| 161 | 3300048928 | Ga0496125_0000663 | Ga0496125_0000663_23203_23889 | 227 |
| 162 | 3300048928 | Ga0496125_0007697 | Ga0496125_0007697_8004_8690 | 227 |
| 163 | 3300049778 | Ga0501282_002406 | Ga0501282_002406_507_1193 | 227 |
| 164 | 3300050489 | nmdc:mga03683_1742_c2 | nmdc:mga03683_1742_c2_1782_2468 | 227 |
| 165 | 3300053139 | Ga0500568_0002126 | Ga0500568_0002126_7990_8682 | 227 |
| 166 | 3300053140 | Ga0500573_0000040 | Ga0500573_0000040_65991_66680 | 227 |
| 167 | 3300053151 | Ga0500604_0131255 | Ga0500604_0131255_95_781 | 227 |
| 168 | 3300003322 | rootL2_10213732 | rootL2_102137322 | 228 |
| 169 | 3300005347 | Ga0070668_100063796 | Ga0070668_1000637963 | 228 |
| 170 | 3300005356 | Ga0070674_100005703 | Ga0070674_1000057034 | 228 |
| 171 | 3300005548 | Ga0070665_100248968 | Ga0070665_1002489682 | 228 |
| 172 | 3300006195 | Ga0075366_10272813 | Ga0075366_102728132 | 228 |
| 173 | 3300017792 | Ga0163161_10357357 | Ga0163161_103573572 | 228 |
| 174 | 3300025904 | Ga0207647_10064303 | Ga0207647_100643031 | 228 |
| 175 | 3300025907 | Ga0207645_10111275 | Ga0207645_101112752 | 228 |
| 176 | 3300025937 | Ga0207669_10000252 | Ga0207669_1000025219 | 228 |
| 177 | 3300025972 | Ga0207668_10132329 | Ga0207668_101323292 | 228 |
| 178 | 3300026121 | Ga0207683_10004500 | Ga0207683_100045002 | 228 |
| 179 | 3300028379 | Ga0268266_10352579 | Ga0268266_103525792 | 228 |
| 180 | 3300047323 | Ga0495683_0008826 | Ga0495683_0008826_54_743 | 228 |
| 181 | 3300048904 | Ga0496101_0620993 | Ga0496101_0620993_100_789 | 228 |
| 182 | 3300048905 | Ga0496102_0000828 | Ga0496102_0000828_25491_26180 | 228 |
| 183 | 3300048906 | Ga0496103_0000636 | Ga0496103_0000636_485_1174 | 228 |
| 184 | 3300048907 | Ga0496104_0016879 | Ga0496104_0016879_5319_6008 | 228 |
| 185 | 3300048908 | Ga0496105_0053057 | Ga0496105_0053057_2076_2765 | 228 |
| 186 | 3300048913 | Ga0496110_0150078 | Ga0496110_0150078_71_760 | 228 |
| 187 | 3300048914 | Ga0496111_0107975 | Ga0496111_0107975_490_1179 | 228 |
| 188 | 3300048916 | Ga0496113_0126127 | Ga0496113_0126127_1147_1836 | 228 |
| 189 | 3300048918 | Ga0496115_0000624 | Ga0496115_0000624_25482_26171 | 228 |
| 190 | 3300048920 | Ga0496117_0001766 | Ga0496117_0001766_28503_29192 | 228 |
| 191 | 3300048921 | Ga0496118_0001902 | Ga0496118_0001902_582_1271 | 228 |
| 192 | 3300048922 | Ga0496119_0059899 | Ga0496119_0059899_1077_1766 | 228 |
| 193 | 3300048925 | Ga0496122_0000218 | Ga0496122_0000218_118457_119146 | 228 |
| 194 | 3300048925 | Ga0496122_0055155 | Ga0496122_0055155_208_897 | 228 |
| 195 | 3300048926 | Ga0496123_0000089 | Ga0496123_0000089_151671_152360 | 228 |
| 196 | 3300048926 | Ga0496123_0230308 | Ga0496123_0230308_153_842 | 228 |
| 197 | 3300048927 | Ga0496124_0001562 | Ga0496124_0001562_28482_29171 | 228 |
| 198 | 3300048928 | Ga0496125_0001758 | Ga0496125_0001758_3824_4513 | 228 |
| 199 | 3300048929 | Ga0496126_0001925 | Ga0496126_0001925_28467_29156 | 228 |
| 200 | 3300053731 | Ga0500609_010791 | Ga0500609_010791_160_849 | 228 |
| 201 | 3300001990 | JGI24737J22298_10017551 | JGI24737J22298_100175511 | 230 |
| 202 | 3300005331 | Ga0070670_100205498 | Ga0070670_1002054982 | 230 |
| 203 | 3300005334 | Ga0068869_100112051 | Ga0068869_1001120512 | 230 |
| 204 | 3300005339 | Ga0070660_100140574 | Ga0070660_1001405742 | 230 |
| 205 | 3300005347 | Ga0070668_100527690 | Ga0070668_1005276902 | 230 |
| 206 | 3300005353 | Ga0070669_100195257 | Ga0070669_1001952572 | 230 |
| 207 | 3300005355 | Ga0070671_100003907 | Ga0070671_1000039072 | 230 |
| 208 | 3300005366 | Ga0070659_100022086 | Ga0070659_1000220862 | 230 |
| 209 | 3300005367 | Ga0070667_100202539 | Ga0070667_1002025392 | 230 |
| 210 | 3300005457 | Ga0070662_100112453 | Ga0070662_1001124532 | 230 |
| 211 | 3300005459 | Ga0068867_100006694 | Ga0068867_10000669413 | 230 |
| 212 | 3300005563 | Ga0068855_100345754 | Ga0068855_1003457542 | 230 |
| 213 | 3300005578 | Ga0068854_100015063 | Ga0068854_1000150635 | 230 |
| 214 | 3300005618 | Ga0068864_100149815 | Ga0068864_1001498152 | 230 |
| 215 | 3300005842 | Ga0068858_100247841 | Ga0068858_1002478412 | 230 |
| 216 | 3300009098 | Ga0105245_10306325 | Ga0105245_103063252 | 230 |
| 217 | 3300009177 | Ga0105248_10051813 | Ga0105248_100518131 | 230 |
| 218 | 3300010375 | Ga0105239_10430380 | Ga0105239_104303801 | 230 |
| 219 | 3300013297 | Ga0157378_10145716 | Ga0157378_101457162 | 230 |
| 220 | 3300014325 | Ga0163163_10033978 | Ga0163163_100339782 | 230 |
| 221 | 3300025901 | Ga0207688_10003457 | Ga0207688_100034572 | 230 |
| 222 | 3300025904 | Ga0207647_10001132 | Ga0207647_1000113229 | 230 |
| 223 | 3300025913 | Ga0207695_10027305 | Ga0207695_100273052 | 230 |
| 224 | 3300025919 | Ga0207657_10065260 | Ga0207657_100652604 | 230 |
| 225 | 3300025923 | Ga0207681_10200064 | Ga0207681_102000642 | 230 |
| 226 | 3300025932 | Ga0207690_10046586 | Ga0207690_100465863 | 230 |
| 227 | 3300025933 | Ga0207706_10001910 | Ga0207706_1000191028 | 230 |
| 228 | 3300025941 | Ga0207711_10055105 | Ga0207711_100551051 | 230 |
| 229 | 3300025949 | Ga0207667_10002702 | Ga0207667_100027029 | 230 |
| 230 | 3300025972 | Ga0207668_10764797 | Ga0207668_107647971 | 230 |
| 231 | 3300025981 | Ga0207640_10099018 | Ga0207640_100990182 | 230 |
| 232 | 3300025986 | Ga0207658_10185015 | Ga0207658_101850152 | 230 |
| 233 | 3300026035 | Ga0207703_10012660 | Ga0207703_100126602 | 230 |
| 234 | 3300026089 | Ga0207648_10002331 | Ga0207648_1000233128 | 230 |
| 235 | 3300026095 | Ga0207676_10131937 | Ga0207676_101319372 | 230 |
| 236 | 3300049571 | Ga0501034_0017856 | Ga0501034_0017856_4543_5241 | 230 |
| 237 | 3300049574 | Ga0501038_0426554 | Ga0501038_0426554_76_774 | 230 |
| 238 | 3300049581 | Ga0501047_0047272 | Ga0501047_0047272_1234_1932 | 230 |
| 239 | 3300049586 | Ga0501070_0030337 | Ga0501070_0030337_3519_4217 | 230 |
| 240 | 3300049822 | Ga0501035_0019183 | Ga0501035_0019183_4379_5077 | 230 |
| 241 | 3300049823 | Ga0501044_0120349 | Ga0501044_0120349_1791_2489 | 230 |
| 242 | iso_pu_bacteria | 2513237094 | 2513637308 | 230 |
| 243 | 3300053157 | Ga0500624_000019 | Ga0500624_000019_106887_107597 | 231 |
| 244 | 3300005843 | Ga0068860_100148141 | Ga0068860_1001481412 | 232 |
| 245 | 3300005844 | Ga0068862_100001858 | Ga0068862_10000185813 | 232 |
| 246 | 3300010375 | Ga0105239_10190998 | Ga0105239_101909982 | 232 |
| 247 | 3300028380 | Ga0268265_10001878 | Ga0268265_100018788 | 232 |
| 248 | 3300048921 | Ga0496118_0031960 | Ga0496118_0031960_2008_2715 | 232 |
| 249 | 3300048926 | Ga0496123_0211814 | Ga0496123_0211814_205_912 | 232 |
| 250 | 3300048927 | Ga0496124_0009604 | Ga0496124_0009604_7380_8087 | 232 |
| 251 | 3300048927 | Ga0496124_0151482 | Ga0496124_0151482_921_1628 | 232 |
| 252 | 3300048928 | Ga0496125_0030926 | Ga0496125_0030926_2244_2951 | 232 |
| 253 | 3300048929 | Ga0496126_0001769 | Ga0496126_0001769_23682_24389 | 232 |
| 254 | 3300049850 | Ga0501204_009859 | Ga0501204_009859_322_1044 | 232 |
| 255 | 3300037471 | Ga0395905_0265828 | Ga0395905_0265828_159_956 | 234 |
| 256 | 3300009551 | Ga0105238_10007431 | Ga0105238_100074312 | 238 |
| 257 | 3300025924 | Ga0207694_10004494 | Ga0207694_1000449410 | 238 |
| 258 | 3300049853 | Ga0501226_012046 | Ga0501226_012046_44_877 | 238 |
| 259 | 3300001989 | JGI24739J22299_10012142 | JGI24739J22299_100121424 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7twe-assembly1.cif.gz_A | crystal structure of the putative oxidoreductase of duf1479-containing protein family ypo2976 from yersinia pestis bound to 2-oxo-glutaric acid | 0.7593 | 144 | 230 |
| 7dt0-assembly4.cif.gz_F | proline hydroxylase h11-n101i mutant | 0.7269 | 23 | 227 |
| 7e09-assembly1.cif.gz_A-2 | trans-3/4-proline-hydroxylase h11 with 3-hydroxyl-proline | 0.7251 | 23 | 227 |
| 8h81-assembly1.cif.gz_A | trans-3/4-proline-hydroxylase h11 with 4-hydroxyl-proline | 0.7205 | 23 | 227 |
| 7dt0-assembly2.cif.gz_B | proline hydroxylase h11-n101i mutant | 0.7183 | 23 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PEJ2_2_436_2.60.120.330 | Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain | 0.7426 | 144 | 226 | 2.60.120.330 |
| af_A0A1D6Q4J3_1_128_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7209 | 143 | 234 | 2.60.120.620 |
| af_A8E5P7_122_256_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7156 | 145 | 230 | 2.60.120.620 |
| af_Q9NAM7_3_287_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7095 | 23 | 230 | 2.60.120.620 |
| 1o4tB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.6857 | 79 | 226 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z0GBJ5-F1-model_v4 | deleted | 0.9832 | 18 | 206 |
|
| AF-A0A7Z0GBJ5-F1-model_v4 | deleted | 0.9582 | 18 | 206 |
|
| AF-A0A521SGW9-F1-model_v4 | deleted | 0.9551 | 21 | 185 |
|
| AF-A0A7W5MYM6-F1-model_v4 | Phytanoyl-CoA dioxygenase PhyH | 0.9499 | 18 | 233 |
|
| AF-A0A679JGY7-F1-model_v4 | Phytanoyl-CoA dioxygenase | 0.9485 | 18 | 232 |
GO:0005506
GO:0016706 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar