F368739

General Info

Members Datasets Scaffolds Average Seq Length
259 113 518 236

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100429855|Ga0075431_1004298552
Length 249
Sequence MTEWFEQWFGEEYHALYPHRDEEDARRAVELIRGVVTWDRGDWILDLACGPGRHVAELEGLGGGGRVVGYDLSRAMLRRARERTQGKVSLVRGDMRALPFRHASFALAVNLFTSFGYFLSDDEHRRVXQXVAAALAPGGYFVLDYLNAEQVRRTLQASDQAGRRRGAAERRTEVRVTRRIGEDGRFVIKEIELRDEGRRFQERVRLFRPDELATLLTDAGLKVVARFGGYDGAPPAPDSPRVILIAVRS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
59 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
90 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
91 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
92 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
93 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
94 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
95 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
96 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
101 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.34
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 20.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100429855 3300006847 Bacteria 1319
2 rootL2_10272684 3300003322 Bacteria 2720
3 Ga0070690_100137694 3300005330 Bacteria 1655
4 Ga0070680_100320127 3300005336 Unclassified 1316
5 Ga0070691_10096470 3300005341 Bacteria 1464
6 Ga0070687_100018838 3300005343 Bacteria 3201
7 Ga0070703_10000654 3300005406 Bacteria 12071
8 Ga0070703_10036139 3300005406 Bacteria 1516
9 Ga0070703_10129857 3300005406 Unclassified 924
10 Ga0070701_10033132 3300005438 Bacteria 2579
11 Ga0070705_100028459 3300005440 Bacteria 3061
12 Ga0070705_100157727 3300005440 Bacteria 1513
13 Ga0070705_100381880 3300005440 Bacteria 1037
14 Ga0070694_100009227 3300005444 Bacteria 6051
15 Ga0070694_100024865 3300005444 Bacteria 3869
16 Ga0070694_100072528 3300005444 Bacteria 2376
17 Ga0070694_100078382 3300005444 Bacteria 2291
18 Ga0070694_100220233 3300005444 Bacteria 1423
19 Ga0070694_100229923 3300005444 Bacteria 1395
20 Ga0070694_100316530 3300005444 Bacteria 1200
21 Ga0070708_100005650 3300005445 Bacteria 9913
22 Ga0070708_100024611 3300005445 Bacteria 5139
23 Ga0070708_100070922 3300005445 Bacteria 3136
24 Ga0070708_100335034 3300005445 Unclassified 1426
25 Ga0070663_100381220 3300005455 Bacteria 1148
26 Ga0068867_100263910 3300005459 Bacteria 1405
27 Ga0070706_100126736 3300005467 Bacteria 2381
28 Ga0070706_100143421 3300005467 Archaea 2230
29 Ga0070706_100201696 3300005467 Unclassified 1858
30 Ga0070707_100018538 3300005468 Bacteria 6548
31 Ga0070707_100099317 3300005468 Bacteria 2820
32 Ga0070707_100103751 3300005468 Bacteria 2755
33 Ga0070707_100376559 3300005468 Bacteria 1379
34 Ga0070699_100031648 3300005518 Bacteria 4568
35 Ga0070699_100053851 3300005518 Bacteria 3482
36 Ga0070699_100217855 3300005518 Bacteria 1701
37 Ga0070699_100225728 3300005518 Bacteria 1670
38 Ga0070697_100004106 3300005536 Bacteria 11156
39 Ga0070697_100004261 3300005536 Bacteria 10967
40 Ga0070697_100014046 3300005536 Bacteria 6290
41 Ga0070697_100127960 3300005536 Unclassified 2128
42 Ga0070697_100404861 3300005536 Bacteria 1184
43 Ga0070695_100008888 3300005545 Bacteria 5966
44 Ga0070695_100017554 3300005545 Bacteria 4341
45 Ga0070695_100055699 3300005545 Bacteria 2549
46 Ga0070695_100395279 3300005545 Bacteria 1047
47 Ga0070695_100479642 3300005545 Bacteria 958
48 Ga0070696_100000351 3300005546 Bacteria 28000
49 Ga0070696_100001737 3300005546 Bacteria 14273
50 Ga0070696_100007419 3300005546 Bacteria 7330
51 Ga0070696_100017564 3300005546 Bacteria 4830
52 Ga0070696_100028854 3300005546 Bacteria 3787
53 Ga0070696_100055904 3300005546 Bacteria 2752
54 Ga0070693_100085006 3300005547 Bacteria 1895
55 Ga0070704_100013467 3300005549 Bacteria 5077
56 Ga0070704_100045385 3300005549 Unclassified 3058
57 Ga0070704_100098340 3300005549 Bacteria 2198
58 Ga0070704_100101951 3300005549 Unclassified 2164
59 Ga0070702_100002238 3300005615 Bacteria 8262
60 Ga0070702_100172276 3300005615 Unclassified 1409
61 Ga0070712_100029631 3300006175 Bacteria 3671
62 Ga0075428_100004745 3300006844 Bacteria 15047
63 Ga0075428_100073529 3300006844 Bacteria 3734
64 Ga0075428_100683513 3300006844 Bacteria 1094
65 Ga0075428_100840741 3300006844 Bacteria 975
66 Ga0075431_100003098 3300006847 Bacteria 16095
67 Ga0075431_100028323 3300006847 Bacteria 5755
68 Ga0075431_100034052 3300006847 Bacteria 5249
69 Ga0075431_100458474 3300006847 Unclassified 1269
70 Ga0075433_10018116 3300006852 Bacteria 5847
71 Ga0075433_10048417 3300006852 Bacteria 3696
72 Ga0075433_10065823 3300006852 Bacteria 3179
73 Ga0075433_10072195 3300006852 Bacteria 3035
74 Ga0075433_10290064 3300006852 Unclassified 1449
75 Ga0075434_100000094 3300006871 Bacteria 48967
76 Ga0075434_100060275 3300006871 Bacteria 3774
77 Ga0075434_100074537 3300006871 Bacteria 3387
78 Ga0075434_100153551 3300006871 Bacteria 2322
79 Ga0075429_100020925 3300006880 Bacteria 5676
80 Ga0075436_100018864 3300006914 Bacteria 4723
81 Ga0075436_100055408 3300006914 Bacteria 2738
82 Ga0075436_100078398 3300006914 Bacteria 2289
83 Ga0075436_100092398 3300006914 Bacteria 2104
84 Ga0075436_100126962 3300006914 Unclassified 1787
85 Ga0075436_100221838 3300006914 Bacteria 1342
86 Ga0075435_100080580 3300007076 Bacteria 2673
87 Ga0075435_100225395 3300007076 Unclassified 1592
88 Ga0075435_100303994 3300007076 Unclassified 1364
89 Ga0075435_100451078 3300007076 Unclassified 1109
90 Ga0099794_10000396 3300007265 Bacteria 14733
91 Ga0099794_10006204 3300007265 Bacteria 4826
92 Ga0114129_10075290 3300009147 Bacteria 4700
93 Ga0114129_10295039 3300009147 Unclassified 2163
94 Ga0114129_10301126 3300009147 Unclassified 2137
95 Ga0114129_10503291 3300009147 Bacteria 1582
96 Ga0207653_10000200 3300025885 Bacteria 40543
97 Ga0207653_10028796 3300025885 Bacteria 1788
98 Ga0207653_10090274 3300025885 Unclassified 1072
99 Ga0207684_10067373 3300025910 Bacteria 3042
100 Ga0207684_10253808 3300025910 Unclassified 1517
101 Ga0207684_10601476 3300025910 Bacteria 939
102 Ga0207663_10031321 3300025916 Bacteria 3147
103 Ga0207660_10220011 3300025917 Bacteria 1490
104 Ga0207662_10032024 3300025918 Unclassified 3057
105 Ga0207646_10096293 3300025922 Bacteria 2651
106 Ga0207646_10434153 3300025922 Unclassified 1185
107 Ga0207690_10028643 3300025932 Bacteria 3531
108 Ga0207689_10104462 3300025942 Bacteria 2327
109 Ga0207639_10568498 3300026041 Bacteria 1043
110 Ga0207678_10322895 3300026067 Bacteria 1328
111 Ga0209588_1002011 3300027671 Bacteria 5478
112 Ga0209588_1009215 3300027671 Archaea 2946
113 Ga0209974_10063686 3300027876 Bacteria 1250
114 Ga0307408_100006867 3300031548 Bacteria 7545
115 Ga0307408_100012284 3300031548 Bacteria 5671
116 Ga0307408_100075666 3300031548 Unclassified 2502
117 Ga0307408_100255899 3300031548 Unclassified 1446
118 Ga0316576_10024387 3300031727 Bacteria 4223
119 Ga0316578_10120804 3300031728 Bacteria 1575
120 Ga0307405_10011306 3300031731 Bacteria 4670
121 Ga0307405_10017053 3300031731 Bacteria 3977
122 Ga0307405_10482442 3300031731 Bacteria 990
123 Ga0307413_10029640 3300031824 Bacteria 3065
124 Ga0307413_10031142 3300031824 Unclassified 3006
125 Ga0307410_10011663 3300031852 Bacteria 5039
126 Ga0307410_10118396 3300031852 Bacteria 1927
127 Ga0307410_10189101 3300031852 Unclassified 1564
128 Ga0307410_10339713 3300031852 Unclassified 1196
129 Ga0307410_10439571 3300031852 Bacteria 1062
130 Ga0307406_10025895 3300031901 Bacteria 3516
131 Ga0307406_10074539 3300031901 Bacteria 2235
132 Ga0307406_10218653 3300031901 Unclassified 1414
133 Ga0307406_10297540 3300031901 Unclassified 1238
134 Ga0307407_10015538 3300031903 Bacteria 3767
135 Ga0307407_10049318 3300031903 Bacteria 2402
136 Ga0307407_10058704 3300031903 Bacteria 2238
137 Ga0307407_10240257 3300031903 Bacteria 1235
138 Ga0307407_10620068 3300031903 Bacteria 807
139 Ga0307412_10033049 3300031911 Bacteria 3284
140 Ga0307412_10143534 3300031911 Unclassified 1752
141 Ga0307409_100005731 3300031995 Bacteria 7200
142 Ga0307409_100051856 3300031995 Bacteria 3142
143 Ga0307409_100103723 3300031995 Bacteria 2366
144 Ga0307409_100249665 3300031995 Archaea 1621
145 Ga0307416_100000613 3300032002 Bacteria 18334
146 Ga0307416_100003537 3300032002 Bacteria 9204
147 Ga0307416_100011410 3300032002 Bacteria 5924
148 Ga0307416_100039607 3300032002 Bacteria 3651
149 Ga0307416_100290107 3300032002 Bacteria 1619
150 Ga0307416_100337216 3300032002 Bacteria 1518
151 Ga0307414_10065659 3300032004 Archaea 2590
152 Ga0307414_10161769 3300032004 Unclassified 1779
153 Ga0307414_10170105 3300032004 Bacteria 1741
154 Ga0307414_10193501 3300032004 Unclassified 1648
155 Ga0307414_10319809 3300032004 Unclassified 1320
156 Ga0307414_10352701 3300032004 Bacteria 1263
157 Ga0307414_10368717 3300032004 Bacteria 1238
158 Ga0307414_10463529 3300032004 Bacteria 1114
159 Ga0307411_10014822 3300032005 Bacteria 4354
160 Ga0307411_10131569 3300032005 Bacteria 1829
161 Ga0307411_10165363 3300032005 Unclassified 1662
162 Ga0307411_10390353 3300032005 Unclassified 1147
163 Ga0307415_100008915 3300032126 Bacteria 5589
164 Ga0307415_100036471 3300032126 Bacteria 3222
165 Ga0307415_100047532 3300032126 Bacteria 2889
166 Ga0373929_0078824 3300035085 Bacteria 800
167 Ga0373941_0254255 3300035115 Unclassified 687
168 Ga0395905_0408936 3300037471 Bacteria 1252
169 Ga0450895_015931 3300042132 Bacteria 673
170 Ga0451577_0072530 3300042876 Bacteria 3072
171 Ga0451577_0353221 3300042876 Bacteria 1334
172 Ga0453683_0024286 3300044673 Unclassified 3858
173 Ga0451576_0003426 3300045051 Bacteria 21810
174 Ga0451576_0004018 3300045051 Bacteria 19565
175 Ga0451576_0009099 3300045051 Bacteria 11556
176 Ga0451576_0018853 3300045051 Bacteria 7543
177 Ga0451576_0050594 3300045051 Bacteria 4357
178 Ga0451576_0071278 3300045051 Bacteria 3616
179 Ga0451576_0110244 3300045051 Bacteria 2864
180 Ga0451576_0175739 3300045051 Bacteria 2235
181 Ga0495621_0064968 3300046539 Unclassified 1332
182 Ga0496101_0208193 3300048904 Bacteria 1514
183 Ga0496102_0021795 3300048905 Bacteria 5670
184 Ga0496102_0192678 3300048905 Bacteria 1921
185 Ga0496102_0693082 3300048905 Bacteria 942
186 Ga0496106_0184790 3300048909 Bacteria 1656
187 Ga0496107_0493400 3300048910 Bacteria 908
188 Ga0496107_0501672 3300048910 Bacteria 900
189 Ga0496108_0002886 3300048911 Bacteria 13792
190 Ga0496108_0018152 3300048911 Bacteria 5757
191 Ga0496109_0029132 3300048912 Bacteria 4942
192 Ga0496109_0074733 3300048912 Bacteria 3116
193 Ga0496110_0010059 3300048913 Bacteria 7679
194 Ga0496111_0104511 3300048914 Bacteria 2083
195 Ga0496112_0003129 3300048915 Bacteria 13576
196 Ga0496112_0510542 3300048915 Bacteria 1137
197 Ga0496113_0010671 3300048916 Bacteria 6084
198 Ga0496113_0075781 3300048916 Unclassified 2568
199 Ga0496114_0326925 3300048917 Bacteria 1355
200 Ga0496115_0306511 3300048918 Bacteria 1301
201 Ga0501298_014184 3300049521 Unclassified 1421
202 Ga0501031_0066809 3300049568 Bacteria 2343
203 Ga0501038_0040938 3300049574 Bacteria 4043
204 Ga0501042_0074957 3300049578 Bacteria 2421
205 Ga0501067_0167254 3300049583 Unclassified 1225
206 Ga0501067_0185875 3300049583 Unclassified 1157
207 Ga0501068_0027728 3300049584 Unclassified 3346
208 Ga0501068_0466331 3300049584 Bacteria 818
209 Ga0501071_0257530 3300049587 Bacteria 1317
210 Ga0501072_0053272 3300049588 Bacteria 3186
211 Ga0501075_0010720 3300049591 Bacteria 6453
212 Ga0501076_0045660 3300049592 Bacteria 3459
213 Ga0501077_0003844 3300049593 Bacteria 9048
214 Ga0501202_016603 3300049652 Bacteria 1430
215 Ga0501206_008865 3300049653 Unclassified 1333
216 Ga0501216_001307 3300049660 Bacteria 3337
217 Ga0501216_013186 3300049660 Bacteria 1367
218 Ga0501235_003545 3300049669 Bacteria 3373
219 Ga0501239_001508 3300049672 Bacteria 2009
220 Ga0501249_001510 3300049679 Bacteria 4778
221 Ga0501257_035138 3300049686 Bacteria 1218
222 Ga0501258_002280 3300049687 Unclassified 1668
223 Ga0501079_0151600 3300049741 Bacteria 1807
224 Ga0501080_0100518 3300049742 Bacteria 2683
225 Ga0501083_0056825 3300049744 Bacteria 2622
226 Ga0501272_012869 3300049769 Unclassified 954
227 Ga0501273_004938 3300049770 Unclassified 1488
228 Ga0501045_0046423 3300049824 Bacteria 3163
229 nmdc:mga05p37_302588_c1 3300050507 Bacteria 1899
230 nmdc:mga05p37_71337_c1 3300050507 Bacteria 4273
231 nmdc:mga09592_72249_c1 3300050508 Unclassified 2930
232 nmdc:mga0qj67_4863_c1 3300050509 Bacteria 9768
233 nmdc:mga06r32_102331_c1 3300050510 Bacteria 2812
234 nmdc:mga06r32_103127_c1 3300050510 Unclassified 2801
235 nmdc:mga06r32_77625_c1 3300050510 Unclassified 3227
236 nmdc:mga0n895_177112_c1 3300050512 Bacteria 2163
237 nmdc:mga0n895_444135_c1 3300050512 Unclassified 1310
238 nmdc:mga0n895_4682_c1 3300050512 Bacteria 11286
239 nmdc:mga0n895_5308_c1 3300050512 Bacteria 10735
240 nmdc:mga0n895_89519_c1 3300050512 Bacteria 3079
241 nmdc:mga0rr50_39220_c1 3300050513 Bacteria 3434
242 nmdc:mga0rr50_59117_c1 3300050513 Bacteria 2877
243 nmdc:mga08x19_14538_c1 3300050514 Bacteria 4774
244 nmdc:mga08x19_199745_c1 3300050514 Unclassified 1370
245 nmdc:mga08x19_301843_c1 3300050514 Bacteria 1112
246 nmdc:mga08x19_36606_c1 3300050514 Bacteria 3109
247 nmdc:mga08x19_43247_c1 3300050514 Bacteria 2874
248 nmdc:mga0a205_147205_c1 3300050515 Unclassified 2256
249 nmdc:mga0a205_19148_c1 3300050515 Bacteria 6452
250 nmdc:mga0a205_302811_c1 3300050515 Bacteria 1471
251 nmdc:mga0a205_31574_c1 3300050515 Bacteria 5075
252 nmdc:mga0a205_396713_c1 3300050515 Unclassified 1244
253 nmdc:mga0a205_46712_c1 3300050515 Bacteria 4176
254 nmdc:mga0a205_73972_c1 3300050515 Unclassified 3292
255 nmdc:mga0a205_9914_c1 3300050515 Bacteria 8737
256 Ga0501084_0014322 3300054114 Bacteria 6571
257 Ga0590071_018567 3300059421 Unclassified 1635
258 Ga0590071_023303 3300059421 Bacteria 1463
259 Ga0501082_0085615 3300060353 Bacteria 2718
260 Ga0075431_100429855
261 rootL2_10272684
262 Ga0070690_100137694
263 Ga0070680_100320127
264 Ga0070691_10096470
265 Ga0070687_100018838
266 Ga0070703_10000654
267 Ga0070703_10036139
268 Ga0070703_10129857
269 Ga0070701_10033132
270 Ga0070705_100028459
271 Ga0070705_100157727
272 Ga0070705_100381880
273 Ga0070694_100009227
274 Ga0070694_100024865
275 Ga0070694_100072528
276 Ga0070694_100078382
277 Ga0070694_100220233
278 Ga0070694_100229923
279 Ga0070694_100316530
280 Ga0070708_100005650
281 Ga0070708_100024611
282 Ga0070708_100070922
283 Ga0070708_100335034
284 Ga0070663_100381220
285 Ga0068867_100263910
286 Ga0070706_100126736
287 Ga0070706_100143421
288 Ga0070706_100201696
289 Ga0070707_100018538
290 Ga0070707_100099317
291 Ga0070707_100103751
292 Ga0070707_100376559
293 Ga0070699_100031648
294 Ga0070699_100053851
295 Ga0070699_100217855
296 Ga0070699_100225728
297 Ga0070697_100004106
298 Ga0070697_100004261
299 Ga0070697_100014046
300 Ga0070697_100127960
301 Ga0070697_100404861
302 Ga0070695_100008888
303 Ga0070695_100017554
304 Ga0070695_100055699
305 Ga0070695_100395279
306 Ga0070695_100479642
307 Ga0070696_100000351
308 Ga0070696_100001737
309 Ga0070696_100007419
310 Ga0070696_100017564
311 Ga0070696_100028854
312 Ga0070696_100055904
313 Ga0070693_100085006
314 Ga0070704_100013467
315 Ga0070704_100045385
316 Ga0070704_100098340
317 Ga0070704_100101951
318 Ga0070702_100002238
319 Ga0070702_100172276
320 Ga0070712_100029631
321 Ga0075428_100004745
322 Ga0075428_100073529
323 Ga0075428_100683513
324 Ga0075428_100840741
325 Ga0075431_100003098
326 Ga0075431_100028323
327 Ga0075431_100034052
328 Ga0075431_100458474
329 Ga0075433_10018116
330 Ga0075433_10048417
331 Ga0075433_10065823
332 Ga0075433_10072195
333 Ga0075433_10290064
334 Ga0075434_100000094
335 Ga0075434_100060275
336 Ga0075434_100074537
337 Ga0075434_100153551
338 Ga0075429_100020925
339 Ga0075436_100018864
340 Ga0075436_100055408
341 Ga0075436_100078398
342 Ga0075436_100092398
343 Ga0075436_100126962
344 Ga0075436_100221838
345 Ga0075435_100080580
346 Ga0075435_100225395
347 Ga0075435_100303994
348 Ga0075435_100451078
349 Ga0099794_10000396
350 Ga0099794_10006204
351 Ga0114129_10075290
352 Ga0114129_10295039
353 Ga0114129_10301126
354 Ga0114129_10503291
355 Ga0207653_10000200
356 Ga0207653_10028796
357 Ga0207653_10090274
358 Ga0207684_10067373
359 Ga0207684_10253808
360 Ga0207684_10601476
361 Ga0207663_10031321
362 Ga0207660_10220011
363 Ga0207662_10032024
364 Ga0207646_10096293
365 Ga0207646_10434153
366 Ga0207690_10028643
367 Ga0207689_10104462
368 Ga0207639_10568498
369 Ga0207678_10322895
370 Ga0209588_1002011
371 Ga0209588_1009215
372 Ga0209974_10063686
373 Ga0307408_100006867
374 Ga0307408_100012284
375 Ga0307408_100075666
376 Ga0307408_100255899
377 Ga0316576_10024387
378 Ga0316578_10120804
379 Ga0307405_10011306
380 Ga0307405_10017053
381 Ga0307405_10482442
382 Ga0307413_10029640
383 Ga0307413_10031142
384 Ga0307410_10011663
385 Ga0307410_10118396
386 Ga0307410_10189101
387 Ga0307410_10339713
388 Ga0307410_10439571
389 Ga0307406_10025895
390 Ga0307406_10074539
391 Ga0307406_10218653
392 Ga0307406_10297540
393 Ga0307407_10015538
394 Ga0307407_10049318
395 Ga0307407_10058704
396 Ga0307407_10240257
397 Ga0307407_10620068
398 Ga0307412_10033049
399 Ga0307412_10143534
400 Ga0307409_100005731
401 Ga0307409_100051856
402 Ga0307409_100103723
403 Ga0307409_100249665
404 Ga0307416_100000613
405 Ga0307416_100003537
406 Ga0307416_100011410
407 Ga0307416_100039607
408 Ga0307416_100290107
409 Ga0307416_100337216
410 Ga0307414_10065659
411 Ga0307414_10161769
412 Ga0307414_10170105
413 Ga0307414_10193501
414 Ga0307414_10319809
415 Ga0307414_10352701
416 Ga0307414_10368717
417 Ga0307414_10463529
418 Ga0307411_10014822
419 Ga0307411_10131569
420 Ga0307411_10165363
421 Ga0307411_10390353
422 Ga0307415_100008915
423 Ga0307415_100036471
424 Ga0307415_100047532
425 Ga0373929_0078824
426 Ga0373941_0254255
427 Ga0395905_0408936
428 Ga0450895_015931
429 Ga0451577_0072530
430 Ga0451577_0353221
431 Ga0453683_0024286
432 Ga0451576_0003426
433 Ga0451576_0004018
434 Ga0451576_0009099
435 Ga0451576_0018853
436 Ga0451576_0050594
437 Ga0451576_0071278
438 Ga0451576_0110244
439 Ga0451576_0175739
440 Ga0495621_0064968
441 Ga0496101_0208193
442 Ga0496102_0021795
443 Ga0496102_0192678
444 Ga0496102_0693082
445 Ga0496106_0184790
446 Ga0496107_0493400
447 Ga0496107_0501672
448 Ga0496108_0002886
449 Ga0496108_0018152
450 Ga0496109_0029132
451 Ga0496109_0074733
452 Ga0496110_0010059
453 Ga0496111_0104511
454 Ga0496112_0003129
455 Ga0496112_0510542
456 Ga0496113_0010671
457 Ga0496113_0075781
458 Ga0496114_0326925
459 Ga0496115_0306511
460 Ga0501298_014184
461 Ga0501031_0066809
462 Ga0501038_0040938
463 Ga0501042_0074957
464 Ga0501067_0167254
465 Ga0501067_0185875
466 Ga0501068_0027728
467 Ga0501068_0466331
468 Ga0501071_0257530
469 Ga0501072_0053272
470 Ga0501075_0010720
471 Ga0501076_0045660
472 Ga0501077_0003844
473 Ga0501202_016603
474 Ga0501206_008865
475 Ga0501216_001307
476 Ga0501216_013186
477 Ga0501235_003545
478 Ga0501239_001508
479 Ga0501249_001510
480 Ga0501257_035138
481 Ga0501258_002280
482 Ga0501079_0151600
483 Ga0501080_0100518
484 Ga0501083_0056825
485 Ga0501272_012869
486 Ga0501273_004938
487 Ga0501045_0046423
488 nmdc:mga05p37_302588_c1
489 nmdc:mga05p37_71337_c1
490 nmdc:mga09592_72249_c1
491 nmdc:mga0qj67_4863_c1
492 nmdc:mga06r32_102331_c1
493 nmdc:mga06r32_103127_c1
494 nmdc:mga06r32_77625_c1
495 nmdc:mga0n895_177112_c1
496 nmdc:mga0n895_444135_c1
497 nmdc:mga0n895_4682_c1
498 nmdc:mga0n895_5308_c1
499 nmdc:mga0n895_89519_c1
500 nmdc:mga0rr50_39220_c1
501 nmdc:mga0rr50_59117_c1
502 nmdc:mga08x19_14538_c1
503 nmdc:mga08x19_199745_c1
504 nmdc:mga08x19_301843_c1
505 nmdc:mga08x19_36606_c1
506 nmdc:mga08x19_43247_c1
507 nmdc:mga0a205_147205_c1
508 nmdc:mga0a205_19148_c1
509 nmdc:mga0a205_302811_c1
510 nmdc:mga0a205_31574_c1
511 nmdc:mga0a205_396713_c1
512 nmdc:mga0a205_46712_c1
513 nmdc:mga0a205_73972_c1
514 nmdc:mga0a205_9914_c1
515 Ga0501084_0014322
516 Ga0590071_018567
517 Ga0590071_023303
518 Ga0501082_0085615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

44

139

0.97

PF08241

Methyltransf_11

Methyltransferase domain

45

143

0.93

PF13847

Methyltransf_31

Methyltransferase domain

39

205

0.85

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

25

160

0.8

PF08242

Methyltransf_12

Methyltransferase domain

45

141

0.77

PF13489

Methyltransf_23

Methyltransferase domain

17

226

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8363 2 238
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8322 2 238
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.8305 31 237
6l7k-assembly1.cif.gz_A solution structure of hifabp v60c/y70c variant. 0.8274 154 196
7zkg-assembly1.cif.gz_A c-methyltransferase psmd from streptomyces griseofuscus with bound cofactor (crystal form 2) 0.8127 12 238
ID Description Score Start End Superfamily
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9274 28 139 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.917 30 139 3.40.50.150
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8691 32 139 3.40.50.150
af_Q95Q27_29_300_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.8687 165 197 3.70.10.10
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8634 30 139 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2A8CVQ7-F1-model_v4 SAM-dependent methyltransferase 0.9187 4 238 GO:0008168
GO:0032259
AF-A0A7Z9LBY2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9121 1 238 GO:0008168
GO:0032259
AF-A0A3B8H7Y6-F1-model_v4 deleted 0.9104 4 238
AF-A0A353VIL1-F1-model_v4 SAM-dependent methyltransferase 0.9104 2 238 GO:0008168
GO:0032259
AF-A0A7Z9LBY2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9084 1 238 GO:0008168
GO:0032259

Map