F368707

General Info

Members Datasets Scaffolds Average Seq Length
259 172 518 136

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10034104|Ga0075365_100341045
Length 148
Sequence MTTLQSRMPTAEQLQRLIAPLFPGLMGVEIVEATPDRIVATLLVRSDLCTSGGVCHGGAYMAFADTVGALGTIMNLPADTRTTIESKTNFLGPAATPLHRGKTTQVWQTTIRNEAGRLCAVVTQTQMVLCRPSLERPAGGRRSSASSI

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
75 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
76 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
101 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
102 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
131 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
148 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.17
Nodule 0
Rhizoplane 0.39
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10034104 3300006038 Bacteria 3285
2 rootH2_10183445 3300003320 Bacteria 3130
3 rootL2_10012834 3300003322 Bacteria 1930
4 Ga0055536_1025999 3300003781 Bacteria 1653
5 Ga0055534_1002617 3300003784 Bacteria 6132
6 Ga0065165_1061770 3300005262 Bacteria 1024
7 Ga0065704_10533004 3300005289 Bacteria 646
8 Ga0070658_10783587 3300005327 Bacteria 828
9 Ga0070658_11619978 3300005327 Bacteria 561
10 Ga0070690_100014366 3300005330 Bacteria 4698
11 Ga0070670_101362101 3300005331 Bacteria 650
12 Ga0068868_100504641 3300005338 Bacteria 1060
13 Ga0070674_101122480 3300005356 Unclassified 695
14 Ga0070667_100768204 3300005367 Bacteria 894
15 Ga0068853_100056414 3300005539 Bacteria 3387
16 Ga0070693_100235645 3300005547 Bacteria 1206
17 Ga0070665_100172607 3300005548 Bacteria 2163
18 Ga0068857_100380525 3300005577 Bacteria 1311
19 Ga0068857_100510542 3300005577 Bacteria 1129
20 Ga0068863_100886704 3300005841 Bacteria 892
21 Ga0068858_100010133 3300005842 Bacteria 8947
22 Ga0075368_10011156 3300006042 Bacteria 3265
23 Ga0075368_10046726 3300006042 Bacteria 1713
24 Ga0075368_10112744 3300006042 Bacteria 1122
25 Ga0075368_10384368 3300006042 Bacteria 615
26 Ga0075363_100002033 3300006048 Bacteria 8068
27 Ga0075363_100013674 3300006048 Bacteria 3944
28 Ga0075363_100083225 3300006048 Bacteria 1753
29 Ga0075363_100097207 3300006048 Bacteria 1627
30 Ga0075364_10593385 3300006051 Bacteria 757
31 Ga0075362_10020143 3300006177 Bacteria 2784
32 Ga0075367_10004172 3300006178 Bacteria 7009
33 Ga0075367_10075141 3300006178 Bacteria 2038
34 Ga0075367_10083769 3300006178 Bacteria 1932
35 Ga0075369_10360533 3300006186 Bacteria 683
36 Ga0075366_10002165 3300006195 Bacteria 10019
37 Ga0075366_10013733 3300006195 Bacteria 4615
38 Ga0075366_10397101 3300006195 Unclassified 849
39 Ga0075370_10002007 3300006353 Bacteria 9229
40 Ga0075370_10015349 3300006353 Bacteria 4099
41 Ga0075370_10047102 3300006353 Bacteria 2441
42 Ga0075428_100005905 3300006844 Bacteria 13608
43 Ga0075428_100049447 3300006844 Bacteria 4613
44 Ga0075430_100048441 3300006846 Bacteria 3588
45 Ga0075431_100000976 3300006847 Bacteria 25434
46 Ga0075431_100256434 3300006847 Bacteria 1776
47 Ga0075431_101561146 3300006847 Bacteria 618
48 Ga0075433_10009097 3300006852 Bacteria 7932
49 Ga0075434_100005337 3300006871 Bacteria 11694
50 Ga0068865_100001612 3300006881 Bacteria 13220
51 Ga0075436_100313863 3300006914 Bacteria 1125
52 Ga0075435_100052314 3300007076 Bacteria 3292
53 Ga0111539_10059206 3300009094 Bacteria 4543
54 Ga0111539_11744994 3300009094 Bacteria 722
55 Ga0114129_10101147 3300009147 Bacteria 3988
56 Ga0114129_10299466 3300009147 Bacteria 2144
57 Ga0114129_11545620 3300009147 Bacteria 814
58 Ga0114129_12395125 3300009147 Bacteria 632
59 Ga0105242_10058766 3300009176 Bacteria 3154
60 Ga0105248_10157812 3300009177 Bacteria 2560
61 Ga0157370_10198934 3300013104 Bacteria 1859
62 Ga0157375_10274162 3300013308 Bacteria 1849
63 Ga0157380_10360154 3300014326 Bacteria 1364
64 Ga0157380_12287028 3300014326 Bacteria 605
65 Ga0182008_10299876 3300014497 Bacteria 841
66 Ga0182008_10549723 3300014497 Bacteria 641
67 Ga0157379_10313275 3300014968 Bacteria 1432
68 Ga0213876_10105917 3300021384 Bacteria 1492
69 Ga0209130_1001942 3300025284 Bacteria 11484
70 Ga0209675_1001194 3300025291 Bacteria 15749
71 Ga0209676_1005591 3300025292 Bacteria 6495
72 Ga0209676_1007339 3300025292 Bacteria 5206
73 Ga0209050_1020261 3300025298 Bacteria 2482
74 Ga0209050_1104690 3300025298 Bacteria 554
75 Ga0209051_1007447 3300025303 Bacteria 5977
76 Ga0209051_1069066 3300025303 Bacteria 1072
77 Ga0209257_1036969 3300025304 Bacteria 1494
78 Ga0207706_10638167 3300025933 Bacteria 913
79 Ga0207686_10012904 3300025934 Bacteria 4607
80 Ga0207669_11030568 3300025937 Unclassified 692
81 Ga0207704_10003732 3300025938 Bacteria 6934
82 Ga0207689_10459612 3300025942 Bacteria 1064
83 Ga0207667_10984156 3300025949 Bacteria 831
84 Ga0207677_10825221 3300026023 Bacteria 831
85 Ga0207708_11328393 3300026075 Bacteria 630
86 Ga0207648_10076175 3300026089 Bacteria 2924
87 Ga0207674_10763093 3300026116 Bacteria 933
88 Ga0207675_100006035 3300026118 Bacteria 11526
89 Ga0207683_10930778 3300026121 Bacteria 807
90 Ga0209813_10002711 3300027866 Bacteria 4078
91 Ga0209813_10014980 3300027866 Bacteria 2094
92 Ga0207428_10177272 3300027907 Bacteria 1612
93 Ga0307517_10285499 3300028786 Bacteria 937
94 Ga0307513_10264632 3300031456 Bacteria 1507
95 Ga0307408_100076772 3300031548 Bacteria 2486
96 Ga0307408_101514944 3300031548 Bacteria 635
97 Ga0307508_10445805 3300031616 Bacteria 887
98 Ga0307405_10972425 3300031731 Bacteria 723
99 Ga0307413_10145173 3300031824 Bacteria 1646
100 Ga0307412_10101715 3300031911 Bacteria 2034
101 Ga0307412_10356515 3300031911 Bacteria 1176
102 Ga0307412_11782929 3300031911 Bacteria 566
103 Ga0307416_100465168 3300032002 Bacteria 1321
104 Ga0307416_102870752 3300032002 Bacteria 576
105 Ga0373948_0163962 3300034817 Bacteria 562
106 Ga0373938_0030336 3300034957 Bacteria 1153
107 Ga0373928_0106656 3300035084 Bacteria 737
108 Ga0373940_0006361 3300035088 Bacteria 2618
109 Ga0373940_0027177 3300035088 Bacteria 1502
110 Ga0373952_0043148 3300035092 Unclassified 1050
111 Ga0373952_0080465 3300035092 Unclassified 830
112 Ga0373932_0226218 3300035112 Bacteria 674
113 Ga0373939_0075229 3300035114 Bacteria 1109
114 Ga0373941_0022825 3300035115 Bacteria 1780
115 Ga0373954_0167740 3300035118 Bacteria 1075
116 Ga0373960_0006258 3300035121 Bacteria 2788
117 Ga0373943_0041102 3300035170 Bacteria 2235
118 Ga0373955_0106412 3300035172 Bacteria 1617
119 Ga0373931_0000704 3300035691 Bacteria 13840
120 Ga0373931_0028470 3300035691 Bacteria 2861
121 Ga0373935_0048475 3300035692 Bacteria 2690
122 Ga0373947_0144584 3300035725 Bacteria 1528
123 Ga0373937_0061471 3300036401 Bacteria 3453
124 Ga0395899_0307743 3300037312 Bacteria 1070
125 Ga0395900_0016466 3300037418 Bacteria 7538
126 Ga0395900_0103789 3300037418 Bacteria 2920
127 Ga0395900_0766461 3300037418 Bacteria 894
128 Ga0395900_0995856 3300037418 Bacteria 758
129 Ga0395900_1064736 3300037418 Bacteria 727
130 Ga0395898_0028195 3300037466 Bacteria 5630
131 Ga0395898_0070064 3300037466 Bacteria 3391
132 Ga0395905_0000033 3300037471 Bacteria 279363
133 Ga0395905_0100057 3300037471 Bacteria 2722
134 Ga0395905_0149877 3300037471 Bacteria 2194
135 Ga0395905_0267381 3300037471 Bacteria 1595
136 Ga0395905_0685989 3300037471 Bacteria 926
137 Ga0395905_0776186 3300037471 Bacteria 861
138 Ga0395905_0823771 3300037471 Bacteria 831
139 Ga0395901_0306291 3300038443 Bacteria 1646
140 Ga0395901_0447187 3300038443 Bacteria 1322
141 Ga0395901_1004284 3300038443 Bacteria 810
142 Ga0395901_1132372 3300038443 Bacteria 751
143 Ga0395901_1640387 3300038443 Bacteria 596
144 Ga0436365_0348586 3300039437 Bacteria 4229
145 Ga0436365_0761116 3300039437 Bacteria 916
146 Ga0439431_0021721 3300041997 Bacteria 1542
147 Ga0439433_0184042 3300041999 Bacteria 548
148 Ga0439445_0029632 3300042004 Bacteria 1415
149 Ga0439463_080630 3300042016 Bacteria 836
150 Ga0450911_000559 3300042115 Bacteria 11534
151 Ga0450888_058791 3300042126 Bacteria 561
152 Ga0450905_004342 3300042142 Bacteria 1878
153 Ga0466969_0025228 3300044656 Bacteria 3058
154 Ga0466969_0380432 3300044656 Bacteria 640
155 Ga0466965_0027497 3300044683 Bacteria 2762
156 Ga0466966_0094554 3300044684 Bacteria 1852
157 Ga0466970_0500107 3300044765 Bacteria 700
158 Ga0466970_0881883 3300044765 Bacteria 526
159 Ga0466960_0304269 3300044901 Bacteria 899
160 Ga0466958_0659444 3300045836 Bacteria 681
161 Ga0495629_0092234 3300046459 Bacteria 2114
162 Ga0495662_0103260 3300046476 Bacteria 1394
163 Ga0495642_0079942 3300046528 Bacteria 1375
164 Ga0495640_0385877 3300046533 Bacteria 861
165 Ga0495645_0662940 3300046543 Bacteria 636
166 Ga0495668_0112564 3300046616 Bacteria 1489
167 Ga0495611_0238640 3300046648 Bacteria 844
168 Ga0495625_0014795 3300046660 Bacteria 6210
169 Ga0495625_0328172 3300046660 Bacteria 973
170 Ga0495657_0432268 3300046675 Bacteria 772
171 Ga0495647_0003593 3300046681 Bacteria 4973
172 Ga0495658_0024368 3300046683 Bacteria 3223
173 Ga0495613_0118235 3300046689 Bacteria 1905
174 Ga0495604_0301103 3300047317 Bacteria 1077
175 Ga0495674_0103617 3300047319 Bacteria 2419
176 Ga0495680_0278646 3300047322 Bacteria 1179
177 Ga0495684_0089497 3300047471 Bacteria 2332
178 Ga0496101_0051162 3300048904 Bacteria 2976
179 Ga0496121_0011977 3300048924 Bacteria 9536
180 Ga0496124_0129529 3300048927 Bacteria 2006
181 Ga0496125_0007476 3300048928 Bacteria 11622
182 Ga0496125_0024840 3300048928 Bacteria 5499
183 Ga0496126_0282536 3300048929 Bacteria 1374
184 Ga0501292_046659 3300049515 Bacteria 759
185 Ga0501294_020203 3300049517 Bacteria 717
186 Ga0501036_0113429 3300049572 Bacteria 2291
187 Ga0501040_1412805 3300049576 Bacteria 505
188 Ga0501046_0262258 3300049580 Bacteria 1269
189 Ga0501047_0157362 3300049581 Bacteria 2145
190 Ga0501067_0467669 3300049583 Unclassified 705
191 Ga0501068_0564125 3300049584 Bacteria 741
192 Ga0501070_1301651 3300049586 Bacteria 555
193 Ga0501072_0098986 3300049588 Bacteria 2318
194 Ga0501073_0476783 3300049589 Bacteria 863
195 Ga0501075_0064377 3300049591 Bacteria 2766
196 Ga0501075_0081048 3300049591 Bacteria 2457
197 Ga0501075_0334138 3300049591 Bacteria 1155
198 Ga0501076_0413123 3300049592 Bacteria 1110
199 Ga0501077_0004924 3300049593 Bacteria 8109
200 Ga0501077_0048613 3300049593 Bacteria 2695
201 Ga0501079_0012253 3300049741 Bacteria 6544
202 Ga0501079_0091318 3300049741 Bacteria 2359
203 Ga0501079_0240376 3300049741 Bacteria 1415
204 Ga0501079_0364451 3300049741 Bacteria 1133
205 Ga0501079_0852825 3300049741 Bacteria 717
206 Ga0501081_1380132 3300049743 Bacteria 535
207 Ga0501083_0145488 3300049744 Bacteria 1552
208 Ga0501083_0737321 3300049744 Unclassified 641
209 Ga0501262_043313 3300049759 Bacteria 678
210 Ga0501274_034966 3300049771 Bacteria 583
211 Ga0501044_0309462 3300049823 Bacteria 1507
212 Ga0501045_0221335 3300049824 Bacteria 1409
213 Ga0501045_0283305 3300049824 Bacteria 1234
214 Ga0501045_0619071 3300049824 Bacteria 801
215 nmdc:mga03683_1123_c1 3300050489 Bacteria 7841
216 nmdc:mga03683_392750_c1 3300050489 Bacteria 661
217 nmdc:mga03n38_1675_c1 3300050490 Bacteria 6514
218 nmdc:mga03n38_24583_c1 3300050490 Bacteria 2465
219 nmdc:mga03n38_54016_c1 3300050490 Bacteria 1804
220 nmdc:mga00v17_82874_c1 3300050491 Bacteria 2005
221 nmdc:mga0yw44_32615_c1 3300050492 Bacteria 3036
222 nmdc:mga0yw44_70025_c1 3300050492 Bacteria 2174
223 nmdc:mga0k408_133_c1 3300050493 Bacteria 36991
224 nmdc:mga0k408_345051_c1 3300050493 Bacteria 888
225 nmdc:mga0k408_4969_c1 3300050493 Bacteria 7047
226 nmdc:mga0k408_5692_c1 3300050493 Bacteria 6627
227 nmdc:mga06z11_106058_c1 3300050494 Bacteria 1549
228 nmdc:mga06z11_192687_c1 3300050494 Bacteria 1181
229 nmdc:mga06z11_36929_c1 3300050494 Bacteria 2416
230 nmdc:mga04h51_1268_c1 3300050495 Bacteria 5830
231 nmdc:mga04h51_2664_c1 3300050495 Bacteria 4255
232 nmdc:mga07m45_1160_c1 3300050496 Bacteria 11835
233 nmdc:mga07m45_12244_c2 3300050496 Bacteria 1225
234 nmdc:mga07m45_2709_c1 3300050496 Bacteria 8345
235 nmdc:mga07m45_44913_c1 3300050496 Bacteria 2480
236 nmdc:mga05p37_1028348_c1 3300050507 Bacteria 872
237 nmdc:mga05p37_376746_c1 3300050507 Bacteria 1664
238 nmdc:mga09592_820453_c1 3300050508 Bacteria 786
239 nmdc:mga06r32_1898_c1 3300050510 Bacteria 18620
240 nmdc:mga06r32_763045_c1 3300050510 Bacteria 930
241 nmdc:mga08y16_83312_c1 3300050511 Bacteria 3333
242 nmdc:mga0n895_32712_c1 3300050512 Bacteria 4993
243 nmdc:mga0rr50_1386347_c1 3300050513 Bacteria 595
244 nmdc:mga0rr50_195225_c1 3300050513 Bacteria 1661
245 nmdc:mga0a205_53369_c1 3300050515 Bacteria 3902
246 nmdc:mga0sz30_20791_c1 3300050516 Bacteria 2650
247 nmdc:mga0sz30_577655_c1 3300050516 Bacteria 508
248 Ga0495601_0055939 3300053077 Bacteria 2498
249 Ga0495619_0201716 3300053085 Bacteria 1377
250 Ga0500568_0014793 3300053139 Bacteria 3511
251 Ga0500568_0031590 3300053139 Bacteria 2183
252 Ga0501084_0048251 3300054114 Bacteria 3564
253 Ga0501084_1113591 3300054114 Bacteria 663
254 Ga0501082_0023837 3300060353 Bacteria 5277
255 Ga0501082_0032141 3300060353 Bacteria 4527
256 Ga0501082_0436409 3300060353 Bacteria 1144
257 Ga0501082_0909312 3300060353 Bacteria 770
258 Ga0530510_0002581 3300061734 Bacteria 12447
259 Ga0530510_0014922 3300061734 Bacteria 5486
260 Ga0075365_10034104
261 rootH2_10183445
262 rootL2_10012834
263 Ga0055536_1025999
264 Ga0055534_1002617
265 Ga0065165_1061770
266 Ga0065704_10533004
267 Ga0070658_10783587
268 Ga0070658_11619978
269 Ga0070690_100014366
270 Ga0070670_101362101
271 Ga0068868_100504641
272 Ga0070674_101122480
273 Ga0070667_100768204
274 Ga0068853_100056414
275 Ga0070693_100235645
276 Ga0070665_100172607
277 Ga0068857_100380525
278 Ga0068857_100510542
279 Ga0068863_100886704
280 Ga0068858_100010133
281 Ga0075368_10011156
282 Ga0075368_10046726
283 Ga0075368_10112744
284 Ga0075368_10384368
285 Ga0075363_100002033
286 Ga0075363_100013674
287 Ga0075363_100083225
288 Ga0075363_100097207
289 Ga0075364_10593385
290 Ga0075362_10020143
291 Ga0075367_10004172
292 Ga0075367_10075141
293 Ga0075367_10083769
294 Ga0075369_10360533
295 Ga0075366_10002165
296 Ga0075366_10013733
297 Ga0075366_10397101
298 Ga0075370_10002007
299 Ga0075370_10015349
300 Ga0075370_10047102
301 Ga0075428_100005905
302 Ga0075428_100049447
303 Ga0075430_100048441
304 Ga0075431_100000976
305 Ga0075431_100256434
306 Ga0075431_101561146
307 Ga0075433_10009097
308 Ga0075434_100005337
309 Ga0068865_100001612
310 Ga0075436_100313863
311 Ga0075435_100052314
312 Ga0111539_10059206
313 Ga0111539_11744994
314 Ga0114129_10101147
315 Ga0114129_10299466
316 Ga0114129_11545620
317 Ga0114129_12395125
318 Ga0105242_10058766
319 Ga0105248_10157812
320 Ga0157370_10198934
321 Ga0157375_10274162
322 Ga0157380_10360154
323 Ga0157380_12287028
324 Ga0182008_10299876
325 Ga0182008_10549723
326 Ga0157379_10313275
327 Ga0213876_10105917
328 Ga0209130_1001942
329 Ga0209675_1001194
330 Ga0209676_1005591
331 Ga0209676_1007339
332 Ga0209050_1020261
333 Ga0209050_1104690
334 Ga0209051_1007447
335 Ga0209051_1069066
336 Ga0209257_1036969
337 Ga0207706_10638167
338 Ga0207686_10012904
339 Ga0207669_11030568
340 Ga0207704_10003732
341 Ga0207689_10459612
342 Ga0207667_10984156
343 Ga0207677_10825221
344 Ga0207708_11328393
345 Ga0207648_10076175
346 Ga0207674_10763093
347 Ga0207675_100006035
348 Ga0207683_10930778
349 Ga0209813_10002711
350 Ga0209813_10014980
351 Ga0207428_10177272
352 Ga0307517_10285499
353 Ga0307513_10264632
354 Ga0307408_100076772
355 Ga0307408_101514944
356 Ga0307508_10445805
357 Ga0307405_10972425
358 Ga0307413_10145173
359 Ga0307412_10101715
360 Ga0307412_10356515
361 Ga0307412_11782929
362 Ga0307416_100465168
363 Ga0307416_102870752
364 Ga0373948_0163962
365 Ga0373938_0030336
366 Ga0373928_0106656
367 Ga0373940_0006361
368 Ga0373940_0027177
369 Ga0373952_0043148
370 Ga0373952_0080465
371 Ga0373932_0226218
372 Ga0373939_0075229
373 Ga0373941_0022825
374 Ga0373954_0167740
375 Ga0373960_0006258
376 Ga0373943_0041102
377 Ga0373955_0106412
378 Ga0373931_0000704
379 Ga0373931_0028470
380 Ga0373935_0048475
381 Ga0373947_0144584
382 Ga0373937_0061471
383 Ga0395899_0307743
384 Ga0395900_0016466
385 Ga0395900_0103789
386 Ga0395900_0766461
387 Ga0395900_0995856
388 Ga0395900_1064736
389 Ga0395898_0028195
390 Ga0395898_0070064
391 Ga0395905_0000033
392 Ga0395905_0100057
393 Ga0395905_0149877
394 Ga0395905_0267381
395 Ga0395905_0685989
396 Ga0395905_0776186
397 Ga0395905_0823771
398 Ga0395901_0306291
399 Ga0395901_0447187
400 Ga0395901_1004284
401 Ga0395901_1132372
402 Ga0395901_1640387
403 Ga0436365_0348586
404 Ga0436365_0761116
405 Ga0439431_0021721
406 Ga0439433_0184042
407 Ga0439445_0029632
408 Ga0439463_080630
409 Ga0450911_000559
410 Ga0450888_058791
411 Ga0450905_004342
412 Ga0466969_0025228
413 Ga0466969_0380432
414 Ga0466965_0027497
415 Ga0466966_0094554
416 Ga0466970_0500107
417 Ga0466970_0881883
418 Ga0466960_0304269
419 Ga0466958_0659444
420 Ga0495629_0092234
421 Ga0495662_0103260
422 Ga0495642_0079942
423 Ga0495640_0385877
424 Ga0495645_0662940
425 Ga0495668_0112564
426 Ga0495611_0238640
427 Ga0495625_0014795
428 Ga0495625_0328172
429 Ga0495657_0432268
430 Ga0495647_0003593
431 Ga0495658_0024368
432 Ga0495613_0118235
433 Ga0495604_0301103
434 Ga0495674_0103617
435 Ga0495680_0278646
436 Ga0495684_0089497
437 Ga0496101_0051162
438 Ga0496121_0011977
439 Ga0496124_0129529
440 Ga0496125_0007476
441 Ga0496125_0024840
442 Ga0496126_0282536
443 Ga0501292_046659
444 Ga0501294_020203
445 Ga0501036_0113429
446 Ga0501040_1412805
447 Ga0501046_0262258
448 Ga0501047_0157362
449 Ga0501067_0467669
450 Ga0501068_0564125
451 Ga0501070_1301651
452 Ga0501072_0098986
453 Ga0501073_0476783
454 Ga0501075_0064377
455 Ga0501075_0081048
456 Ga0501075_0334138
457 Ga0501076_0413123
458 Ga0501077_0004924
459 Ga0501077_0048613
460 Ga0501079_0012253
461 Ga0501079_0091318
462 Ga0501079_0240376
463 Ga0501079_0364451
464 Ga0501079_0852825
465 Ga0501081_1380132
466 Ga0501083_0145488
467 Ga0501083_0737321
468 Ga0501262_043313
469 Ga0501274_034966
470 Ga0501044_0309462
471 Ga0501045_0221335
472 Ga0501045_0283305
473 Ga0501045_0619071
474 nmdc:mga03683_1123_c1
475 nmdc:mga03683_392750_c1
476 nmdc:mga03n38_1675_c1
477 nmdc:mga03n38_24583_c1
478 nmdc:mga03n38_54016_c1
479 nmdc:mga00v17_82874_c1
480 nmdc:mga0yw44_32615_c1
481 nmdc:mga0yw44_70025_c1
482 nmdc:mga0k408_133_c1
483 nmdc:mga0k408_345051_c1
484 nmdc:mga0k408_4969_c1
485 nmdc:mga0k408_5692_c1
486 nmdc:mga06z11_106058_c1
487 nmdc:mga06z11_192687_c1
488 nmdc:mga06z11_36929_c1
489 nmdc:mga04h51_1268_c1
490 nmdc:mga04h51_2664_c1
491 nmdc:mga07m45_1160_c1
492 nmdc:mga07m45_12244_c2
493 nmdc:mga07m45_2709_c1
494 nmdc:mga07m45_44913_c1
495 nmdc:mga05p37_1028348_c1
496 nmdc:mga05p37_376746_c1
497 nmdc:mga09592_820453_c1
498 nmdc:mga06r32_1898_c1
499 nmdc:mga06r32_763045_c1
500 nmdc:mga08y16_83312_c1
501 nmdc:mga0n895_32712_c1
502 nmdc:mga0rr50_1386347_c1
503 nmdc:mga0rr50_195225_c1
504 nmdc:mga0a205_53369_c1
505 nmdc:mga0sz30_20791_c1
506 nmdc:mga0sz30_577655_c1
507 Ga0495601_0055939
508 Ga0495619_0201716
509 Ga0500568_0014793
510 Ga0500568_0031590
511 Ga0501084_0048251
512 Ga0501084_1113591
513 Ga0501082_0023837
514 Ga0501082_0032141
515 Ga0501082_0436409
516 Ga0501082_0909312
517 Ga0530510_0002581
518 Ga0530510_0014922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

52

120

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9579 21 133
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9557 20 134
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9513 30 132
1vi8-assembly1.cif.gz_B crystal structure of a putative thioesterase 0.9512 1 134
1vh5-assembly1.cif.gz_A crystal structure of a putative thioesterase 0.9511 1 132
ID Description Score Start End Superfamily
af_I1N3I1_40_174_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9546 21 132 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9448 21 134 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9414 9 134 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9408 11 134 3.10.129.10
3gekA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9374 30 132 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2H5YHT7-F1-model_v4 Esterase (EC 3.1.2.-) 0.9986 35 134 GO:0047617
AF-A0A515DH57-F1-model_v4 PaaI family thioesterase 0.9923 23 134 GO:0005829
GO:0061522
AF-A0A6G9W5F7-F1-model_v4 PaaI family thioesterase 0.9893 19 134 GO:0005829
GO:0061522
AF-A0A6L6HQW9-F1-model_v4 Hotdog fold thioesterase 0.9883 19 134 GO:0005829
GO:0061522
AF-A0A645HA39-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) 0.9863 17 134 GO:0005829
GO:0061522

Map