F368962

General Info

Members Datasets Scaffolds Average Seq Length
259 116 518 132

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0197530|Ga0395899_0197530_211_666
Length 151
Sequence MTCAEHFQAEAPTRRSDFMDGDGSSAVDAKIRSLNDWRGAMLAKLRGLIKEADPDVVEEVKWRKASNPLGVPTWSHSGIICTGETYKDKVKLTFARGAALKDAQGLFNSSLEGGVRRAIDFAQGTKIDEKAIKGLIREAIAANLAAKSHRR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 3.86
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0197530 3300037312 Bacteria 1404
2 JGI24736J21556_1009187 3300001904 Bacteria 1635
3 JGI24741J21665_1033703 3300001915 Bacteria 762
4 JGI24740J21852_10029205 3300001979 Bacteria 1813
5 JGI24737J22298_10002117 3300001990 Bacteria 7081
6 JGI24737J22298_10017349 3300001990 Bacteria 2320
7 Ga0070658_10098054 3300005327 Bacteria 2420
8 Ga0070658_10401518 3300005327 Bacteria 1177
9 Ga0070683_100426181 3300005329 Bacteria 1266
10 Ga0070670_100001878 3300005331 Bacteria 17143
11 Ga0070670_100248487 3300005331 Bacteria 1549
12 Ga0070660_100151238 3300005339 Bacteria 1866
13 Ga0070660_101231252 3300005339 Bacteria 635
14 Ga0070661_100132884 3300005344 Bacteria 1870
15 Ga0070661_100133612 3300005344 Bacteria 1865
16 Ga0070661_100178608 3300005344 Bacteria 1614
17 Ga0070661_100745275 3300005344 Bacteria 801
18 Ga0070661_100969424 3300005344 Bacteria 704
19 Ga0070669_100459488 3300005353 Bacteria 1051
20 Ga0070671_100012319 3300005355 Bacteria 6885
21 Ga0070673_100447904 3300005364 Bacteria 1161
22 Ga0070659_100008333 3300005366 Bacteria 7568
23 Ga0070659_100695658 3300005366 Bacteria 879
24 Ga0070659_101657869 3300005366 Bacteria 571
25 Ga0070709_10212999 3300005434 Bacteria 1374
26 Ga0070714_100039767 3300005435 Bacteria 3961
27 Ga0070713_100007084 3300005436 Bacteria 7837
28 Ga0070713_100858265 3300005436 Bacteria 872
29 Ga0070713_101676840 3300005436 Bacteria 617
30 Ga0070663_100010481 3300005455 Bacteria 5776
31 Ga0070663_100138943 3300005455 Bacteria 1853
32 Ga0070663_100532696 3300005455 Bacteria 979
33 Ga0070679_101669345 3300005530 Bacteria 585
34 Ga0070679_101680423 3300005530 Bacteria 583
35 Ga0070684_100201567 3300005535 Bacteria 1812
36 Ga0068853_101086991 3300005539 Bacteria 771
37 Ga0070672_100031218 3300005543 Bacteria 4008
38 Ga0068855_100087326 3300005563 Bacteria 3605
39 Ga0068855_100715437 3300005563 Bacteria 1070
40 Ga0068855_100932688 3300005563 Bacteria 915
41 Ga0068855_101691019 3300005563 Bacteria 645
42 Ga0070664_101089213 3300005564 Unclassified 752
43 Ga0068857_100013119 3300005577 Bacteria 7221
44 Ga0068857_100186100 3300005577 Bacteria 1891
45 Ga0068854_100135559 3300005578 Bacteria 1884
46 Ga0068854_100266946 3300005578 Bacteria 1372
47 Ga0068854_100315727 3300005578 Bacteria 1268
48 Ga0068856_100178547 3300005614 Bacteria 2136
49 Ga0068856_100327553 3300005614 Bacteria 1549
50 Ga0068856_100855567 3300005614 Bacteria 928
51 Ga0068856_101187526 3300005614 Bacteria 779
52 Ga0068856_101814510 3300005614 Bacteria 621
53 Ga0068852_100121850 3300005616 Bacteria 2389
54 Ga0068852_100132961 3300005616 Bacteria 2293
55 Ga0068852_100195878 3300005616 Bacteria 1909
56 Ga0068852_100594402 3300005616 Bacteria 1110
57 Ga0068852_101361345 3300005616 Bacteria 732
58 Ga0068852_102461232 3300005616 Bacteria 541
59 Ga0068863_100012634 3300005841 Bacteria 8146
60 Ga0068862_100218590 3300005844 Bacteria 1724
61 Ga0068862_100842585 3300005844 Bacteria 898
62 Ga0081455_10030258 3300005937 Bacteria 4921
63 Ga0075364_10277975 3300006051 Bacteria 1139
64 Ga0075366_10086214 3300006195 Bacteria 1879
65 Ga0097621_100876202 3300006237 Bacteria 835
66 Ga0068871_100239843 3300006358 Bacteria 1576
67 Ga0105240_10115940 3300009093 Bacteria 3233
68 Ga0105240_10161615 3300009093 Bacteria 2660
69 Ga0105243_11471758 3300009148 Bacteria 704
70 Ga0105237_10268662 3300009545 Bacteria 1708
71 Ga0105237_10589144 3300009545 Bacteria 1119
72 Ga0105238_10308630 3300009551 Bacteria 1567
73 Ga0105249_10470672 3300009553 Bacteria 1298
74 Ga0105249_10549365 3300009553 Bacteria 1205
75 Ga0105239_10327059 3300010375 Bacteria 1729
76 Ga0157373_10340506 3300013100 Bacteria 1069
77 Ga0157373_10784533 3300013100 Bacteria 702
78 Ga0157373_11133501 3300013100 Bacteria 588
79 Ga0157371_10668150 3300013102 Bacteria 776
80 Ga0157371_10692489 3300013102 Bacteria 762
81 Ga0157371_11348840 3300013102 Bacteria 553
82 Ga0157371_11399268 3300013102 Bacteria 543
83 Ga0157370_10069204 3300013104 Bacteria 3334
84 Ga0157370_10623240 3300013104 Bacteria 987
85 Ga0157370_10840846 3300013104 Bacteria 834
86 Ga0157370_11278905 3300013104 Bacteria 661
87 Ga0157369_10011889 3300013105 Bacteria 9888
88 Ga0157369_10117944 3300013105 Bacteria 2817
89 Ga0157369_10287637 3300013105 Bacteria 1711
90 Ga0157374_10083319 3300013296 Bacteria 3038
91 Ga0157372_10205789 3300013307 Bacteria 2280
92 Ga0157372_10731921 3300013307 Bacteria 1150
93 Ga0157372_10753677 3300013307 Bacteria 1132
94 Ga0157375_10982313 3300013308 Unclassified 985
95 Ga0163163_11259061 3300014325 Bacteria 802
96 Ga0207647_10010223 3300025904 Bacteria 6629
97 Ga0207647_10046578 3300025904 Bacteria 2702
98 Ga0207705_10000722 3300025909 Bacteria 27211
99 Ga0207705_10002112 3300025909 Bacteria 15440
100 Ga0207705_10289068 3300025909 Bacteria 1256
101 Ga0207654_10391082 3300025911 Bacteria 965
102 Ga0207695_10002670 3300025913 Bacteria 26052
103 Ga0207695_10007729 3300025913 Bacteria 13618
104 Ga0207695_10249539 3300025913 Bacteria 1674
105 Ga0207695_10573715 3300025913 Bacteria 1010
106 Ga0207657_10049994 3300025919 Bacteria 3640
107 Ga0207657_10539722 3300025919 Bacteria 912
108 Ga0207649_10000298 3300025920 Bacteria 38460
109 Ga0207649_10280496 3300025920 Bacteria 1211
110 Ga0207649_10502039 3300025920 Bacteria 923
111 Ga0207681_10517915 3300025923 Bacteria 978
112 Ga0207650_10001451 3300025925 Bacteria 17072
113 Ga0207650_10527742 3300025925 Bacteria 988
114 Ga0207650_10939824 3300025925 Unclassified 735
115 Ga0207700_10021105 3300025928 Bacteria 4439
116 Ga0207700_10836616 3300025928 Bacteria 823
117 Ga0207700_11486111 3300025928 Bacteria 601
118 Ga0207664_10013249 3300025929 Bacteria 5910
119 Ga0207664_10077612 3300025929 Bacteria 2691
120 Ga0207690_10322385 3300025932 Bacteria 1215
121 Ga0207661_10211210 3300025944 Bacteria 1711
122 Ga0207661_10466125 3300025944 Bacteria 1152
123 Ga0207679_10094824 3300025945 Bacteria 2318
124 Ga0207667_10062528 3300025949 Bacteria 3892
125 Ga0207667_10188878 3300025949 Bacteria 2114
126 Ga0207667_10326849 3300025949 Bacteria 1566
127 Ga0207667_10525733 3300025949 Bacteria 1198
128 Ga0207667_10625221 3300025949 Bacteria 1084
129 Ga0207651_10034826 3300025960 Bacteria 3266
130 Ga0207712_10467541 3300025961 Bacteria 1072
131 Ga0207712_10562034 3300025961 Bacteria 982
132 Ga0207668_10178029 3300025972 Bacteria 1675
133 Ga0207640_10006745 3300025981 Bacteria 6313
134 Ga0207640_10024752 3300025981 Bacteria 3626
135 Ga0207640_10132449 3300025981 Bacteria 1804
136 Ga0207639_11179684 3300026041 Bacteria 718
137 Ga0207678_10055859 3300026067 Bacteria 3400
138 Ga0207678_10168162 3300026067 Bacteria 1872
139 Ga0207702_10004503 3300026078 Bacteria 12363
140 Ga0207702_10088352 3300026078 Bacteria 2707
141 Ga0207702_10147648 3300026078 Bacteria 2135
142 Ga0207702_10293784 3300026078 Bacteria 1540
143 Ga0207676_10220510 3300026095 Bacteria 1689
144 Ga0207676_10644970 3300026095 Bacteria 1021
145 Ga0207674_10000065 3300026116 Bacteria 109485
146 Ga0207674_10035966 3300026116 Bacteria 5165
147 Ga0207698_10148579 3300026142 Bacteria 2030
148 Ga0207698_10609059 3300026142 Bacteria 1077
149 Ga0268265_11307391 3300028380 Bacteria 725
150 Ga0307406_10887127 3300031901 Bacteria 758
151 Ga0307412_10333097 3300031911 Bacteria 1212
152 Ga0307416_100414438 3300032002 Bacteria 1389
153 Ga0307414_11858203 3300032004 Bacteria 562
154 Ga0395899_0000317 3300037312 Bacteria 61581
155 Ga0395899_0100698 3300037312 Bacteria 2086
156 Ga0395899_0135349 3300037312 Bacteria 1756
157 Ga0395899_0169869 3300037312 Bacteria 1536
158 Ga0395900_0000238 3300037418 Bacteria 86469
159 Ga0395900_0041494 3300037418 Bacteria 4743
160 Ga0395900_0083518 3300037418 Bacteria 3281
161 Ga0395900_0121010 3300037418 Bacteria 2685
162 Ga0395900_0225404 3300037418 Bacteria 1887
163 Ga0395900_0243617 3300037418 Bacteria 1802
164 Ga0395900_0257600 3300037418 Bacteria 1743
165 Ga0395900_0356934 3300037418 Bacteria 1434
166 Ga0395900_0445880 3300037418 Bacteria 1251
167 Ga0395900_0521074 3300037418 Bacteria 1137
168 Ga0395900_0824638 3300037418 Bacteria 854
169 Ga0395900_0887428 3300037418 Bacteria 816
170 Ga0395900_1001127 3300037418 Bacteria 756
171 Ga0395900_1077492 3300037418 Bacteria 721
172 Ga0395900_1513402 3300037418 Bacteria 583
173 Ga0395898_0000245 3300037466 Bacteria 136315
174 Ga0395898_0045050 3300037466 Bacteria 4337
175 Ga0395898_0045213 3300037466 Bacteria 4329
176 Ga0395898_0078629 3300037466 Bacteria 3182
177 Ga0395898_0304762 3300037466 Bacteria 1519
178 Ga0395898_1144780 3300037466 Bacteria 710
179 Ga0395905_0000006 3300037471 Bacteria 549428
180 Ga0395905_0002916 3300037471 Bacteria 18646
181 Ga0395905_0027909 3300037471 Bacteria 5321
182 Ga0395905_0034682 3300037471 Bacteria 4739
183 Ga0395905_0130266 3300037471 Bacteria 2366
184 Ga0395905_0194884 3300037471 Bacteria 1900
185 Ga0395905_0315667 3300037471 Bacteria 1452
186 Ga0395905_0348612 3300037471 Bacteria 1372
187 Ga0395905_0495345 3300037471 Bacteria 1122
188 Ga0395905_0548619 3300037471 Bacteria 1057
189 Ga0395905_0664760 3300037471 Bacteria 944
190 Ga0395905_0783878 3300037471 Bacteria 856
191 Ga0395905_0785348 3300037471 Bacteria 855
192 Ga0395905_1209362 3300037471 Bacteria 659
193 Ga0395901_0000156 3300038443 Bacteria 88513
194 Ga0395901_0098079 3300038443 Bacteria 3072
195 Ga0395901_0154617 3300038443 Bacteria 2409
196 Ga0395901_0193495 3300038443 Bacteria 2133
197 Ga0395901_0258656 3300038443 Bacteria 1812
198 Ga0395901_0468591 3300038443 Bacteria 1286
199 Ga0395901_0487181 3300038443 Bacteria 1257
200 Ga0395901_0540851 3300038443 Bacteria 1181
201 Ga0395901_0614717 3300038443 Bacteria 1094
202 Ga0395901_0730869 3300038443 Bacteria 984
203 Ga0395901_0914355 3300038443 Bacteria 858
204 Ga0395901_1009866 3300038443 Bacteria 807
205 Ga0439455_0105825 3300042012 Bacteria 780
206 Ga0466969_0005304 3300044656 Bacteria 6860
207 Ga0466969_0324783 3300044656 Bacteria 696
208 Ga0466966_0000732 3300044684 Bacteria 20858
209 Ga0466966_0003316 3300044684 Bacteria 10609
210 Ga0466966_0147177 3300044684 Bacteria 1438
211 Ga0466961_0003019 3300044693 Bacteria 10439
212 Ga0466961_0033166 3300044693 Bacteria 3318
213 Ga0466961_0080610 3300044693 Bacteria 2060
214 Ga0466963_0069662 3300044694 Bacteria 2364
215 Ga0466963_0512991 3300044694 Bacteria 846
216 Ga0466971_0003492 3300044719 Bacteria 6712
217 Ga0466970_0003584 3300044765 Bacteria 7569
218 Ga0466970_0064388 3300044765 Bacteria 1966
219 Ga0466970_0431118 3300044765 Bacteria 754
220 Ga0466970_0472398 3300044765 Unclassified 720
221 Ga0466957_0000953 3300044842 Bacteria 14840
222 Ga0466959_0009763 3300045049 Bacteria 6836
223 Ga0466959_0039343 3300045049 Bacteria 3494
224 Ga0466959_0251953 3300045049 Unclassified 1217
225 Ga0466958_0008167 3300045836 Bacteria 5793
226 Ga0466958_0022533 3300045836 Bacteria 3691
227 Ga0466958_0042248 3300045836 Bacteria 2745
228 Ga0466967_0389619 3300045976 Bacteria 1354
229 Ga0495663_0000475 3300046525 Bacteria 14684
230 Ga0495598_0013374 3300046537 Bacteria 2033
231 Ga0495598_0118359 3300046537 Bacteria 895
232 Ga0495621_0000359 3300046539 Bacteria 11112
233 Ga0495621_0071797 3300046539 Bacteria 1276
234 Ga0495633_0063555 3300046558 Bacteria 1727
235 Ga0495633_0063929 3300046558 Bacteria 1721
236 Ga0495659_0023815 3300046664 Bacteria 2083
237 Ga0495670_0052927 3300046691 Bacteria 2033
238 Ga0495670_0318888 3300046691 Bacteria 834
239 Ga0495687_088615 3300047443 Bacteria 1191
240 Ga0495677_0013088 3300047445 Bacteria 3019
241 Ga0496107_0468374 3300048910 Bacteria 935
242 Ga0496108_0003426 3300048911 Bacteria 12718
243 Ga0496109_0010865 3300048912 Bacteria 7793
244 Ga0496109_0430134 3300048912 Bacteria 1247
245 Ga0496110_0817807 3300048913 Bacteria 836
246 Ga0496112_0004521 3300048915 Bacteria 11813
247 Ga0496112_0006533 3300048915 Bacteria 10253
248 Ga0496113_0003356 3300048916 Bacteria 9561
249 Ga0496113_0021916 3300048916 Bacteria 4512
250 Ga0496115_0001169 3300048918 Bacteria 18809
251 Ga0496126_0107853 3300048929 Bacteria 2429
252 nmdc:mga06r32_57434_c1 3300050510 Bacteria 3738
253 nmdc:mga08y16_792346_c1 3300050511 Bacteria 941
254 nmdc:mga0rr50_815650_c1 3300050513 Bacteria 796
255 nmdc:mga0a205_904770_c1 3300050515 Bacteria 729
256 Ga0500645_000349 3300053730 Bacteria 32789
257 Ga0466962_0003081 3300061719 Bacteria 7934
258 Ga0466962_0013901 3300061719 Bacteria 3876
259 8054006676 8054002106 Bacteria 7987183
260 Ga0395899_0197530
261 JGI24736J21556_1009187
262 JGI24741J21665_1033703
263 JGI24740J21852_10029205
264 JGI24737J22298_10002117
265 JGI24737J22298_10017349
266 Ga0070658_10098054
267 Ga0070658_10401518
268 Ga0070683_100426181
269 Ga0070670_100001878
270 Ga0070670_100248487
271 Ga0070660_100151238
272 Ga0070660_101231252
273 Ga0070661_100132884
274 Ga0070661_100133612
275 Ga0070661_100178608
276 Ga0070661_100745275
277 Ga0070661_100969424
278 Ga0070669_100459488
279 Ga0070671_100012319
280 Ga0070673_100447904
281 Ga0070659_100008333
282 Ga0070659_100695658
283 Ga0070659_101657869
284 Ga0070709_10212999
285 Ga0070714_100039767
286 Ga0070713_100007084
287 Ga0070713_100858265
288 Ga0070713_101676840
289 Ga0070663_100010481
290 Ga0070663_100138943
291 Ga0070663_100532696
292 Ga0070679_101669345
293 Ga0070679_101680423
294 Ga0070684_100201567
295 Ga0068853_101086991
296 Ga0070672_100031218
297 Ga0068855_100087326
298 Ga0068855_100715437
299 Ga0068855_100932688
300 Ga0068855_101691019
301 Ga0070664_101089213
302 Ga0068857_100013119
303 Ga0068857_100186100
304 Ga0068854_100135559
305 Ga0068854_100266946
306 Ga0068854_100315727
307 Ga0068856_100178547
308 Ga0068856_100327553
309 Ga0068856_100855567
310 Ga0068856_101187526
311 Ga0068856_101814510
312 Ga0068852_100121850
313 Ga0068852_100132961
314 Ga0068852_100195878
315 Ga0068852_100594402
316 Ga0068852_101361345
317 Ga0068852_102461232
318 Ga0068863_100012634
319 Ga0068862_100218590
320 Ga0068862_100842585
321 Ga0081455_10030258
322 Ga0075364_10277975
323 Ga0075366_10086214
324 Ga0097621_100876202
325 Ga0068871_100239843
326 Ga0105240_10115940
327 Ga0105240_10161615
328 Ga0105243_11471758
329 Ga0105237_10268662
330 Ga0105237_10589144
331 Ga0105238_10308630
332 Ga0105249_10470672
333 Ga0105249_10549365
334 Ga0105239_10327059
335 Ga0157373_10340506
336 Ga0157373_10784533
337 Ga0157373_11133501
338 Ga0157371_10668150
339 Ga0157371_10692489
340 Ga0157371_11348840
341 Ga0157371_11399268
342 Ga0157370_10069204
343 Ga0157370_10623240
344 Ga0157370_10840846
345 Ga0157370_11278905
346 Ga0157369_10011889
347 Ga0157369_10117944
348 Ga0157369_10287637
349 Ga0157374_10083319
350 Ga0157372_10205789
351 Ga0157372_10731921
352 Ga0157372_10753677
353 Ga0157375_10982313
354 Ga0163163_11259061
355 Ga0207647_10010223
356 Ga0207647_10046578
357 Ga0207705_10000722
358 Ga0207705_10002112
359 Ga0207705_10289068
360 Ga0207654_10391082
361 Ga0207695_10002670
362 Ga0207695_10007729
363 Ga0207695_10249539
364 Ga0207695_10573715
365 Ga0207657_10049994
366 Ga0207657_10539722
367 Ga0207649_10000298
368 Ga0207649_10280496
369 Ga0207649_10502039
370 Ga0207681_10517915
371 Ga0207650_10001451
372 Ga0207650_10527742
373 Ga0207650_10939824
374 Ga0207700_10021105
375 Ga0207700_10836616
376 Ga0207700_11486111
377 Ga0207664_10013249
378 Ga0207664_10077612
379 Ga0207690_10322385
380 Ga0207661_10211210
381 Ga0207661_10466125
382 Ga0207679_10094824
383 Ga0207667_10062528
384 Ga0207667_10188878
385 Ga0207667_10326849
386 Ga0207667_10525733
387 Ga0207667_10625221
388 Ga0207651_10034826
389 Ga0207712_10467541
390 Ga0207712_10562034
391 Ga0207668_10178029
392 Ga0207640_10006745
393 Ga0207640_10024752
394 Ga0207640_10132449
395 Ga0207639_11179684
396 Ga0207678_10055859
397 Ga0207678_10168162
398 Ga0207702_10004503
399 Ga0207702_10088352
400 Ga0207702_10147648
401 Ga0207702_10293784
402 Ga0207676_10220510
403 Ga0207676_10644970
404 Ga0207674_10000065
405 Ga0207674_10035966
406 Ga0207698_10148579
407 Ga0207698_10609059
408 Ga0268265_11307391
409 Ga0307406_10887127
410 Ga0307412_10333097
411 Ga0307416_100414438
412 Ga0307414_11858203
413 Ga0395899_0000317
414 Ga0395899_0100698
415 Ga0395899_0135349
416 Ga0395899_0169869
417 Ga0395900_0000238
418 Ga0395900_0041494
419 Ga0395900_0083518
420 Ga0395900_0121010
421 Ga0395900_0225404
422 Ga0395900_0243617
423 Ga0395900_0257600
424 Ga0395900_0356934
425 Ga0395900_0445880
426 Ga0395900_0521074
427 Ga0395900_0824638
428 Ga0395900_0887428
429 Ga0395900_1001127
430 Ga0395900_1077492
431 Ga0395900_1513402
432 Ga0395898_0000245
433 Ga0395898_0045050
434 Ga0395898_0045213
435 Ga0395898_0078629
436 Ga0395898_0304762
437 Ga0395898_1144780
438 Ga0395905_0000006
439 Ga0395905_0002916
440 Ga0395905_0027909
441 Ga0395905_0034682
442 Ga0395905_0130266
443 Ga0395905_0194884
444 Ga0395905_0315667
445 Ga0395905_0348612
446 Ga0395905_0495345
447 Ga0395905_0548619
448 Ga0395905_0664760
449 Ga0395905_0783878
450 Ga0395905_0785348
451 Ga0395905_1209362
452 Ga0395901_0000156
453 Ga0395901_0098079
454 Ga0395901_0154617
455 Ga0395901_0193495
456 Ga0395901_0258656
457 Ga0395901_0468591
458 Ga0395901_0487181
459 Ga0395901_0540851
460 Ga0395901_0614717
461 Ga0395901_0730869
462 Ga0395901_0914355
463 Ga0395901_1009866
464 Ga0439455_0105825
465 Ga0466969_0005304
466 Ga0466969_0324783
467 Ga0466966_0000732
468 Ga0466966_0003316
469 Ga0466966_0147177
470 Ga0466961_0003019
471 Ga0466961_0033166
472 Ga0466961_0080610
473 Ga0466963_0069662
474 Ga0466963_0512991
475 Ga0466971_0003492
476 Ga0466970_0003584
477 Ga0466970_0064388
478 Ga0466970_0431118
479 Ga0466970_0472398
480 Ga0466957_0000953
481 Ga0466959_0009763
482 Ga0466959_0039343
483 Ga0466959_0251953
484 Ga0466958_0008167
485 Ga0466958_0022533
486 Ga0466958_0042248
487 Ga0466967_0389619
488 Ga0495663_0000475
489 Ga0495598_0013374
490 Ga0495598_0118359
491 Ga0495621_0000359
492 Ga0495621_0071797
493 Ga0495633_0063555
494 Ga0495633_0063929
495 Ga0495659_0023815
496 Ga0495670_0052927
497 Ga0495670_0318888
498 Ga0495687_088615
499 Ga0495677_0013088
500 Ga0496107_0468374
501 Ga0496108_0003426
502 Ga0496109_0010865
503 Ga0496109_0430134
504 Ga0496110_0817807
505 Ga0496112_0004521
506 Ga0496112_0006533
507 Ga0496113_0003356
508 Ga0496113_0021916
509 Ga0496115_0001169
510 Ga0496126_0107853
511 nmdc:mga06r32_57434_c1
512 nmdc:mga08y16_792346_c1
513 nmdc:mga0rr50_815650_c1
514 nmdc:mga0a205_904770_c1
515 Ga0500645_000349
516 Ga0466962_0003081
517 Ga0466962_0013901
518 8054006676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

38

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.761 5 117
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6894 1 128
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6845 1 128
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6645 5 117
3nk4-assembly1.cif.gz_A crystal structure of full-length sperm receptor zp3 at 2.0 a resolution 0.611 60 105
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7875 5 116 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7569 5 116 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7298 5 128 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.719 5 128 3.90.1150.200
af_B8A580_83_200_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.66 60 105 2.60.40.3210
ID Description Score Start End GO Terms
AF-A0A7H9VG25-F1-model_v4 DUF1801 domain-containing protein 0.9906 1 127
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.9896 3 127
AF-A0A427CGT7-F1-model_v4 DUF1801 domain-containing protein 0.9888 5 124
AF-A0A536QTR2-F1-model_v4 DUF1801 domain-containing protein 0.9881 6 127
AF-A0A433B8C7-F1-model_v4 DUF1801 domain-containing protein 0.9872 1 127

Map