F368817

General Info

Members Datasets Scaffolds Average Seq Length
259 180 518 202

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10677762|Ga0157378_106777621
Length 222
Sequence MVSRQKGVAFFSRDMKELRMATRGFFGRRQAPEIEARLPPGQYLEKGFPVLSAGPTPIIKPEQWNFSLKVGPKTLKTWNWQEFNQLPKTKVHKDISCVTKWTKFDTNWEGVTVDDILKAAGLDAPPTPYVLAHSFDGYSTNVPYKDLAEGKGMVALTYEGYPITSEHGGPARLLVPHLYFWKSAKGVNGLQFTNVDEPGFWELRGYHIYGDPWKEQRFTGDP

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
87 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
170 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
171 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
172 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
173 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
174 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
175 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
176 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
177 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
178 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
179 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
180 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0.39
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 1.93
Rhizoplane 3.86
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10677762 3300013297 Bacteria 1049
2 JGI25407J50210_10008748 3300003373 Bacteria 2554
3 Ga0070682_100298709 3300005337 Bacteria 1181
4 Ga0070671_100357384 3300005355 Bacteria 1247
5 Ga0070674_100524678 3300005356 Bacteria 990
6 Ga0070709_10305707 3300005434 Bacteria 1163
7 Ga0070714_100497927 3300005435 Bacteria 1162
8 Ga0070713_100214595 3300005436 Bacteria 1744
9 Ga0070713_100219964 3300005436 Bacteria 1722
10 Ga0070710_10164452 3300005437 Bacteria 1378
11 Ga0070711_100028155 3300005439 Bacteria 3694
12 Ga0070711_100093513 3300005439 Bacteria 2171
13 Ga0070708_100027301 3300005445 Bacteria 4897
14 Ga0070708_100698943 3300005445 Bacteria 954
15 Ga0070663_100000139 3300005455 Bacteria 35134
16 Ga0070663_100904388 3300005455 Bacteria 763
17 Ga0070706_100122449 3300005467 Bacteria 2425
18 Ga0070706_100222592 3300005467 Bacteria 1761
19 Ga0070707_100042501 3300005468 Bacteria 4351
20 Ga0070707_100294192 3300005468 Bacteria 1578
21 Ga0070707_101103637 3300005468 Bacteria 759
22 Ga0070698_100077218 3300005471 Bacteria 3331
23 Ga0070698_100212917 3300005471 Bacteria 1867
24 Ga0070698_100300006 3300005471 Bacteria 1537
25 Ga0070698_100406893 3300005471 Bacteria 1294
26 Ga0070698_100613758 3300005471 Bacteria 1028
27 Ga0070699_101028231 3300005518 Bacteria 756
28 Ga0070679_100006865 3300005530 Bacteria 10613
29 Ga0070697_100032264 3300005536 Bacteria 4214
30 Ga0070697_100180185 3300005536 Bacteria 1791
31 Ga0070697_100975671 3300005536 Bacteria 753
32 Ga0068853_100922989 3300005539 Bacteria 839
33 Ga0070696_100652682 3300005546 Bacteria 853
34 Ga0070665_100006597 3300005548 Bacteria 11795
35 Ga0068864_100213570 3300005618 Bacteria 1778
36 Ga0081455_10045835 3300005937 Bacteria 3800
37 Ga0081538_10004699 3300005981 Bacteria 12504
38 Ga0081540_1028367 3300005983 Bacteria 3144
39 Ga0081539_10137058 3300005985 Bacteria 1194
40 Ga0070717_10116199 3300006028 Bacteria 2287
41 Ga0070717_10236610 3300006028 Bacteria 1609
42 Ga0070717_10273523 3300006028 Bacteria 1496
43 Ga0075363_100000164 3300006048 Bacteria 16988
44 Ga0070716_100104920 3300006173 Bacteria 1740
45 Ga0070716_100655186 3300006173 Bacteria 797
46 Ga0070712_100062709 3300006175 Bacteria 2629
47 Ga0075428_100030359 3300006844 Bacteria 5977
48 Ga0075428_100345796 3300006844 Bacteria 1596
49 Ga0075430_100039516 3300006846 Bacteria 3994
50 Ga0075431_100019866 3300006847 Bacteria 6859
51 Ga0075431_100041069 3300006847 Bacteria 4769
52 Ga0075431_100339838 3300006847 Bacteria 1511
53 Ga0075433_10002811 3300006852 Bacteria 13327
54 Ga0075433_10013932 3300006852 Bacteria 6554
55 Ga0075434_100079197 3300006871 Bacteria 3282
56 Ga0075434_100079746 3300006871 Bacteria 3270
57 Ga0075429_100024714 3300006880 Bacteria 5214
58 Ga0075429_100437978 3300006880 Bacteria 1145
59 Ga0075436_100075012 3300006914 Bacteria 2342
60 Ga0075435_100026918 3300007076 Bacteria 4492
61 Ga0111539_10075962 3300009094 Bacteria 3957
62 Ga0111539_10099405 3300009094 Bacteria 3417
63 Ga0111539_10209225 3300009094 Bacteria 2273
64 Ga0114129_10012698 3300009147 Bacteria 11991
65 Ga0114129_10112093 3300009147 Bacteria 3762
66 Ga0114129_10113066 3300009147 Bacteria 3744
67 Ga0114129_10457411 3300009147 Bacteria 1673
68 Ga0105246_10641698 3300011119 Bacteria 923
69 Ga0157370_10415007 3300013104 Bacteria 1239
70 Ga0157375_10115846 3300013308 Bacteria 2783
71 Ga0157375_10351708 3300013308 Bacteria 1639
72 Ga0163163_11504872 3300014325 Bacteria 734
73 Ga0157376_10023197 3300014969 Bacteria 4854
74 Ga0206351_10243528 3300020077 Bacteria 682
75 Ga0213874_10006005 3300021377 Bacteria 2856
76 Ga0207692_10109446 3300025898 Bacteria 1530
77 Ga0207680_10119110 3300025903 Bacteria 1724
78 Ga0207705_10391444 3300025909 Bacteria 1074
79 Ga0207705_10505399 3300025909 Bacteria 939
80 Ga0207684_10006655 3300025910 Bacteria 10504
81 Ga0207684_10041196 3300025910 Bacteria 3917
82 Ga0207684_10093394 3300025910 Bacteria 2565
83 Ga0207684_10359693 3300025910 Bacteria 1253
84 Ga0207693_10006071 3300025915 Bacteria 10005
85 Ga0207663_10017855 3300025916 Bacteria 3962
86 Ga0207663_10039257 3300025916 Bacteria 2867
87 Ga0207657_10395058 3300025919 Bacteria 1088
88 Ga0207652_10002019 3300025921 Bacteria 17497
89 Ga0207646_10013826 3300025922 Bacteria 7697
90 Ga0207646_10013898 3300025922 Bacteria 7677
91 Ga0207700_10091464 3300025928 Bacteria 2403
92 Ga0207700_10122844 3300025928 Bacteria 2108
93 Ga0207664_10088406 3300025929 Bacteria 2535
94 Ga0207664_10113452 3300025929 Bacteria 2257
95 Ga0207665_10001548 3300025939 Bacteria 15470
96 Ga0207665_10136643 3300025939 Bacteria 1745
97 Ga0207665_10406725 3300025939 Bacteria 1037
98 Ga0207711_10339832 3300025941 Bacteria 1389
99 Ga0207639_11039125 3300026041 Bacteria 768
100 Ga0207678_10001348 3300026067 Bacteria 22636
101 Ga0207678_10206937 3300026067 Bacteria 1678
102 Ga0207702_10596005 3300026078 Bacteria 1084
103 Ga0207683_10266189 3300026121 Bacteria 1565
104 Ga0265318_10015909 3300028577 Bacteria 3116
105 Ga0265338_10382212 3300028800 Bacteria 1007
106 Ga0265325_10015444 3300031241 Bacteria 4292
107 Ga0265329_10021151 3300031242 Bacteria 2188
108 Ga0265340_10001874 3300031247 Bacteria 11973
109 Ga0265340_10009150 3300031247 Bacteria 5326
110 Ga0265340_10114199 3300031247 Bacteria 1246
111 Ga0265339_10007678 3300031249 Bacteria 6938
112 Ga0265331_10193953 3300031250 Bacteria 916
113 Ga0265316_10024639 3300031344 Bacteria 5034
114 Ga0265313_10000773 3300031595 Bacteria 32495
115 Ga0265313_10024365 3300031595 Bacteria 3234
116 Ga0265313_10081731 3300031595 Bacteria 1466
117 Ga0265314_10362980 3300031711 Bacteria 793
118 Ga0265342_10021078 3300031712 Bacteria 4168
119 Ga0307407_10642127 3300031903 Bacteria 794
120 Ga0307416_100909487 3300032002 Bacteria 980
121 Ga0373954_0114520 3300035118 Bacteria 1306
122 Ga0373955_0031525 3300035172 Bacteria 2778
123 Ga0373933_0022199 3300035724 Bacteria 3612
124 Ga0395898_0088851 3300037466 Bacteria 2974
125 Ga0436365_0853042 3300039437 Bacteria 2663
126 Ga0436365_1210584 3300039437 Bacteria 4998
127 Ga0436363_0778515 3300039450 Bacteria 3946
128 Ga0436362_0560635 3300039453 Bacteria 896
129 Ga0451791_0483771 3300041451 Bacteria 2659
130 Ga0451797_0199165 3300041453 Bacteria 1283
131 Ga0451839_0165231 3300041496 Bacteria 1117
132 Ga0439448_0019706 3300042005 Bacteria 2080
133 Ga0466963_0000540 3300044694 Bacteria 17784
134 Ga0466968_0091477 3300044735 Bacteria 1349
135 Ga0466957_0532334 3300044842 Bacteria 817
136 Ga0466967_0003722 3300045976 Bacteria 10048
137 Ga0466967_0022837 3300045976 Bacteria 5115
138 Ga0466967_0059575 3300045976 Bacteria 3380
139 Ga0495629_0297482 3300046459 Bacteria 1106
140 Ga0495638_0005273 3300046460 Bacteria 9658
141 Ga0495651_0078145 3300046462 Bacteria 2503
142 Ga0495653_0102790 3300046463 Bacteria 2067
143 Ga0495642_0024791 3300046528 Bacteria 2374
144 Ga0495652_0005199 3300046529 Bacteria 12300
145 Ga0495645_0144314 3300046543 Bacteria 1658
146 Ga0495667_0079455 3300046559 Bacteria 2132
147 Ga0495625_0181946 3300046660 Bacteria 1397
148 Ga0495657_0015762 3300046675 Bacteria 5522
149 Ga0495624_0321497 3300046690 Bacteria 932
150 Ga0495600_0035321 3300046809 Bacteria 3245
151 Ga0495674_0009384 3300047319 Bacteria 9301
152 Ga0495680_0011061 3300047322 Bacteria 8012
153 Ga0495686_0063295 3300047472 Bacteria 2293
154 Ga0495602_0007957 3300048088 Bacteria 11078
155 Ga0496101_0464523 3300048904 Bacteria 999
156 Ga0496102_0066235 3300048905 Bacteria 3310
157 Ga0496103_0117262 3300048906 Bacteria 1694
158 Ga0496103_0209208 3300048906 Bacteria 1254
159 Ga0496104_0577441 3300048907 Bacteria 1035
160 Ga0496108_0151395 3300048911 Bacteria 2002
161 Ga0496109_0272488 3300048912 Bacteria 1595
162 Ga0496111_0140337 3300048914 Bacteria 1791
163 Ga0496116_0000223 3300048919 Bacteria 106176
164 Ga0496117_0000619 3300048920 Bacteria 57505
165 Ga0496118_0000766 3300048921 Bacteria 51540
166 Ga0496119_0000137 3300048922 Bacteria 103451
167 Ga0496119_0158523 3300048922 Bacteria 1205
168 Ga0496124_0039296 3300048927 Bacteria 4103
169 Ga0496124_0215671 3300048927 Bacteria 1448
170 Ga0496126_0005127 3300048929 Bacteria 15173
171 Ga0496126_0098349 3300048929 Bacteria 2564
172 Ga0496126_0225629 3300048929 Bacteria 1571
173 Ga0501032_0049344 3300049569 Bacteria 2839
174 Ga0501032_0327781 3300049569 Bacteria 988
175 Ga0501034_0070820 3300049571 Bacteria 3497
176 Ga0501034_0085671 3300049571 Bacteria 3152
177 Ga0501034_0319320 3300049571 Bacteria 1486
178 Ga0501034_0518108 3300049571 Bacteria 1104
179 Ga0501034_0574257 3300049571 Bacteria 1035
180 Ga0501036_0018498 3300049572 Bacteria 5839
181 Ga0501036_0078601 3300049572 Bacteria 2790
182 Ga0501037_0025496 3300049573 Bacteria 4368
183 Ga0501037_0114049 3300049573 Bacteria 1945
184 Ga0501037_0247868 3300049573 Bacteria 1247
185 Ga0501038_0004126 3300049574 Bacteria 13517
186 Ga0501039_0017038 3300049575 Bacteria 5570
187 Ga0501040_0023534 3300049576 Bacteria 4131
188 Ga0501041_0011582 3300049577 Bacteria 5217
189 Ga0501042_0032023 3300049578 Bacteria 3721
190 Ga0501043_0140723 3300049579 Bacteria 1890
191 Ga0501043_0647837 3300049579 Bacteria 776
192 Ga0501046_0008366 3300049580 Bacteria 9022
193 Ga0501046_0432437 3300049580 Bacteria 948
194 Ga0501047_0037004 3300049581 Bacteria 4717
195 Ga0501047_0221801 3300049581 Bacteria 1747
196 Ga0501047_0408044 3300049581 Bacteria 1191
197 Ga0501048_0032215 3300049582 Bacteria 3788
198 Ga0501048_0365968 3300049582 Bacteria 1029
199 Ga0501067_0066058 3300049583 Bacteria 2002
200 Ga0501068_0525430 3300049584 Bacteria 768
201 Ga0501070_0463748 3300049586 Bacteria 1020
202 Ga0501071_0014397 3300049587 Bacteria 5409
203 Ga0501072_0005443 3300049588 Bacteria 9696
204 Ga0501073_0063269 3300049589 Bacteria 2581
205 Ga0501073_0380449 3300049589 Bacteria 975
206 Ga0501073_0566878 3300049589 Bacteria 784
207 Ga0501074_0013512 3300049590 Bacteria 5934
208 Ga0501075_0005090 3300049591 Bacteria 8982
209 Ga0501076_0019384 3300049592 Bacteria 5201
210 Ga0501077_0016926 3300049593 Bacteria 4598
211 Ga0501079_0006112 3300049741 Bacteria 9027
212 Ga0501080_0196969 3300049742 Bacteria 1850
213 Ga0501081_0049124 3300049743 Bacteria 2904
214 Ga0501083_0002682 3300049744 Bacteria 12262
215 Ga0501083_0064420 3300049744 Bacteria 2443
216 Ga0501083_0112496 3300049744 Bacteria 1789
217 Ga0501083_0532929 3300049744 Bacteria 764
218 Ga0501083_0542530 3300049744 Bacteria 757
219 Ga0501035_0022881 3300049822 Bacteria 5739
220 Ga0501044_0114518 3300049823 Bacteria 2702
221 Ga0501044_0138381 3300049823 Bacteria 2424
222 Ga0501045_0006456 3300049824 Bacteria 8121
223 nmdc:mga03n38_25918_c1 3300050490 Bacteria 2415
224 nmdc:mga05p37_10112_c1 3300050507 Bacteria 11199
225 nmdc:mga05p37_197793_c1 3300050507 Bacteria 2437
226 nmdc:mga05p37_892340_c1 3300050507 Bacteria 960
227 nmdc:mga09592_103431_c1 3300050508 Bacteria 2440
228 nmdc:mga09592_19785_c1 3300050508 Bacteria 5530
229 nmdc:mga09592_426689_c1 3300050508 Bacteria 1145
230 nmdc:mga06r32_34296_c1 3300050510 Bacteria 4785
231 nmdc:mga06r32_70135_c1 3300050510 Bacteria 1297
232 nmdc:mga08y16_370667_c1 3300050511 Bacteria 1469
233 nmdc:mga08y16_85563_c1 3300050511 Bacteria 3286
234 nmdc:mga0n895_172790_c1 3300050512 Bacteria 2193
235 nmdc:mga0n895_6186_c1 3300050512 Bacteria 10119
236 nmdc:mga0rr50_49245_c1 3300050513 Bacteria 3119
237 nmdc:mga08x19_71328_c1 3300050514 Bacteria 2265
238 nmdc:mga0a205_16240_c2 3300050515 Bacteria 5987
239 nmdc:mga0a205_4719_c1 3300050515 Bacteria 12234
240 Ga0495619_0011193 3300053085 Bacteria 5642
241 Ga0500643_016350 3300053087 Bacteria 2515
242 Ga0500566_0165056 3300053094 Bacteria 1150
243 Ga0500573_0000730 3300053140 Bacteria 14658
244 Ga0501084_0020046 3300054114 Bacteria 5575
245 Ga0501082_0003197 3300060353 Bacteria 14282
246 Ga0466962_0020163 3300061719 Bacteria 3204
247 Ga0530510_0025042 3300061734 Bacteria 4265
248 2644503366 2643221690 Bacteria 4654705
249 2644525672 2643221694 Bacteria 4392972
250 2644669742 2643221722 Bacteria 4247614
251 2799184186 2799112218 Bacteria 4315149
252 2858904527 2858902515 Bacteria 7086037
253 2884995945 2884994152 Bacteria 4492978
254 2895434334 2895427314 Bacteria 13147766
255 2924762374 2924754689 Bacteria 6774424
256 2970546522 2970540015 Bacteria 6977556
257 8004395966 8004395343 Bacteria 6620908
258 8054919377 8054913762 Bacteria 7713009
259 8054925163 8054920844 Bacteria 7068637
260 Ga0157378_10677762
261 JGI25407J50210_10008748
262 Ga0070682_100298709
263 Ga0070671_100357384
264 Ga0070674_100524678
265 Ga0070709_10305707
266 Ga0070714_100497927
267 Ga0070713_100214595
268 Ga0070713_100219964
269 Ga0070710_10164452
270 Ga0070711_100028155
271 Ga0070711_100093513
272 Ga0070708_100027301
273 Ga0070708_100698943
274 Ga0070663_100000139
275 Ga0070663_100904388
276 Ga0070706_100122449
277 Ga0070706_100222592
278 Ga0070707_100042501
279 Ga0070707_100294192
280 Ga0070707_101103637
281 Ga0070698_100077218
282 Ga0070698_100212917
283 Ga0070698_100300006
284 Ga0070698_100406893
285 Ga0070698_100613758
286 Ga0070699_101028231
287 Ga0070679_100006865
288 Ga0070697_100032264
289 Ga0070697_100180185
290 Ga0070697_100975671
291 Ga0068853_100922989
292 Ga0070696_100652682
293 Ga0070665_100006597
294 Ga0068864_100213570
295 Ga0081455_10045835
296 Ga0081538_10004699
297 Ga0081540_1028367
298 Ga0081539_10137058
299 Ga0070717_10116199
300 Ga0070717_10236610
301 Ga0070717_10273523
302 Ga0075363_100000164
303 Ga0070716_100104920
304 Ga0070716_100655186
305 Ga0070712_100062709
306 Ga0075428_100030359
307 Ga0075428_100345796
308 Ga0075430_100039516
309 Ga0075431_100019866
310 Ga0075431_100041069
311 Ga0075431_100339838
312 Ga0075433_10002811
313 Ga0075433_10013932
314 Ga0075434_100079197
315 Ga0075434_100079746
316 Ga0075429_100024714
317 Ga0075429_100437978
318 Ga0075436_100075012
319 Ga0075435_100026918
320 Ga0111539_10075962
321 Ga0111539_10099405
322 Ga0111539_10209225
323 Ga0114129_10012698
324 Ga0114129_10112093
325 Ga0114129_10113066
326 Ga0114129_10457411
327 Ga0105246_10641698
328 Ga0157370_10415007
329 Ga0157375_10115846
330 Ga0157375_10351708
331 Ga0163163_11504872
332 Ga0157376_10023197
333 Ga0206351_10243528
334 Ga0213874_10006005
335 Ga0207692_10109446
336 Ga0207680_10119110
337 Ga0207705_10391444
338 Ga0207705_10505399
339 Ga0207684_10006655
340 Ga0207684_10041196
341 Ga0207684_10093394
342 Ga0207684_10359693
343 Ga0207693_10006071
344 Ga0207663_10017855
345 Ga0207663_10039257
346 Ga0207657_10395058
347 Ga0207652_10002019
348 Ga0207646_10013826
349 Ga0207646_10013898
350 Ga0207700_10091464
351 Ga0207700_10122844
352 Ga0207664_10088406
353 Ga0207664_10113452
354 Ga0207665_10001548
355 Ga0207665_10136643
356 Ga0207665_10406725
357 Ga0207711_10339832
358 Ga0207639_11039125
359 Ga0207678_10001348
360 Ga0207678_10206937
361 Ga0207702_10596005
362 Ga0207683_10266189
363 Ga0265318_10015909
364 Ga0265338_10382212
365 Ga0265325_10015444
366 Ga0265329_10021151
367 Ga0265340_10001874
368 Ga0265340_10009150
369 Ga0265340_10114199
370 Ga0265339_10007678
371 Ga0265331_10193953
372 Ga0265316_10024639
373 Ga0265313_10000773
374 Ga0265313_10024365
375 Ga0265313_10081731
376 Ga0265314_10362980
377 Ga0265342_10021078
378 Ga0307407_10642127
379 Ga0307416_100909487
380 Ga0373954_0114520
381 Ga0373955_0031525
382 Ga0373933_0022199
383 Ga0395898_0088851
384 Ga0436365_0853042
385 Ga0436365_1210584
386 Ga0436363_0778515
387 Ga0436362_0560635
388 Ga0451791_0483771
389 Ga0451797_0199165
390 Ga0451839_0165231
391 Ga0439448_0019706
392 Ga0466963_0000540
393 Ga0466968_0091477
394 Ga0466957_0532334
395 Ga0466967_0003722
396 Ga0466967_0022837
397 Ga0466967_0059575
398 Ga0495629_0297482
399 Ga0495638_0005273
400 Ga0495651_0078145
401 Ga0495653_0102790
402 Ga0495642_0024791
403 Ga0495652_0005199
404 Ga0495645_0144314
405 Ga0495667_0079455
406 Ga0495625_0181946
407 Ga0495657_0015762
408 Ga0495624_0321497
409 Ga0495600_0035321
410 Ga0495674_0009384
411 Ga0495680_0011061
412 Ga0495686_0063295
413 Ga0495602_0007957
414 Ga0496101_0464523
415 Ga0496102_0066235
416 Ga0496103_0117262
417 Ga0496103_0209208
418 Ga0496104_0577441
419 Ga0496108_0151395
420 Ga0496109_0272488
421 Ga0496111_0140337
422 Ga0496116_0000223
423 Ga0496117_0000619
424 Ga0496118_0000766
425 Ga0496119_0000137
426 Ga0496119_0158523
427 Ga0496124_0039296
428 Ga0496124_0215671
429 Ga0496126_0005127
430 Ga0496126_0098349
431 Ga0496126_0225629
432 Ga0501032_0049344
433 Ga0501032_0327781
434 Ga0501034_0070820
435 Ga0501034_0085671
436 Ga0501034_0319320
437 Ga0501034_0518108
438 Ga0501034_0574257
439 Ga0501036_0018498
440 Ga0501036_0078601
441 Ga0501037_0025496
442 Ga0501037_0114049
443 Ga0501037_0247868
444 Ga0501038_0004126
445 Ga0501039_0017038
446 Ga0501040_0023534
447 Ga0501041_0011582
448 Ga0501042_0032023
449 Ga0501043_0140723
450 Ga0501043_0647837
451 Ga0501046_0008366
452 Ga0501046_0432437
453 Ga0501047_0037004
454 Ga0501047_0221801
455 Ga0501047_0408044
456 Ga0501048_0032215
457 Ga0501048_0365968
458 Ga0501067_0066058
459 Ga0501068_0525430
460 Ga0501070_0463748
461 Ga0501071_0014397
462 Ga0501072_0005443
463 Ga0501073_0063269
464 Ga0501073_0380449
465 Ga0501073_0566878
466 Ga0501074_0013512
467 Ga0501075_0005090
468 Ga0501076_0019384
469 Ga0501077_0016926
470 Ga0501079_0006112
471 Ga0501080_0196969
472 Ga0501081_0049124
473 Ga0501083_0002682
474 Ga0501083_0064420
475 Ga0501083_0112496
476 Ga0501083_0532929
477 Ga0501083_0542530
478 Ga0501035_0022881
479 Ga0501044_0114518
480 Ga0501044_0138381
481 Ga0501045_0006456
482 nmdc:mga03n38_25918_c1
483 nmdc:mga05p37_10112_c1
484 nmdc:mga05p37_197793_c1
485 nmdc:mga05p37_892340_c1
486 nmdc:mga09592_103431_c1
487 nmdc:mga09592_19785_c1
488 nmdc:mga09592_426689_c1
489 nmdc:mga06r32_34296_c1
490 nmdc:mga06r32_70135_c1
491 nmdc:mga08y16_370667_c1
492 nmdc:mga08y16_85563_c1
493 nmdc:mga0n895_172790_c1
494 nmdc:mga0n895_6186_c1
495 nmdc:mga0rr50_49245_c1
496 nmdc:mga08x19_71328_c1
497 nmdc:mga0a205_16240_c2
498 nmdc:mga0a205_4719_c1
499 Ga0495619_0011193
500 Ga0500643_016350
501 Ga0500566_0165056
502 Ga0500573_0000730
503 Ga0501084_0020046
504 Ga0501082_0003197
505 Ga0466962_0020163
506 Ga0530510_0025042
507 2644503366
508 2644525672
509 2644669742
510 2799184186
511 2858904527
512 2884995945
513 2895434334
514 2924762374
515 2970546522
516 8004395966
517 8054919377
518 8054925163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

53

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8903 44 188
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8898 39 188
2bii-assembly1.cif.gz_A crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta 0.8819 34 172
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8812 34 172
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.88 38 179
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8897 39 188 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8819 34 172 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8761 36 172 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8679 38 183 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8644 40 183 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9945 71 198
AF-A0A2V6AJT6-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9938 56 198
AF-A0A536DRT5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.987 44 198
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9868 71 198
AF-A0A239NDA5-F1-model_v4 Oxidoreductase molybdopterin binding domain-containing protein 0.9858 49 198

Map