F368933

General Info

Members Datasets Scaffolds Average Seq Length
259 105 518 135

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10561831|Ga0307414_105618312
Length 155
Sequence LSQASRAVGVVVGAGTVFPTKRATTRTASCRCGQLRATVTGEPVRVSVCHCLNCKKRSGSAFAVQARWPAGQVAIEGRSKSFEKVADSGNRATFYFCPDCGSDVHYDNNGKFDGQIAIPLGCFDDPFAFTPAFSVWEERKHRWVEILGDGVEHFD

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
104 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
105 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10561831 3300032004 Bacteria 1018
2 JGI24741J21665_1007613 3300001915 Bacteria 2092
3 JGI24740J21852_10018718 3300001979 Bacteria 2450
4 JGI24739J22299_10017823 3300001989 Bacteria 2558
5 JGI24735J21928_10011303 3300002067 Bacteria 2834
6 JGI24735J21928_10036004 3300002067 Bacteria 1452
7 Ga0065715_10350977 3300005293 Unclassified 951
8 Ga0065715_10908527 3300005293 Unclassified 572
9 Ga0070658_10005221 3300005327 Bacteria 10564
10 Ga0070658_11756872 3300005327 Bacteria 537
11 Ga0070683_101266822 3300005329 Bacteria 709
12 Ga0070690_100383498 3300005330 Bacteria 1028
13 Ga0070680_100008547 3300005336 Bacteria 7843
14 Ga0070680_100187522 3300005336 Bacteria 1742
15 Ga0070680_100581942 3300005336 Bacteria 960
16 Ga0070682_100773655 3300005337 Unclassified 777
17 Ga0070660_100008399 3300005339 Bacteria 7217
18 Ga0070660_100147080 3300005339 Bacteria 1893
19 Ga0070660_100520376 3300005339 Bacteria 991
20 Ga0070660_100997017 3300005339 Bacteria 708
21 Ga0070661_100014521 3300005344 Bacteria 5549
22 Ga0070661_100094467 3300005344 Bacteria 2216
23 Ga0070661_100721909 3300005344 Bacteria 813
24 Ga0070661_101242209 3300005344 Bacteria 624
25 Ga0070668_100297447 3300005347 Bacteria 1353
26 Ga0070669_100161059 3300005353 Bacteria 1744
27 Ga0070669_100245584 3300005353 Bacteria 1424
28 Ga0070675_100038132 3300005354 Bacteria 3915
29 Ga0070673_100073629 3300005364 Bacteria 2750
30 Ga0070659_100021286 3300005366 Bacteria 4935
31 Ga0070659_100035347 3300005366 Bacteria 3891
32 Ga0070659_100035378 3300005366 Bacteria 3890
33 Ga0070659_100167267 3300005366 Bacteria 1800
34 Ga0070663_100071712 3300005455 Bacteria 2521
35 Ga0070662_100096626 3300005457 Bacteria 2228
36 Ga0070662_100098400 3300005457 Bacteria 2209
37 Ga0070662_100562200 3300005457 Bacteria 957
38 Ga0070681_10071255 3300005458 Bacteria 3440
39 Ga0070681_11109971 3300005458 Bacteria 712
40 Ga0070679_100090850 3300005530 Bacteria 3041
41 Ga0070679_100215320 3300005530 Bacteria 1883
42 Ga0070679_100228041 3300005530 Bacteria 1822
43 Ga0070679_100722821 3300005530 Bacteria 939
44 Ga0070684_101893789 3300005535 Bacteria 563
45 Ga0068853_100531573 3300005539 Bacteria 1112
46 Ga0068853_100976056 3300005539 Bacteria 815
47 Ga0068853_101149783 3300005539 Bacteria 749
48 Ga0070693_100739270 3300005547 Bacteria 724
49 Ga0070693_100998436 3300005547 Bacteria 633
50 Ga0068855_100571789 3300005563 Bacteria 1221
51 Ga0068855_102052353 3300005563 Bacteria 577
52 Ga0070664_100014790 3300005564 Bacteria 6372
53 Ga0070664_100170357 3300005564 Bacteria 1931
54 Ga0068857_100124203 3300005577 Bacteria 2325
55 Ga0068857_100238376 3300005577 Bacteria 1665
56 Ga0068857_100319980 3300005577 Bacteria 1432
57 Ga0068854_100017430 3300005578 Bacteria 4806
58 Ga0068854_100035564 3300005578 Bacteria 3487
59 Ga0068854_101279631 3300005578 Bacteria 659
60 Ga0068856_100579351 3300005614 Bacteria 1143
61 Ga0068852_100131729 3300005616 Bacteria 2303
62 Ga0068852_100380946 3300005616 Bacteria 1384
63 Ga0068852_100850453 3300005616 Bacteria 928
64 Ga0068851_10567227 3300005834 Bacteria 688
65 Ga0068862_100308153 3300005844 Bacteria 1459
66 Ga0097621_100280556 3300006237 Bacteria 1466
67 Ga0068871_100065305 3300006358 Bacteria 2980
68 Ga0105240_10292525 3300009093 Bacteria 1866
69 Ga0114129_10198027 3300009147 Bacteria 2723
70 Ga0105241_10767264 3300009174 Bacteria 885
71 Ga0105248_10073240 3300009177 Bacteria 3850
72 Ga0105238_10083403 3300009551 Bacteria 3185
73 Ga0105238_10817079 3300009551 Bacteria 948
74 Ga0157373_10410465 3300013100 Bacteria 971
75 Ga0157373_10678526 3300013100 Bacteria 754
76 Ga0157371_10209795 3300013102 Bacteria 1397
77 Ga0157371_10379211 3300013102 Bacteria 1032
78 Ga0157371_11024700 3300013102 Unclassified 630
79 Ga0157370_10282673 3300013104 Bacteria 1533
80 Ga0157370_10524406 3300013104 Bacteria 1087
81 Ga0157369_10287357 3300013105 Bacteria 1712
82 Ga0157369_10381912 3300013105 Bacteria 1462
83 Ga0157369_10392776 3300013105 Bacteria 1439
84 Ga0157369_10401743 3300013105 Bacteria 1421
85 Ga0157369_10541302 3300013105 Bacteria 1204
86 Ga0157372_10015905 3300013307 Bacteria 8072
87 Ga0157372_10740958 3300013307 Bacteria 1143
88 Ga0157375_13193753 3300013308 Bacteria 547
89 Ga0157380_10011728 3300014326 Bacteria 6337
90 Ga0206354_10599540 3300020081 Bacteria 1955
91 Ga0206353_11835990 3300020082 Bacteria 2321
92 Ga0207656_10527572 3300025321 Bacteria 600
93 Ga0207705_10063759 3300025909 Bacteria 2662
94 Ga0207705_10115662 3300025909 Bacteria 1985
95 Ga0207705_10144835 3300025909 Bacteria 1777
96 Ga0207705_10785581 3300025909 Bacteria 739
97 Ga0207705_11270558 3300025909 Bacteria 563
98 Ga0207707_10020792 3300025912 Bacteria 5732
99 Ga0207707_10938968 3300025912 Unclassified 713
100 Ga0207695_10065361 3300025913 Bacteria 3740
101 Ga0207660_10003718 3300025917 Bacteria 9941
102 Ga0207660_10014836 3300025917 Bacteria 5134
103 Ga0207657_10014359 3300025919 Bacteria 7734
104 Ga0207657_10570740 3300025919 Bacteria 884
105 Ga0207657_10722465 3300025919 Bacteria 773
106 Ga0207657_10877206 3300025919 Unclassified 692
107 Ga0207649_10008523 3300025920 Bacteria 5592
108 Ga0207649_10026294 3300025920 Bacteria 3403
109 Ga0207649_10455391 3300025920 Bacteria 966
110 Ga0207649_10556292 3300025920 Bacteria 878
111 Ga0207652_10046673 3300025921 Bacteria 3697
112 Ga0207652_10181098 3300025921 Bacteria 1894
113 Ga0207652_10191228 3300025921 Bacteria 1841
114 Ga0207652_10560259 3300025921 Bacteria 1026
115 Ga0207681_10449263 3300025923 Unclassified 1048
116 Ga0207681_10512321 3300025923 Bacteria 984
117 Ga0207694_10058909 3300025924 Bacteria 2987
118 Ga0207694_10837838 3300025924 Bacteria 777
119 Ga0207690_10014039 3300025932 Bacteria 4829
120 Ga0207690_10739155 3300025932 Bacteria 811
121 Ga0207706_10006593 3300025933 Bacteria 10752
122 Ga0207661_10529651 3300025944 Bacteria 1078
123 Ga0207679_10195846 3300025945 Bacteria 1684
124 Ga0207679_10704738 3300025945 Bacteria 916
125 Ga0207679_11099728 3300025945 Bacteria 729
126 Ga0207667_10018263 3300025949 Bacteria 7871
127 Ga0207658_10062993 3300025986 Bacteria 2777
128 Ga0207639_10073146 3300026041 Bacteria 2686
129 Ga0207639_10095701 3300026041 Bacteria 2387
130 Ga0207639_10251483 3300026041 Bacteria 1541
131 Ga0207678_10001557 3300026067 Bacteria 21055
132 Ga0207678_10135496 3300026067 Bacteria 2101
133 Ga0207702_10167727 3300026078 Bacteria 2010
134 Ga0207674_10931142 3300026116 Bacteria 837
135 Ga0207698_10027238 3300026142 Bacteria 4055
136 Ga0207698_10271359 3300026142 Bacteria 1564
137 Ga0207698_11852799 3300026142 Bacteria 618
138 Ga0209971_1028580 3300027682 Bacteria 1334
139 Ga0268265_12147029 3300028380 Bacteria 565
140 Ga0307408_100110895 3300031548 Bacteria 2107
141 Ga0307408_100223275 3300031548 Bacteria 1538
142 Ga0307408_100279763 3300031548 Bacteria 1389
143 Ga0307408_100565481 3300031548 Bacteria 1005
144 Ga0307405_10060006 3300031731 Bacteria 2399
145 Ga0307405_10339674 3300031731 Bacteria 1154
146 Ga0307405_10347161 3300031731 Bacteria 1143
147 Ga0307413_10005619 3300031824 Bacteria 5620
148 Ga0307413_10150088 3300031824 Bacteria 1623
149 Ga0307413_10168721 3300031824 Bacteria 1546
150 Ga0307413_12169802 3300031824 Unclassified 503
151 Ga0307410_10071558 3300031852 Bacteria 2405
152 Ga0307410_10073347 3300031852 Bacteria 2380
153 Ga0307410_10076311 3300031852 Bacteria 2339
154 Ga0307410_10414319 3300031852 Bacteria 1091
155 Ga0307410_10636454 3300031852 Bacteria 893
156 Ga0307410_10767851 3300031852 Bacteria 817
157 Ga0307410_10984688 3300031852 Bacteria 726
158 Ga0307410_11409374 3300031852 Unclassified 612
159 Ga0307406_10081077 3300031901 Bacteria 2156
160 Ga0307406_10090847 3300031901 Bacteria 2056
161 Ga0307406_10177204 3300031901 Bacteria 1549
162 Ga0307406_10476974 3300031901 Bacteria 1006
163 Ga0307406_11525073 3300031901 Bacteria 589
164 Ga0307407_10021398 3300031903 Bacteria 3334
165 Ga0307407_10092546 3300031903 Bacteria 1857
166 Ga0307407_10469581 3300031903 Bacteria 917
167 Ga0307407_10688016 3300031903 Bacteria 769
168 Ga0307407_11441369 3300031903 Bacteria 543
169 Ga0307412_10057849 3300031911 Bacteria 2590
170 Ga0307412_10085910 3300031911 Bacteria 2188
171 Ga0307412_10095580 3300031911 Bacteria 2089
172 Ga0307412_10154268 3300031911 Bacteria 1698
173 Ga0307412_10204981 3300031911 Bacteria 1500
174 Ga0307412_10467129 3300031911 Bacteria 1043
175 Ga0307409_100038490 3300031995 Bacteria 3538
176 Ga0307409_100068246 3300031995 Bacteria 2811
177 Ga0307409_100086174 3300031995 Bacteria 2556
178 Ga0307409_100139603 3300031995 Bacteria 2086
179 Ga0307409_100166635 3300031995 Bacteria 1934
180 Ga0307409_100503460 3300031995 Bacteria 1180
181 Ga0307416_100002746 3300032002 Bacteria 10214
182 Ga0307416_100027648 3300032002 Bacteria 4204
183 Ga0307416_100051529 3300032002 Bacteria 3288
184 Ga0307416_100066350 3300032002 Bacteria 2971
185 Ga0307416_100117189 3300032002 Bacteria 2363
186 Ga0307416_100138008 3300032002 Bacteria 2210
187 Ga0307416_100156740 3300032002 Bacteria 2097
188 Ga0307416_100455364 3300032002 Bacteria 1333
189 Ga0307416_100474595 3300032002 Bacteria 1309
190 Ga0307416_102194262 3300032002 Bacteria 653
191 Ga0307414_10106992 3300032004 Bacteria 2118
192 Ga0307414_10122322 3300032004 Bacteria 2003
193 Ga0307414_10174435 3300032004 Bacteria 1722
194 Ga0307414_10207862 3300032004 Bacteria 1597
195 Ga0307414_10236915 3300032004 Bacteria 1508
196 Ga0307414_10242769 3300032004 Bacteria 1492
197 Ga0307414_10407238 3300032004 Bacteria 1183
198 Ga0307411_10087101 3300032005 Bacteria 2168
199 Ga0307411_10143777 3300032005 Bacteria 1762
200 Ga0307411_10213643 3300032005 Bacteria 1491
201 Ga0307411_10600226 3300032005 Bacteria 946
202 Ga0307411_10705534 3300032005 Bacteria 879
203 Ga0307411_11228075 3300032005 Bacteria 680
204 Ga0307411_11868668 3300032005 Bacteria 558
205 Ga0307415_100001878 3300032126 Bacteria 10311
206 Ga0307415_100027817 3300032126 Bacteria 3588
207 Ga0307415_100043457 3300032126 Bacteria 2998
208 Ga0307415_100052706 3300032126 Bacteria 2768
209 Ga0307415_100140414 3300032126 Bacteria 1844
210 Ga0307415_100186923 3300032126 Bacteria 1631
211 Ga0307415_100203083 3300032126 Bacteria 1574
212 Ga0307415_100230745 3300032126 Bacteria 1490
213 Ga0307415_100257596 3300032126 Bacteria 1421
214 Ga0395899_0000244 3300037312 Bacteria 72329
215 Ga0395899_0028049 3300037312 Bacteria 4240
216 Ga0395899_0251150 3300037312 Unclassified 1213
217 Ga0395900_0000771 3300037418 Bacteria 42659
218 Ga0395900_0063934 3300037418 Bacteria 3782
219 Ga0395900_0426769 3300037418 Bacteria 1285
220 Ga0395900_0463213 3300037418 Bacteria 1222
221 Ga0395900_0958942 3300037418 Bacteria 776
222 Ga0395900_1096500 3300037418 Bacteria 713
223 Ga0395900_1503687 3300037418 Bacteria 585
224 Ga0395898_0032289 3300037466 Bacteria 5225
225 Ga0395898_0261370 3300037466 Bacteria 1651
226 Ga0395898_0531674 3300037466 Bacteria 1117
227 Ga0395898_0535811 3300037466 Bacteria 1112
228 Ga0395898_0571032 3300037466 Bacteria 1073
229 Ga0395905_0125871 3300037471 Bacteria 2409
230 Ga0395905_0602458 3300037471 Bacteria 1000
231 Ga0395905_0904801 3300037471 Unclassified 785
232 Ga0395901_0000206 3300038443 Bacteria 73997
233 Ga0395901_0077711 3300038443 Bacteria 3464
234 Ga0395901_0295975 3300038443 Bacteria 1678
235 Ga0395901_0327522 3300038443 Bacteria 1584
236 Ga0395901_0633964 3300038443 Bacteria 1074
237 Ga0395901_0964675 3300038443 Bacteria 830
238 Ga0395901_1996936 3300038443 Unclassified 526
239 Ga0439465_0042900 3300041413 Bacteria 1467
240 Ga0439465_0407909 3300041413 Bacteria 518
241 Ga0439432_154584 3300042006 Bacteria 672
242 Ga0466963_0014561 3300044694 Bacteria 4853
243 Ga0466963_0920338 3300044694 Bacteria 616
244 Ga0466963_0971778 3300044694 Bacteria 598
245 Ga0466971_0250022 3300044719 Bacteria 845
246 Ga0466957_0056936 3300044842 Bacteria 2391
247 Ga0466957_0201838 3300044842 Bacteria 1306
248 Ga0466958_0109853 3300045836 Bacteria 1721
249 Ga0466967_0004902 3300045976 Bacteria 9144
250 Ga0495669_0039302 3300046684 Bacteria 2095
251 Ga0496108_1295560 3300048911 Bacteria 613
252 Ga0496109_1568330 3300048912 Bacteria 593
253 Ga0501043_0171607 3300049579 Bacteria 1692
254 Ga0501067_0052064 3300049583 Bacteria 2268
255 Ga0501227_184932 3300049665 Bacteria 587
256 Ga0501249_008329 3300049679 Bacteria 2152
257 Ga0501263_004911 3300049760 Bacteria 1493
258 Ga0501270_001881 3300049767 Bacteria 2085
259 Ga0466962_0043124 3300061719 Bacteria 2159
260 Ga0307414_10561831
261 JGI24741J21665_1007613
262 JGI24740J21852_10018718
263 JGI24739J22299_10017823
264 JGI24735J21928_10011303
265 JGI24735J21928_10036004
266 Ga0065715_10350977
267 Ga0065715_10908527
268 Ga0070658_10005221
269 Ga0070658_11756872
270 Ga0070683_101266822
271 Ga0070690_100383498
272 Ga0070680_100008547
273 Ga0070680_100187522
274 Ga0070680_100581942
275 Ga0070682_100773655
276 Ga0070660_100008399
277 Ga0070660_100147080
278 Ga0070660_100520376
279 Ga0070660_100997017
280 Ga0070661_100014521
281 Ga0070661_100094467
282 Ga0070661_100721909
283 Ga0070661_101242209
284 Ga0070668_100297447
285 Ga0070669_100161059
286 Ga0070669_100245584
287 Ga0070675_100038132
288 Ga0070673_100073629
289 Ga0070659_100021286
290 Ga0070659_100035347
291 Ga0070659_100035378
292 Ga0070659_100167267
293 Ga0070663_100071712
294 Ga0070662_100096626
295 Ga0070662_100098400
296 Ga0070662_100562200
297 Ga0070681_10071255
298 Ga0070681_11109971
299 Ga0070679_100090850
300 Ga0070679_100215320
301 Ga0070679_100228041
302 Ga0070679_100722821
303 Ga0070684_101893789
304 Ga0068853_100531573
305 Ga0068853_100976056
306 Ga0068853_101149783
307 Ga0070693_100739270
308 Ga0070693_100998436
309 Ga0068855_100571789
310 Ga0068855_102052353
311 Ga0070664_100014790
312 Ga0070664_100170357
313 Ga0068857_100124203
314 Ga0068857_100238376
315 Ga0068857_100319980
316 Ga0068854_100017430
317 Ga0068854_100035564
318 Ga0068854_101279631
319 Ga0068856_100579351
320 Ga0068852_100131729
321 Ga0068852_100380946
322 Ga0068852_100850453
323 Ga0068851_10567227
324 Ga0068862_100308153
325 Ga0097621_100280556
326 Ga0068871_100065305
327 Ga0105240_10292525
328 Ga0114129_10198027
329 Ga0105241_10767264
330 Ga0105248_10073240
331 Ga0105238_10083403
332 Ga0105238_10817079
333 Ga0157373_10410465
334 Ga0157373_10678526
335 Ga0157371_10209795
336 Ga0157371_10379211
337 Ga0157371_11024700
338 Ga0157370_10282673
339 Ga0157370_10524406
340 Ga0157369_10287357
341 Ga0157369_10381912
342 Ga0157369_10392776
343 Ga0157369_10401743
344 Ga0157369_10541302
345 Ga0157372_10015905
346 Ga0157372_10740958
347 Ga0157375_13193753
348 Ga0157380_10011728
349 Ga0206354_10599540
350 Ga0206353_11835990
351 Ga0207656_10527572
352 Ga0207705_10063759
353 Ga0207705_10115662
354 Ga0207705_10144835
355 Ga0207705_10785581
356 Ga0207705_11270558
357 Ga0207707_10020792
358 Ga0207707_10938968
359 Ga0207695_10065361
360 Ga0207660_10003718
361 Ga0207660_10014836
362 Ga0207657_10014359
363 Ga0207657_10570740
364 Ga0207657_10722465
365 Ga0207657_10877206
366 Ga0207649_10008523
367 Ga0207649_10026294
368 Ga0207649_10455391
369 Ga0207649_10556292
370 Ga0207652_10046673
371 Ga0207652_10181098
372 Ga0207652_10191228
373 Ga0207652_10560259
374 Ga0207681_10449263
375 Ga0207681_10512321
376 Ga0207694_10058909
377 Ga0207694_10837838
378 Ga0207690_10014039
379 Ga0207690_10739155
380 Ga0207706_10006593
381 Ga0207661_10529651
382 Ga0207679_10195846
383 Ga0207679_10704738
384 Ga0207679_11099728
385 Ga0207667_10018263
386 Ga0207658_10062993
387 Ga0207639_10073146
388 Ga0207639_10095701
389 Ga0207639_10251483
390 Ga0207678_10001557
391 Ga0207678_10135496
392 Ga0207702_10167727
393 Ga0207674_10931142
394 Ga0207698_10027238
395 Ga0207698_10271359
396 Ga0207698_11852799
397 Ga0209971_1028580
398 Ga0268265_12147029
399 Ga0307408_100110895
400 Ga0307408_100223275
401 Ga0307408_100279763
402 Ga0307408_100565481
403 Ga0307405_10060006
404 Ga0307405_10339674
405 Ga0307405_10347161
406 Ga0307413_10005619
407 Ga0307413_10150088
408 Ga0307413_10168721
409 Ga0307413_12169802
410 Ga0307410_10071558
411 Ga0307410_10073347
412 Ga0307410_10076311
413 Ga0307410_10414319
414 Ga0307410_10636454
415 Ga0307410_10767851
416 Ga0307410_10984688
417 Ga0307410_11409374
418 Ga0307406_10081077
419 Ga0307406_10090847
420 Ga0307406_10177204
421 Ga0307406_10476974
422 Ga0307406_11525073
423 Ga0307407_10021398
424 Ga0307407_10092546
425 Ga0307407_10469581
426 Ga0307407_10688016
427 Ga0307407_11441369
428 Ga0307412_10057849
429 Ga0307412_10085910
430 Ga0307412_10095580
431 Ga0307412_10154268
432 Ga0307412_10204981
433 Ga0307412_10467129
434 Ga0307409_100038490
435 Ga0307409_100068246
436 Ga0307409_100086174
437 Ga0307409_100139603
438 Ga0307409_100166635
439 Ga0307409_100503460
440 Ga0307416_100002746
441 Ga0307416_100027648
442 Ga0307416_100051529
443 Ga0307416_100066350
444 Ga0307416_100117189
445 Ga0307416_100138008
446 Ga0307416_100156740
447 Ga0307416_100455364
448 Ga0307416_100474595
449 Ga0307416_102194262
450 Ga0307414_10106992
451 Ga0307414_10122322
452 Ga0307414_10174435
453 Ga0307414_10207862
454 Ga0307414_10236915
455 Ga0307414_10242769
456 Ga0307414_10407238
457 Ga0307411_10087101
458 Ga0307411_10143777
459 Ga0307411_10213643
460 Ga0307411_10600226
461 Ga0307411_10705534
462 Ga0307411_11228075
463 Ga0307411_11868668
464 Ga0307415_100001878
465 Ga0307415_100027817
466 Ga0307415_100043457
467 Ga0307415_100052706
468 Ga0307415_100140414
469 Ga0307415_100186923
470 Ga0307415_100203083
471 Ga0307415_100230745
472 Ga0307415_100257596
473 Ga0395899_0000244
474 Ga0395899_0028049
475 Ga0395899_0251150
476 Ga0395900_0000771
477 Ga0395900_0063934
478 Ga0395900_0426769
479 Ga0395900_0463213
480 Ga0395900_0958942
481 Ga0395900_1096500
482 Ga0395900_1503687
483 Ga0395898_0032289
484 Ga0395898_0261370
485 Ga0395898_0531674
486 Ga0395898_0535811
487 Ga0395898_0571032
488 Ga0395905_0125871
489 Ga0395905_0602458
490 Ga0395905_0904801
491 Ga0395901_0000206
492 Ga0395901_0077711
493 Ga0395901_0295975
494 Ga0395901_0327522
495 Ga0395901_0633964
496 Ga0395901_0964675
497 Ga0395901_1996936
498 Ga0439465_0042900
499 Ga0439465_0407909
500 Ga0439432_154584
501 Ga0466963_0014561
502 Ga0466963_0920338
503 Ga0466963_0971778
504 Ga0466971_0250022
505 Ga0466957_0056936
506 Ga0466957_0201838
507 Ga0466958_0109853
508 Ga0466967_0004902
509 Ga0495669_0039302
510 Ga0496108_1295560
511 Ga0496109_1568330
512 Ga0501043_0171607
513 Ga0501067_0052064
514 Ga0501227_184932
515 Ga0501249_008329
516 Ga0501263_004911
517 Ga0501270_001881
518 Ga0466962_0043124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

47

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.9049 57 85
2oqa-assembly1.cif.gz_A x-ray sequence and crystal structure of luffaculin 1, a novel type 1 ribosome-inactivating protein 0.8717 57 84
2oqa-assembly2.cif.gz_B x-ray sequence and crystal structure of luffaculin 1, a novel type 1 ribosome-inactivating protein 0.8691 57 84
3ku0-assembly2.cif.gz_B structure of gap31 with adenine at its binding pocket 0.868 57 86
1bry-assembly2.cif.gz_Z bryodin type i rip 0.8621 55 84
ID Description Score Start End Superfamily
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.868 57 86 3.40.420.10
af_A0A0P0X332_29_163_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8556 57 85 3.40.420.10
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8544 55 88 3.40.420.10
af_A0A0P0XZ50_2_174_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8407 57 85 3.40.420.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8308 55 84 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A848Q840-F1-model_v4 deleted 0.9275 1 85
AF-Q7MF78-F1-model_v4 Uncharacterized conserved protein 0.9253 2 107 GO:0016846
GO:0046872
AF-A0A530C491-F1-model_v4 GFA family protein 0.9202 1 113 GO:0016846
GO:0046872
AF-A0A848Q840-F1-model_v4 deleted 0.9171 1 85
AF-A0A526S5J8-F1-model_v4 Aldehyde-activating protein 0.917 1 89 GO:0016846
GO:0046872

Map