F368966

General Info

Members Datasets Scaffolds Average Seq Length
259 169 253 228

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0265828|Ga0395905_0265828_159_956
Length 265
Sequence MVFESRSHFTTALSKKARESNVGLPPIADTTPLAVAPPVVRAADALGPLVREGAVRLPNAALGRLADLADTLREYPSDEAGVRIHGNARLKRLLDREGPIGAIAATALGEHSRPVRAILFNKTPKTNWSLGWHQDRTIAVSEQRDVPGFGPWTVKGGMHHVEPPLELLARMVTLRVHFDDVDAQNAPLLVAPGSHRIGRVKEADIDQVVRRCGTLACLAAAGDVWLYSTPILHASEAARAPRARRVLQVDYAAEDLPNGLEWLGV

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
155 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
169 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.58
Nodule 0.39
Rhizoplane 4.25
Rhizosphere 71.81
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012142 3300001989 Bacteria 3163
2 JGI24737J22298_10017551 3300001990 Unclassified 2303
3 JGI25165J46597_1000012 3300003214 Bacteria 421074
4 rootL2_10213732 3300003322 Bacteria 2268
5 Ga0055537_1004554 3300003773 Bacteria 3944
6 Ga0055530_10043239 3300003791 Bacteria 1088
7 Ga0065165_1053434 3300005262 Bacteria 1137
8 Ga0070658_10016463 3300005327 Bacteria 5918
9 Ga0070658_10676438 3300005327 Bacteria 896
10 Ga0070676_10113724 3300005328 Bacteria 1689
11 Ga0070670_100205498 3300005331 Bacteria 1712
12 Ga0070670_100221189 3300005331 Unclassified 1647
13 Ga0070670_100292998 3300005331 Bacteria 1422
14 Ga0068869_100112051 3300005334 Bacteria 2076
15 Ga0070660_100020649 3300005339 Bacteria 4845
16 Ga0070660_100140574 3300005339 Bacteria 1937
17 Ga0070661_100000042 3300005344 Bacteria 99327
18 Ga0070668_100063796 3300005347 Bacteria 2856
19 Ga0070668_100527690 3300005347 Bacteria 1025
20 Ga0070669_100002131 3300005353 Bacteria 14306
21 Ga0070669_100195257 3300005353 Bacteria 1590
22 Ga0070671_100003907 3300005355 Bacteria 11721
23 Ga0070674_100005703 3300005356 Bacteria 7222
24 Ga0070673_100165029 3300005364 Bacteria 1886
25 Ga0070659_100022086 3300005366 Bacteria 4856
26 Ga0070667_100202539 3300005367 Bacteria 1761
27 Ga0070667_100381462 3300005367 Bacteria 1280
28 Ga0070663_100005331 3300005455 Bacteria 7630
29 Ga0070662_100112453 3300005457 Bacteria 2076
30 Ga0068867_100006694 3300005459 Bacteria 8145
31 Ga0070665_100012021 3300005548 Bacteria 8732
32 Ga0070665_100248968 3300005548 Bacteria 1778
33 Ga0070665_100448694 3300005548 Bacteria 1299
34 Ga0068855_100345754 3300005563 Bacteria 1639
35 Ga0070664_100239779 3300005564 Unclassified 1627
36 Ga0068857_100005430 3300005577 Bacteria 10868
37 Ga0068857_100036094 3300005577 Bacteria 4380
38 Ga0068857_100287836 3300005577 Bacteria 1512
39 Ga0068854_100015063 3300005578 Bacteria 5111
40 Ga0068854_100031827 3300005578 Bacteria 3667
41 Ga0068854_100281384 3300005578 Bacteria 1339
42 Ga0068856_100133228 3300005614 Bacteria 2490
43 Ga0068852_100494930 3300005616 Bacteria 1217
44 Ga0068859_100000448 3300005617 Bacteria 41237
45 Ga0068859_100065380 3300005617 Bacteria 3671
46 Ga0068859_100587738 3300005617 Bacteria 1207
47 Ga0068864_100057767 3300005618 Unclassified 3352
48 Ga0068864_100149815 3300005618 Bacteria 2112
49 Ga0068864_100253647 3300005618 Bacteria 1634
50 Ga0068851_10018160 3300005834 Bacteria 3387
51 Ga0068863_100021768 3300005841 Bacteria 6117
52 Ga0068863_100037357 3300005841 Bacteria 4624
53 Ga0068863_100786648 3300005841 Bacteria 948
54 Ga0068863_100807654 3300005841 Unclassified 936
55 Ga0068858_100002043 3300005842 Bacteria 20565
56 Ga0068858_100027453 3300005842 Bacteria 5288
57 Ga0068858_100247841 3300005842 Bacteria 1692
58 Ga0068860_100008590 3300005843 Bacteria 10181
59 Ga0068860_100148141 3300005843 Bacteria 2259
60 Ga0068860_100741329 3300005843 Bacteria 993
61 Ga0068862_100001858 3300005844 Bacteria 19137
62 Ga0068862_100050964 3300005844 Unclassified 3539
63 Ga0075368_10000498 3300006042 Bacteria 11644
64 Ga0075367_10000330 3300006178 Bacteria 16782
65 Ga0075366_10272813 3300006195 Bacteria 1033
66 Ga0097620_100000448 3300006931 Bacteria 41237
67 Ga0097620_100065377 3300006931 Bacteria 3671
68 Ga0097620_100587750 3300006931 Bacteria 1207
69 Ga0105251_10001861 3300009011 Bacteria 17335
70 Ga0105240_10001076 3300009093 Bacteria 48242
71 Ga0105245_10306325 3300009098 Bacteria 1560
72 Ga0105247_10120462 3300009101 Bacteria 1699
73 Ga0105243_10138484 3300009148 Unclassified 2073
74 Ga0105241_10049588 3300009174 Unclassified 3198
75 Ga0105248_10003638 3300009177 Bacteria 17113
76 Ga0105248_10051813 3300009177 Bacteria 4605
77 Ga0105248_10666392 3300009177 Bacteria 1174
78 Ga0105238_10007431 3300009551 Bacteria 10975
79 Ga0105238_10073296 3300009551 Bacteria 3419
80 Ga0105249_10048846 3300009553 Bacteria 3858
81 Ga0105239_10190998 3300010375 Bacteria 2292
82 Ga0105239_10430380 3300010375 Bacteria 1496
83 Ga0105239_10611935 3300010375 Bacteria 1243
84 Ga0105246_10118870 3300011119 Unclassified 1955
85 Ga0157371_10037030 3300013102 Bacteria 3494
86 Ga0157369_10001565 3300013105 Bacteria 28007
87 Ga0157369_10214430 3300013105 Bacteria 2017
88 Ga0157378_10145716 3300013297 Bacteria 2202
89 Ga0163162_10009790 3300013306 Bacteria 9326
90 Ga0163163_10033978 3300014325 Bacteria 4936
91 Ga0163161_10107055 3300017792 Unclassified 2087
92 Ga0163161_10188789 3300017792 Bacteria 1583
93 Ga0163161_10357357 3300017792 Bacteria 1163
94 Ga0209233_1000058 3300025261 Bacteria 421872
95 Ga0209565_1000044 3300025263 Bacteria 229969
96 Ga0209673_1023642 3300025273 Bacteria 2087
97 Ga0209564_1032016 3300025295 Bacteria 1592
98 Ga0209050_1019153 3300025298 Bacteria 2616
99 Ga0207426_1035347 3300025302 Bacteria 1595
100 Ga0209257_1006725 3300025304 Bacteria 7267
101 Ga0207713_1003490 3300025735 Bacteria 10679
102 Ga0207688_10003457 3300025901 Bacteria 8615
103 Ga0207647_10001132 3300025904 Bacteria 20537
104 Ga0207647_10064303 3300025904 Bacteria 2230
105 Ga0207647_10097331 3300025904 Bacteria 1750
106 Ga0207645_10111275 3300025907 Bacteria 1773
107 Ga0207705_10039553 3300025909 Bacteria 3381
108 Ga0207695_10027305 3300025913 Bacteria 6359
109 Ga0207657_10030907 3300025919 Bacteria 4855
110 Ga0207657_10065260 3300025919 Bacteria 3104
111 Ga0207649_10000047 3300025920 Bacteria 110856
112 Ga0207681_10000503 3300025923 Bacteria 27243
113 Ga0207681_10020828 3300025923 Unclassified 4162
114 Ga0207681_10200064 3300025923 Bacteria 1533
115 Ga0207694_10004494 3300025924 Bacteria 10884
116 Ga0207694_10052732 3300025924 Bacteria 3153
117 Ga0207687_10008468 3300025927 Bacteria 6724
118 Ga0207690_10046586 3300025932 Bacteria 2872
119 Ga0207706_10001910 3300025933 Bacteria 20460
120 Ga0207669_10000252 3300025937 Bacteria 24461
121 Ga0207711_10002908 3300025941 Bacteria 15009
122 Ga0207711_10055105 3300025941 Bacteria 3413
123 Ga0207711_10460558 3300025941 Bacteria 1184
124 Ga0207667_10002702 3300025949 Bacteria 21955
125 Ga0207668_10132329 3300025972 Bacteria 1906
126 Ga0207668_10764797 3300025972 Unclassified 853
127 Ga0207640_10022469 3300025981 Bacteria 3776
128 Ga0207640_10099018 3300025981 Bacteria 2040
129 Ga0207658_10127449 3300025986 Bacteria 2039
130 Ga0207658_10185015 3300025986 Bacteria 1727
131 Ga0207703_10002444 3300026035 Bacteria 16115
132 Ga0207703_10012660 3300026035 Bacteria 6579
133 Ga0207703_10031561 3300026035 Unclassified 4190
134 Ga0207678_10008920 3300026067 Bacteria 8827
135 Ga0207641_10012206 3300026088 Bacteria 7050
136 Ga0207641_10026200 3300026088 Bacteria 4811
137 Ga0207641_10354260 3300026088 Unclassified 1399
138 Ga0207641_10589778 3300026088 Unclassified 1087
139 Ga0207648_10002331 3300026089 Bacteria 20497
140 Ga0207676_10051988 3300026095 Unclassified 3200
141 Ga0207676_10131937 3300026095 Bacteria 2125
142 Ga0207674_10008912 3300026116 Bacteria 11530
143 Ga0207674_10011227 3300026116 Bacteria 10066
144 Ga0207674_10019358 3300026116 Bacteria 7375
145 Ga0207674_10170315 3300026116 Unclassified 2131
146 Ga0207674_10251389 3300026116 Bacteria 1715
147 Ga0207683_10004500 3300026121 Bacteria 12025
148 Ga0207698_10791918 3300026142 Unclassified 950
149 Ga0209813_10000182 3300027866 Bacteria 20378
150 Ga0268266_10130238 3300028379 Bacteria 2249
151 Ga0268266_10352579 3300028379 Bacteria 1383
152 Ga0268265_10001878 3300028380 Bacteria 16707
153 Ga0268264_10029392 3300028381 Bacteria 4500
154 Ga0268264_10679214 3300028381 Bacteria 1021
155 Ga0307408_100011485 3300031548 Bacteria 5851
156 Ga0307405_10298050 3300031731 Bacteria 1222
157 Ga0307406_10343640 3300031901 Unclassified 1163
158 Ga0307407_10058220 3300031903 Bacteria 2245
159 Ga0307412_10237699 3300031911 Bacteria 1407
160 Ga0307409_100082373 3300031995 Bacteria 2604
161 Ga0307416_100127991 3300032002 Bacteria 2279
162 Ga0307414_10012911 3300032004 Bacteria 4958
163 Ga0395899_0055315 3300037312 Bacteria 2935
164 Ga0395899_0143095 3300037312 Bacteria 1700
165 Ga0395899_0262741 3300037312 Bacteria 1180
166 Ga0395900_0033178 3300037418 Bacteria 5313
167 Ga0395900_0102725 3300037418 Bacteria 2936
168 Ga0395900_0214628 3300037418 Bacteria 1942
169 Ga0395900_0291669 3300037418 Bacteria 1620
170 Ga0395898_0006326 3300037466 Bacteria 12652
171 Ga0395898_0953073 3300037466 Bacteria 795
172 Ga0395905_0265828 3300037471 Bacteria 1601
173 Ga0395905_0339267 3300037471 Bacteria 1394
174 Ga0395905_0908812 3300037471 Unclassified 783
175 Ga0395901_0004771 3300038443 Bacteria 13679
176 Ga0395901_0130052 3300038443 Bacteria 2645
177 Ga0395901_0253902 3300038443 Bacteria 1831
178 Ga0436363_0447161 3300039450 Bacteria 1013
179 Ga0450920_004311 3300042122 Bacteria 2493
180 Ga0439458_0000025 3300042157 Bacteria 23156
181 Ga0439435_0030544 3300042436 Bacteria 1461
182 Ga0495638_0000336 3300046460 Bacteria 59114
183 Ga0495639_0071878 3300046475 Bacteria 1599
184 Ga0495606_0004929 3300046507 Bacteria 13059
185 Ga0495633_0043244 3300046558 Bacteria 2137
186 Ga0495625_0280987 3300046660 Bacteria 1071
187 Ga0495671_0000062 3300046692 Bacteria 106672
188 Ga0495683_0008826 3300047323 Bacteria 5376
189 Ga0495681_0006067 3300047470 Bacteria 7988
190 Ga0495686_0139137 3300047472 Bacteria 1433
191 Ga0496101_0620993 3300048904 Bacteria 854
192 Ga0496102_0000828 3300048905 Bacteria 29896
193 Ga0496103_0000636 3300048906 Bacteria 26810
194 Ga0496104_0016879 3300048907 Bacteria 6639
195 Ga0496105_0053057 3300048908 Bacteria 3348
196 Ga0496110_0150078 3300048913 Bacteria 2110
197 Ga0496111_0107975 3300048914 Bacteria 2049
198 Ga0496113_0126127 3300048916 Bacteria 2005
199 Ga0496115_0000624 3300048918 Bacteria 26823
200 Ga0496115_0000906 3300048918 Bacteria 21502
201 Ga0496117_0001766 3300048920 Bacteria 29764
202 Ga0496118_0001902 3300048921 Bacteria 29748
203 Ga0496118_0015051 3300048921 Bacteria 7191
204 Ga0496118_0031960 3300048921 Bacteria 4348
205 Ga0496118_0266004 3300048921 Unclassified 964
206 Ga0496119_0059899 3300048922 Bacteria 2283
207 Ga0496121_0014523 3300048924 Bacteria 8349
208 Ga0496121_0030779 3300048924 Bacteria 4922
209 Ga0496122_0000218 3300048925 Bacteria 127770
210 Ga0496122_0012639 3300048925 Bacteria 8372
211 Ga0496122_0055155 3300048925 Bacteria 2977
212 Ga0496123_0000089 3300048926 Bacteria 179941
213 Ga0496123_0003280 3300048926 Bacteria 18335
214 Ga0496123_0010286 3300048926 Bacteria 8299
215 Ga0496123_0211814 3300048926 Bacteria 984
216 Ga0496123_0230308 3300048926 Bacteria 928
217 Ga0496124_0001562 3300048927 Bacteria 33102
218 Ga0496124_0009604 3300048927 Bacteria 9915
219 Ga0496124_0011763 3300048927 Bacteria 8725
220 Ga0496124_0096260 3300048927 Bacteria 2405
221 Ga0496124_0151482 3300048927 Bacteria 1818
222 Ga0496125_0000663 3300048928 Bacteria 57400
223 Ga0496125_0001758 3300048928 Bacteria 30058
224 Ga0496125_0007697 3300048928 Bacteria 11417
225 Ga0496125_0011023 3300048928 Bacteria 9075
226 Ga0496125_0030926 3300048928 Bacteria 4779
227 Ga0496126_0001769 3300048929 Bacteria 31972
228 Ga0496126_0001925 3300048929 Bacteria 29687
229 Ga0501034_0017856 3300049571 Bacteria 7277
230 Ga0501038_0426554 3300049574 Bacteria 1022
231 Ga0501047_0047272 3300049581 Bacteria 4158
232 Ga0501070_0030337 3300049586 Unclassified 4530
233 Ga0501282_002406 3300049778 Bacteria 2038
234 Ga0501035_0019183 3300049822 Bacteria 6296
235 Ga0501044_0120349 3300049823 Bacteria 2627
236 Ga0501044_0528057 3300049823 Bacteria 1079
237 Ga0501204_009859 3300049850 Bacteria 1111
238 Ga0501226_012046 3300049853 Unclassified 958
239 nmdc:mga03683_1742_c2 3300050489 Bacteria 3912
240 nmdc:mga03n38_22734_c1 3300050490 Bacteria 2542
241 nmdc:mga06z11_443_c1 3300050494 Bacteria 15505
242 nmdc:mga04h51_151_c1 3300050495 Bacteria 20376
243 Ga0500562_001980 3300053108 Bacteria 5137
244 Ga0500658_0000979 3300053134 Bacteria 11665
245 Ga0500658_0030191 3300053134 Bacteria 2112
246 Ga0500559_0013100 3300053136 Bacteria 3517
247 Ga0500564_026050 3300053138 Bacteria 2687
248 Ga0500568_0002126 3300053139 Bacteria 11964
249 Ga0500573_0000040 3300053140 Bacteria 105074
250 Ga0500604_0131255 3300053151 Archaea 842
251 Ga0500624_000019 3300053157 Bacteria 125903
252 Ga0500567_006198 3300053723 Bacteria 5572
253 Ga0500609_010791 3300053731 Bacteria 1233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100020649 Ga0070660_1000206493 211
2 3300005344 Ga0070661_100000042 Ga0070661_10000004261 211
3 3300025919 Ga0207657_10030907 Ga0207657_100309073 211
4 3300025920 Ga0207649_10000047 Ga0207649_1000004765 211
5 3300013306 Ga0163162_10009790 Ga0163162_100097902 212
6 3300025927 Ga0207687_10008468 Ga0207687_100084682 213
7 3300053134 Ga0500658_0030191 Ga0500658_0030191_101_745 213
8 3300037466 Ga0395898_0953073 Ga0395898_0953073_31_681 215
9 iso_pu_bacteria 2599185359 2600227007 215
10 iso_pu_bacteria 2879163058 2879163444 215
11 iso_pu_bacteria 2928968154 2928970952 215
12 3300025302 Ga0207426_1035347 Ga0207426_10353473 216
13 3300037312 Ga0395899_0055315 Ga0395899_0055315_1851_2612 216
14 3300037312 Ga0395899_0143095 Ga0395899_0143095_205_879 216
15 3300037418 Ga0395900_0033178 Ga0395900_0033178_2610_3284 216
16 3300037418 Ga0395900_0102725 Ga0395900_0102725_408_1085 216
17 3300037418 Ga0395900_0291669 Ga0395900_0291669_634_1287 216
18 3300037466 Ga0395898_0006326 Ga0395898_0006326_3235_3996 216
19 3300037471 Ga0395905_0339267 Ga0395905_0339267_247_924 216
20 3300038443 Ga0395901_0004771 Ga0395901_0004771_11631_12308 216
21 3300038443 Ga0395901_0130052 Ga0395901_0130052_828_1502 216
22 3300042157 Ga0439458_0000025 Ga0439458_0000025_10108_10770 216
23 3300005328 Ga0070676_10113724 Ga0070676_101137242 217
24 3300005364 Ga0070673_100165029 Ga0070673_1001650292 217
25 3300042122 Ga0450920_004311 Ga0450920_004311_1230_1892 217
26 3300005327 Ga0070658_10676438 Ga0070658_106764382 218
27 3300005331 Ga0070670_100221189 Ga0070670_1002211892 218
28 3300005455 Ga0070663_100005331 Ga0070663_1000053313 218
29 3300005548 Ga0070665_100012021 Ga0070665_1000120218 218
30 3300005564 Ga0070664_100239779 Ga0070664_1002397792 218
31 3300005577 Ga0068857_100005430 Ga0068857_1000054309 218
32 3300005577 Ga0068857_100287836 Ga0068857_1002878361 218
33 3300005614 Ga0068856_100133228 Ga0068856_1001332283 218
34 3300005617 Ga0068859_100065380 Ga0068859_1000653802 218
35 3300005618 Ga0068864_100057767 Ga0068864_1000577674 218
36 3300005841 Ga0068863_100021768 Ga0068863_1000217683 218
37 3300005841 Ga0068863_100786648 Ga0068863_1007866482 218
38 3300005841 Ga0068863_100807654 Ga0068863_1008076541 218
39 3300005842 Ga0068858_100027453 Ga0068858_1000274535 218
40 3300005843 Ga0068860_100008590 Ga0068860_1000085904 218
41 3300005844 Ga0068862_100050964 Ga0068862_1000509642 218
42 3300006931 Ga0097620_100065377 Ga0097620_1000653775 218
43 3300009093 Ga0105240_10001076 Ga0105240_1000107611 218
44 3300009148 Ga0105243_10138484 Ga0105243_101384841 218
45 3300009174 Ga0105241_10049588 Ga0105241_100495884 218
46 3300009553 Ga0105249_10048846 Ga0105249_100488465 218
47 3300011119 Ga0105246_10118870 Ga0105246_101188702 218
48 3300013105 Ga0157369_10001565 Ga0157369_1000156518 218
49 3300025923 Ga0207681_10020828 Ga0207681_100208282 218
50 3300026035 Ga0207703_10031561 Ga0207703_100315615 218
51 3300026067 Ga0207678_10008920 Ga0207678_100089203 218
52 3300026088 Ga0207641_10012206 Ga0207641_100122062 218
53 3300026088 Ga0207641_10354260 Ga0207641_103542602 218
54 3300026088 Ga0207641_10589778 Ga0207641_105897781 218
55 3300026095 Ga0207676_10051988 Ga0207676_100519882 218
56 3300026116 Ga0207674_10008912 Ga0207674_1000891210 218
57 3300026116 Ga0207674_10170315 Ga0207674_101703152 218
58 3300026116 Ga0207674_10251389 Ga0207674_102513892 218
59 3300026142 Ga0207698_10791918 Ga0207698_107919181 218
60 3300028379 Ga0268266_10130238 Ga0268266_101302382 218
61 3300028381 Ga0268264_10029392 Ga0268264_100293923 218
62 3300031731 Ga0307405_10298050 Ga0307405_102980501 218
63 3300037471 Ga0395905_0908812 Ga0395905_0908812_25_687 218
64 3300047472 Ga0495686_0139137 Ga0495686_0139137_688_1368 218
65 3300053108 Ga0500562_001980 Ga0500562_001980_4140_4802 218
66 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012347 219
67 3300005577 Ga0068857_100036094 Ga0068857_1000360945 219
68 3300005617 Ga0068859_100000448 Ga0068859_1000004488 219
69 3300005618 Ga0068864_100253647 Ga0068864_1002536472 219
70 3300006931 Ga0097620_100000448 Ga0097620_1000004488 219
71 3300009551 Ga0105238_10073296 Ga0105238_100732964 219
72 3300010375 Ga0105239_10611935 Ga0105239_106119352 219
73 3300025261 Ga0209233_1000058 Ga0209233_100005871 219
74 3300025304 Ga0209257_1006725 Ga0209257_10067258 219
75 3300025924 Ga0207694_10052732 Ga0207694_100527322 219
76 3300026116 Ga0207674_10011227 Ga0207674_100112277 219
77 3300048926 Ga0496123_0010286 Ga0496123_0010286_1665_2327 219
78 3300048927 Ga0496124_0011763 Ga0496124_0011763_5116_5778 219
79 3300053136 Ga0500559_0013100 Ga0500559_0013100_1412_2074 219
80 3300017792 Ga0163161_10188789 Ga0163161_101887892 220
81 3300046558 Ga0495633_0043244 Ga0495633_0043244_606_1280 220
82 3300046692 Ga0495671_0000062 Ga0495671_0000062_76270_76944 220
83 3300047470 Ga0495681_0006067 Ga0495681_0006067_5629_6303 220
84 3300048927 Ga0496124_0096260 Ga0496124_0096260_30_743 220
85 3300031903 Ga0307407_10058220 Ga0307407_100582201 221
86 3300031995 Ga0307409_100082373 Ga0307409_1000823733 221
87 3300032002 Ga0307416_100127991 Ga0307416_1001279912 221
88 3300032004 Ga0307414_10012911 Ga0307414_100129116 221
89 3300042436 Ga0439435_0030544 Ga0439435_0030544_22_699 221
90 3300048921 Ga0496118_0266004 Ga0496118_0266004_17_691 221
91 3300005548 Ga0070665_100448694 Ga0070665_1004486942 222
92 3300046460 Ga0495638_0000336 Ga0495638_0000336_18126_18797 222
93 3300053134 Ga0500658_0000979 Ga0500658_0000979_3479_4150 222
94 3300003773 Ga0055537_1004554 Ga0055537_10045542 223
95 3300003791 Ga0055530_10043239 Ga0055530_100432392 223
96 3300005262 Ga0065165_1053434 Ga0065165_10534342 223
97 3300005617 Ga0068859_100587738 Ga0068859_1005877382 223
98 3300005842 Ga0068858_100002043 Ga0068858_1000020433 223
99 3300006931 Ga0097620_100587750 Ga0097620_1005877502 223
100 3300009177 Ga0105248_10003638 Ga0105248_1000363815 223
101 3300017792 Ga0163161_10107055 Ga0163161_101070552 223
102 3300025263 Ga0209565_1000044 Ga0209565_1000044175 223
103 3300025273 Ga0209673_1023642 Ga0209673_10236423 223
104 3300025295 Ga0209564_1032016 Ga0209564_10320162 223
105 3300025298 Ga0209050_1019153 Ga0209050_10191533 223
106 3300025941 Ga0207711_10002908 Ga0207711_1000290810 223
107 3300026035 Ga0207703_10002444 Ga0207703_100024443 223
108 3300046507 Ga0495606_0004929 Ga0495606_0004929_5994_6668 223
109 3300048925 Ga0496122_0012639 Ga0496122_0012639_4623_5297 223
110 3300048926 Ga0496123_0003280 Ga0496123_0003280_5180_5854 223
111 iso_pu_bacteria 2510917021 2511131063 223
112 iso_pu_bacteria 2852653556 2852655616 223
113 3300005327 Ga0070658_10016463 Ga0070658_100164636 224
114 3300005331 Ga0070670_100292998 Ga0070670_1002929982 224
115 3300006042 Ga0075368_10000498 Ga0075368_1000049810 224
116 3300006178 Ga0075367_10000330 Ga0075367_100003307 224
117 3300025909 Ga0207705_10039553 Ga0207705_100395531 224
118 3300027866 Ga0209813_10000182 Ga0209813_1000018221 224
119 3300037312 Ga0395899_0262741 Ga0395899_0262741_200_880 224
120 3300037418 Ga0395900_0214628 Ga0395900_0214628_987_1667 224
121 3300038443 Ga0395901_0253902 Ga0395901_0253902_80_760 224
122 3300046475 Ga0495639_0071878 Ga0495639_0071878_584_1261 224
123 3300048918 Ga0496115_0000906 Ga0496115_0000906_17678_18355 224
124 3300049823 Ga0501044_0528057 Ga0501044_0528057_183_860 224
125 3300050490 nmdc:mga03n38_22734_c1 nmdc:mga03n38_22734_c1_1424_2104 224
126 3300050494 nmdc:mga06z11_443_c1 nmdc:mga06z11_443_c1_14116_14796 224
127 3300050495 nmdc:mga04h51_151_c1 nmdc:mga04h51_151_c1_5581_6261 224
128 3300053138 Ga0500564_026050 Ga0500564_026050_716_1393 224
129 3300053723 Ga0500567_006198 Ga0500567_006198_3517_4194 224
130 3300005578 Ga0068854_100031827 Ga0068854_1000318272 225
131 3300025981 Ga0207640_10022469 Ga0207640_100224693 225
132 3300026116 Ga0207674_10019358 Ga0207674_100193588 225
133 3300031911 Ga0307412_10237699 Ga0307412_102376991 225
134 3300048921 Ga0496118_0015051 Ga0496118_0015051_3018_3698 225
135 3300048924 Ga0496121_0014523 Ga0496121_0014523_5030_5713 225
136 3300048928 Ga0496125_0011023 Ga0496125_0011023_65_748 226
137 3300005353 Ga0070669_100002131 Ga0070669_1000021314 227
138 3300005367 Ga0070667_100381462 Ga0070667_1003814622 227
139 3300005578 Ga0068854_100281384 Ga0068854_1002813842 227
140 3300005616 Ga0068852_100494930 Ga0068852_1004949302 227
141 3300005834 Ga0068851_10018160 Ga0068851_100181604 227
142 3300005841 Ga0068863_100037357 Ga0068863_1000373572 227
143 3300005843 Ga0068860_100741329 Ga0068860_1007413291 227
144 3300009011 Ga0105251_10001861 Ga0105251_1000186115 227
145 3300009101 Ga0105247_10120462 Ga0105247_101204622 227
146 3300009177 Ga0105248_10666392 Ga0105248_106663922 227
147 3300013102 Ga0157371_10037030 Ga0157371_100370302 227
148 3300013105 Ga0157369_10214430 Ga0157369_102144302 227
149 3300025735 Ga0207713_1003490 Ga0207713_100349012 227
150 3300025904 Ga0207647_10097331 Ga0207647_100973313 227
151 3300025923 Ga0207681_10000503 Ga0207681_1000050325 227
152 3300025941 Ga0207711_10460558 Ga0207711_104605582 227
153 3300025986 Ga0207658_10127449 Ga0207658_101274492 227
154 3300026088 Ga0207641_10026200 Ga0207641_100262006 227
155 3300028381 Ga0268264_10679214 Ga0268264_106792141 227
156 3300031548 Ga0307408_100011485 Ga0307408_10001148510 227
157 3300031901 Ga0307406_10343640 Ga0307406_103436401 227
158 3300039450 Ga0436363_0447161 Ga0436363_0447161_151_837 227
159 3300046660 Ga0495625_0280987 Ga0495625_0280987_87_773 227
160 3300048924 Ga0496121_0030779 Ga0496121_0030779_2558_3244 227
161 3300048928 Ga0496125_0000663 Ga0496125_0000663_23203_23889 227
162 3300048928 Ga0496125_0007697 Ga0496125_0007697_8004_8690 227
163 3300049778 Ga0501282_002406 Ga0501282_002406_507_1193 227
164 3300050489 nmdc:mga03683_1742_c2 nmdc:mga03683_1742_c2_1782_2468 227
165 3300053139 Ga0500568_0002126 Ga0500568_0002126_7990_8682 227
166 3300053140 Ga0500573_0000040 Ga0500573_0000040_65991_66680 227
167 3300053151 Ga0500604_0131255 Ga0500604_0131255_95_781 227
168 3300003322 rootL2_10213732 rootL2_102137322 228
169 3300005347 Ga0070668_100063796 Ga0070668_1000637963 228
170 3300005356 Ga0070674_100005703 Ga0070674_1000057034 228
171 3300005548 Ga0070665_100248968 Ga0070665_1002489682 228
172 3300006195 Ga0075366_10272813 Ga0075366_102728132 228
173 3300017792 Ga0163161_10357357 Ga0163161_103573572 228
174 3300025904 Ga0207647_10064303 Ga0207647_100643031 228
175 3300025907 Ga0207645_10111275 Ga0207645_101112752 228
176 3300025937 Ga0207669_10000252 Ga0207669_1000025219 228
177 3300025972 Ga0207668_10132329 Ga0207668_101323292 228
178 3300026121 Ga0207683_10004500 Ga0207683_100045002 228
179 3300028379 Ga0268266_10352579 Ga0268266_103525792 228
180 3300047323 Ga0495683_0008826 Ga0495683_0008826_54_743 228
181 3300048904 Ga0496101_0620993 Ga0496101_0620993_100_789 228
182 3300048905 Ga0496102_0000828 Ga0496102_0000828_25491_26180 228
183 3300048906 Ga0496103_0000636 Ga0496103_0000636_485_1174 228
184 3300048907 Ga0496104_0016879 Ga0496104_0016879_5319_6008 228
185 3300048908 Ga0496105_0053057 Ga0496105_0053057_2076_2765 228
186 3300048913 Ga0496110_0150078 Ga0496110_0150078_71_760 228
187 3300048914 Ga0496111_0107975 Ga0496111_0107975_490_1179 228
188 3300048916 Ga0496113_0126127 Ga0496113_0126127_1147_1836 228
189 3300048918 Ga0496115_0000624 Ga0496115_0000624_25482_26171 228
190 3300048920 Ga0496117_0001766 Ga0496117_0001766_28503_29192 228
191 3300048921 Ga0496118_0001902 Ga0496118_0001902_582_1271 228
192 3300048922 Ga0496119_0059899 Ga0496119_0059899_1077_1766 228
193 3300048925 Ga0496122_0000218 Ga0496122_0000218_118457_119146 228
194 3300048925 Ga0496122_0055155 Ga0496122_0055155_208_897 228
195 3300048926 Ga0496123_0000089 Ga0496123_0000089_151671_152360 228
196 3300048926 Ga0496123_0230308 Ga0496123_0230308_153_842 228
197 3300048927 Ga0496124_0001562 Ga0496124_0001562_28482_29171 228
198 3300048928 Ga0496125_0001758 Ga0496125_0001758_3824_4513 228
199 3300048929 Ga0496126_0001925 Ga0496126_0001925_28467_29156 228
200 3300053731 Ga0500609_010791 Ga0500609_010791_160_849 228
201 3300001990 JGI24737J22298_10017551 JGI24737J22298_100175511 230
202 3300005331 Ga0070670_100205498 Ga0070670_1002054982 230
203 3300005334 Ga0068869_100112051 Ga0068869_1001120512 230
204 3300005339 Ga0070660_100140574 Ga0070660_1001405742 230
205 3300005347 Ga0070668_100527690 Ga0070668_1005276902 230
206 3300005353 Ga0070669_100195257 Ga0070669_1001952572 230
207 3300005355 Ga0070671_100003907 Ga0070671_1000039072 230
208 3300005366 Ga0070659_100022086 Ga0070659_1000220862 230
209 3300005367 Ga0070667_100202539 Ga0070667_1002025392 230
210 3300005457 Ga0070662_100112453 Ga0070662_1001124532 230
211 3300005459 Ga0068867_100006694 Ga0068867_10000669413 230
212 3300005563 Ga0068855_100345754 Ga0068855_1003457542 230
213 3300005578 Ga0068854_100015063 Ga0068854_1000150635 230
214 3300005618 Ga0068864_100149815 Ga0068864_1001498152 230
215 3300005842 Ga0068858_100247841 Ga0068858_1002478412 230
216 3300009098 Ga0105245_10306325 Ga0105245_103063252 230
217 3300009177 Ga0105248_10051813 Ga0105248_100518131 230
218 3300010375 Ga0105239_10430380 Ga0105239_104303801 230
219 3300013297 Ga0157378_10145716 Ga0157378_101457162 230
220 3300014325 Ga0163163_10033978 Ga0163163_100339782 230
221 3300025901 Ga0207688_10003457 Ga0207688_100034572 230
222 3300025904 Ga0207647_10001132 Ga0207647_1000113229 230
223 3300025913 Ga0207695_10027305 Ga0207695_100273052 230
224 3300025919 Ga0207657_10065260 Ga0207657_100652604 230
225 3300025923 Ga0207681_10200064 Ga0207681_102000642 230
226 3300025932 Ga0207690_10046586 Ga0207690_100465863 230
227 3300025933 Ga0207706_10001910 Ga0207706_1000191028 230
228 3300025941 Ga0207711_10055105 Ga0207711_100551051 230
229 3300025949 Ga0207667_10002702 Ga0207667_100027029 230
230 3300025972 Ga0207668_10764797 Ga0207668_107647971 230
231 3300025981 Ga0207640_10099018 Ga0207640_100990182 230
232 3300025986 Ga0207658_10185015 Ga0207658_101850152 230
233 3300026035 Ga0207703_10012660 Ga0207703_100126602 230
234 3300026089 Ga0207648_10002331 Ga0207648_1000233128 230
235 3300026095 Ga0207676_10131937 Ga0207676_101319372 230
236 3300049571 Ga0501034_0017856 Ga0501034_0017856_4543_5241 230
237 3300049574 Ga0501038_0426554 Ga0501038_0426554_76_774 230
238 3300049581 Ga0501047_0047272 Ga0501047_0047272_1234_1932 230
239 3300049586 Ga0501070_0030337 Ga0501070_0030337_3519_4217 230
240 3300049822 Ga0501035_0019183 Ga0501035_0019183_4379_5077 230
241 3300049823 Ga0501044_0120349 Ga0501044_0120349_1791_2489 230
242 iso_pu_bacteria 2513237094 2513637308 230
243 3300053157 Ga0500624_000019 Ga0500624_000019_106887_107597 231
244 3300005843 Ga0068860_100148141 Ga0068860_1001481412 232
245 3300005844 Ga0068862_100001858 Ga0068862_10000185813 232
246 3300010375 Ga0105239_10190998 Ga0105239_101909982 232
247 3300028380 Ga0268265_10001878 Ga0268265_100018788 232
248 3300048921 Ga0496118_0031960 Ga0496118_0031960_2008_2715 232
249 3300048926 Ga0496123_0211814 Ga0496123_0211814_205_912 232
250 3300048927 Ga0496124_0009604 Ga0496124_0009604_7380_8087 232
251 3300048927 Ga0496124_0151482 Ga0496124_0151482_921_1628 232
252 3300048928 Ga0496125_0030926 Ga0496125_0030926_2244_2951 232
253 3300048929 Ga0496126_0001769 Ga0496126_0001769_23682_24389 232
254 3300049850 Ga0501204_009859 Ga0501204_009859_322_1044 232
255 3300037471 Ga0395905_0265828 Ga0395905_0265828_159_956 234
256 3300009551 Ga0105238_10007431 Ga0105238_100074312 238
257 3300025924 Ga0207694_10004494 Ga0207694_1000449410 238
258 3300049853 Ga0501226_012046 Ga0501226_012046_44_877 238
259 3300001989 JGI24739J22299_10012142 JGI24739J22299_100121424 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

69

246

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7twe-assembly1.cif.gz_A crystal structure of the putative oxidoreductase of duf1479-containing protein family ypo2976 from yersinia pestis bound to 2-oxo-glutaric acid 0.7593 144 230
7dt0-assembly4.cif.gz_F proline hydroxylase h11-n101i mutant 0.7269 23 227
7e09-assembly1.cif.gz_A-2 trans-3/4-proline-hydroxylase h11 with 3-hydroxyl-proline 0.7251 23 227
8h81-assembly1.cif.gz_A trans-3/4-proline-hydroxylase h11 with 4-hydroxyl-proline 0.7205 23 227
7dt0-assembly2.cif.gz_B proline hydroxylase h11-n101i mutant 0.7183 23 236
ID Description Score Start End Superfamily
af_A0A1D8PEJ2_2_436_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.7426 144 226 2.60.120.330
af_A0A1D6Q4J3_1_128_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7209 143 234 2.60.120.620
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7156 145 230 2.60.120.620
af_Q9NAM7_3_287_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7095 23 230 2.60.120.620
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6857 79 226 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7Z0GBJ5-F1-model_v4 deleted 0.9832 18 206
AF-A0A7Z0GBJ5-F1-model_v4 deleted 0.9582 18 206
AF-A0A521SGW9-F1-model_v4 deleted 0.9551 21 185
AF-A0A7W5MYM6-F1-model_v4 Phytanoyl-CoA dioxygenase PhyH 0.9499 18 233
AF-A0A679JGY7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9485 18 232 GO:0005506
GO:0016706

Feature Viewer

pLDDT pTM Quality
77.56 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map