F368601

General Info

Members Datasets Scaffolds Average Seq Length
259 133 258 140

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100009865|Ga0070659_1000098657
Length 169
Sequence MLLPWRALAEIAGGTEVWTVGPPRSTCGRMTVPPFHLAFPVDDLAAARAFYGGLLGCPEGRSADEWVDFNLYGHQIVAHLAPEVVRQRASNEVDGDNVPVPHFGIVLPMDEWKALAERLEAAGTEFVIPPTVRFEGQVGEQATMFFLDPAGNALEFKAMADPDNLFAKD

Samples

Sample ID Description Type Environment
1 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 1.16
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10269339 3300005290 Bacteria 919
2 Ga0070658_10051662 3300005327 Bacteria 3331
3 Ga0070658_10546850 3300005327 Bacteria 1002
4 Ga0070658_10620710 3300005327 Bacteria 937
5 Ga0070658_10639349 3300005327 Bacteria 923
6 Ga0070683_100009638 3300005329 Bacteria 8264
7 Ga0070690_100401979 3300005330 Bacteria 1006
8 Ga0070670_100953360 3300005331 Bacteria 779
9 Ga0070677_10601685 3300005333 Bacteria 609
10 Ga0070660_100372133 3300005339 Bacteria 1179
11 Ga0070661_100139939 3300005344 Bacteria 1823
12 Ga0070661_100473264 3300005344 Bacteria 999
13 Ga0070671_100040710 3300005355 Bacteria 3861
14 Ga0070671_100111643 3300005355 Bacteria 2296
15 Ga0070671_100430458 3300005355 Bacteria 1131
16 Ga0070671_100469287 3300005355 Bacteria 1081
17 Ga0070673_100529048 3300005364 Bacteria 1069
18 Ga0070659_100009865 3300005366 Bacteria 7024
19 Ga0070659_100056857 3300005366 Bacteria 3084
20 Ga0070659_100187565 3300005366 Bacteria 1699
21 Ga0070659_100388406 3300005366 Bacteria 1177
22 Ga0070667_100224434 3300005367 Bacteria 1673
23 Ga0070667_100830744 3300005367 Bacteria 858
24 Ga0070714_100070658 3300005435 Bacteria 3018
25 Ga0070705_101901672 3300005440 Bacteria 506
26 Ga0070663_100049025 3300005455 Bacteria 2997
27 Ga0070663_100317286 3300005455 Bacteria 1252
28 Ga0070663_100718350 3300005455 Bacteria 851
29 Ga0070662_100004338 3300005457 Bacteria 8958
30 Ga0070662_100990283 3300005457 Bacteria 719
31 Ga0070681_10051073 3300005458 Bacteria 4125
32 Ga0070681_10551096 3300005458 Bacteria 1067
33 Ga0070679_100150657 3300005530 Bacteria 2303
34 Ga0068853_100035057 3300005539 Bacteria 4261
35 Ga0068853_100165446 3300005539 Bacteria 1998
36 Ga0070665_100055144 3300005548 Bacteria 3986
37 Ga0068855_100029176 3300005563 Bacteria 6597
38 Ga0068855_100393677 3300005563 Bacteria 1519
39 Ga0068855_100604303 3300005563 Bacteria 1182
40 Ga0070664_100601286 3300005564 Bacteria 1020
41 Ga0068854_100025543 3300005578 Bacteria 4054
42 Ga0068856_100123447 3300005614 Bacteria 2592
43 Ga0068856_100184735 3300005614 Bacteria 2098
44 Ga0068852_100010165 3300005616 Bacteria 7012
45 Ga0068852_100307537 3300005616 Bacteria 1536
46 Ga0068852_100968248 3300005616 Bacteria 869
47 Ga0068859_100592604 3300005617 Bacteria 1202
48 Ga0068864_100302188 3300005618 Bacteria 1498
49 Ga0068861_100157090 3300005719 Bacteria 1872
50 Ga0068863_100134351 3300005841 Bacteria 2363
51 Ga0068863_101323093 3300005841 Bacteria 728
52 Ga0068858_100018040 3300005842 Bacteria 6609
53 Ga0068858_100596711 3300005842 Bacteria 1071
54 Ga0068858_100805522 3300005842 Bacteria 916
55 Ga0068858_101201393 3300005842 Bacteria 745
56 Ga0068860_101558182 3300005843 Bacteria 682
57 Ga0097621_100024196 3300006237 Bacteria 4739
58 Ga0097621_101260061 3300006237 Bacteria 697
59 Ga0068871_100143642 3300006358 Bacteria 2031
60 Ga0068865_100470417 3300006881 Bacteria 1043
61 Ga0097620_100592693 3300006931 Bacteria 1202
62 Ga0105240_10620197 3300009093 Bacteria 1189
63 Ga0105240_11194564 3300009093 Bacteria 806
64 Ga0105240_11783249 3300009093 Bacteria 641
65 Ga0111539_12051486 3300009094 Bacteria 663
66 Ga0105242_10134656 3300009176 Unclassified 2137
67 Ga0105248_10462766 3300009177 Bacteria 1430
68 Ga0105248_10872975 3300009177 Bacteria 1016
69 Ga0105237_10042281 3300009545 Bacteria 4597
70 Ga0105237_10888559 3300009545 Bacteria 898
71 Ga0105249_11041484 3300009553 Bacteria 888
72 Ga0157373_10018959 3300013100 Bacteria 5009
73 Ga0157373_10242854 3300013100 Bacteria 1273
74 Ga0157373_10478484 3300013100 Bacteria 898
75 Ga0157373_10905308 3300013100 Bacteria 655
76 Ga0157373_10972094 3300013100 Bacteria 632
77 Ga0157371_10007494 3300013102 Bacteria 8831
78 Ga0157371_10020954 3300013102 Bacteria 4807
79 Ga0157370_10168381 3300013104 Bacteria 2037
80 Ga0157370_10259448 3300013104 Bacteria 1606
81 Ga0157370_10436566 3300013104 Bacteria 1204
82 Ga0157369_10000239 3300013105 Bacteria 76144
83 Ga0157369_10005009 3300013105 Bacteria 15516
84 Ga0157369_10058439 3300013105 Bacteria 4160
85 Ga0157369_10174326 3300013105 Bacteria 2264
86 Ga0157369_10423883 3300013105 Bacteria 1379
87 Ga0157369_10519585 3300013105 Bacteria 1231
88 Ga0157374_10377618 3300013296 Bacteria 1412
89 Ga0157378_10950910 3300013297 Bacteria 892
90 Ga0157378_11223367 3300013297 Bacteria 791
91 Ga0163162_10300607 3300013306 Bacteria 1737
92 Ga0163162_10309381 3300013306 Bacteria 1712
93 Ga0157372_10008388 3300013307 Bacteria 10979
94 Ga0157372_10067564 3300013307 Bacteria 4017
95 Ga0157372_10460899 3300013307 Bacteria 1481
96 Ga0157372_10609535 3300013307 Bacteria 1272
97 Ga0157375_10347221 3300013308 Bacteria 1649
98 Ga0157375_10461811 3300013308 Bacteria 1435
99 Ga0163163_10408626 3300014325 Bacteria 1416
100 Ga0163163_11130797 3300014325 Bacteria 846
101 Ga0182008_10393424 3300014497 Bacteria 743
102 Ga0182008_10616847 3300014497 Bacteria 611
103 Ga0157379_10300771 3300014968 Bacteria 1462
104 Ga0157379_10304370 3300014968 Bacteria 1453
105 Ga0157379_11024528 3300014968 Bacteria 788
106 Ga0157376_10314969 3300014969 Bacteria 1486
107 Ga0163161_10004275 3300017792 Bacteria 9961
108 Ga0163161_10231079 3300017792 Bacteria 1435
109 Ga0207682_10083119 3300025893 Bacteria 1376
110 Ga0207705_10000003 3300025909 Bacteria 709270
111 Ga0207705_10079319 3300025909 Bacteria 2391
112 Ga0207695_10106749 3300025913 Bacteria 2786
113 Ga0207695_10438648 3300025913 Bacteria 1189
114 Ga0207695_10445611 3300025913 Bacteria 1178
115 Ga0207660_10148378 3300025917 Bacteria 1800
116 Ga0207657_10093546 3300025919 Bacteria 2504
117 Ga0207657_10320817 3300025919 Bacteria 1225
118 Ga0207657_10944776 3300025919 Bacteria 663
119 Ga0207649_10001056 3300025920 Bacteria 16892
120 Ga0207649_10245450 3300025920 Bacteria 1287
121 Ga0207649_10325682 3300025920 Bacteria 1130
122 Ga0207652_10533599 3300025921 Bacteria 1055
123 Ga0207652_11038115 3300025921 Bacteria 719
124 Ga0207650_10277746 3300025925 Bacteria 1363
125 Ga0207664_10602660 3300025929 Bacteria 986
126 Ga0207664_10661877 3300025929 Bacteria 939
127 Ga0207644_10211271 3300025931 Bacteria 1534
128 Ga0207690_10006163 3300025932 Bacteria 7101
129 Ga0207690_10019155 3300025932 Bacteria 4207
130 Ga0207690_10045972 3300025932 Bacteria 2888
131 Ga0207690_10570093 3300025932 Bacteria 922
132 Ga0207706_10001143 3300025933 Bacteria 27029
133 Ga0207706_10285316 3300025933 Bacteria 1439
134 Ga0207706_10716335 3300025933 Bacteria 854
135 Ga0207711_10586091 3300025941 Bacteria 1040
136 Ga0207661_10670151 3300025944 Bacteria 954
137 Ga0207679_10004431 3300025945 Bacteria 8745
138 Ga0207679_10448338 3300025945 Bacteria 1144
139 Ga0207679_11158943 3300025945 Bacteria 709
140 Ga0207667_10007152 3300025949 Bacteria 13475
141 Ga0207667_10441932 3300025949 Bacteria 1322
142 Ga0207667_10603190 3300025949 Bacteria 1107
143 Ga0207640_10002216 3300025981 Bacteria 10455
144 Ga0207703_10037809 3300026035 Bacteria 3847
145 Ga0207639_10093713 3300026041 Bacteria 2409
146 Ga0207678_10060986 3300026067 Bacteria 3243
147 Ga0207678_10172432 3300026067 Bacteria 1847
148 Ga0207678_10256237 3300026067 Bacteria 1499
149 Ga0207678_10364109 3300026067 Bacteria 1248
150 Ga0207702_10004323 3300026078 Bacteria 12670
151 Ga0207702_10221519 3300026078 Bacteria 1763
152 Ga0207702_10492022 3300026078 Bacteria 1195
153 Ga0207641_10125691 3300026088 Bacteria 2295
154 Ga0207676_10426138 3300026095 Bacteria 1245
155 Ga0207675_100335503 3300026118 Bacteria 1479
156 Ga0207698_10005194 3300026142 Bacteria 8004
157 Ga0207698_10236257 3300026142 Bacteria 1662
158 Ga0207698_10249722 3300026142 Bacteria 1622
159 Ga0268264_10172075 3300028381 Bacteria 1959
160 Ga0265325_10002474 3300031241 Bacteria 12447
161 Ga0265313_10086674 3300031595 Unclassified 1413
162 Ga0307413_10010650 3300031824 Bacteria 4475
163 Ga0307413_10346075 3300031824 Bacteria 1145
164 Ga0307413_10736439 3300031824 Bacteria 823
165 Ga0307410_10103411 3300031852 Bacteria 2046
166 Ga0307410_10147292 3300031852 Bacteria 1748
167 Ga0307406_10342665 3300031901 Bacteria 1165
168 Ga0307406_10844158 3300031901 Bacteria 776
169 Ga0307407_10000424 3300031903 Bacteria 12941
170 Ga0307407_11347683 3300031903 Bacteria 561
171 Ga0307412_10142026 3300031911 Bacteria 1760
172 Ga0307412_10302905 3300031911 Bacteria 1264
173 Ga0307409_100093311 3300031995 Bacteria 2473
174 Ga0307409_100243890 3300031995 Bacteria 1637
175 Ga0307409_101009887 3300031995 Bacteria 850
176 Ga0307409_101422242 3300031995 Bacteria 720
177 Ga0307416_100111765 3300032002 Bacteria 2410
178 Ga0307414_10663320 3300032004 Bacteria 941
179 Ga0307414_10666823 3300032004 Bacteria 939
180 Ga0307414_12276350 3300032004 Bacteria 506
181 Ga0307411_10013078 3300032005 Bacteria 4561
182 Ga0307411_10035870 3300032005 Bacteria 3102
183 Ga0307415_100046325 3300032126 Bacteria 2920
184 Ga0373937_2010011 3300036401 Unclassified 524
185 Ga0395899_0018641 3300037312 Bacteria 5273
186 Ga0395899_0066326 3300037312 Bacteria 2650
187 Ga0395899_0144689 3300037312 Bacteria 1689
188 Ga0395900_0024203 3300037418 Bacteria 6217
189 Ga0395900_0089535 3300037418 Bacteria 3163
190 Ga0395900_0122181 3300037418 Bacteria 2671
191 Ga0395900_0356179 3300037418 Bacteria 1436
192 Ga0395900_0452774 3300037418 Bacteria 1239
193 Ga0395900_0653868 3300037418 Bacteria 987
194 Ga0395900_0738310 3300037418 Bacteria 916
195 Ga0395900_1063191 3300037418 Bacteria 727
196 Ga0395898_0013237 3300037466 Bacteria 8499
197 Ga0395898_0343232 3300037466 Bacteria 1424
198 Ga0395898_0987987 3300037466 Bacteria 778
199 Ga0395905_0008910 3300037471 Bacteria 9853
200 Ga0395905_0130161 3300037471 Bacteria 2367
201 Ga0395905_0235958 3300037471 Bacteria 1709
202 Ga0395905_0663024 3300037471 Bacteria 945
203 Ga0395905_0807726 3300037471 Bacteria 841
204 Ga0395905_0817965 3300037471 Bacteria 834
205 Ga0395905_0917126 3300037471 Bacteria 779
206 Ga0395901_0000973 3300038443 Bacteria 31117
207 Ga0395901_0012581 3300038443 Bacteria 8586
208 Ga0395901_0068985 3300038443 Bacteria 3682
209 Ga0395901_0484251 3300038443 Bacteria 1261
210 Ga0395901_0552404 3300038443 Bacteria 1167
211 Ga0466969_0008825 3300044656 Bacteria 5345
212 Ga0466966_0000039 3300044684 Bacteria 97202
213 Ga0466966_0000939 3300044684 Bacteria 18614
214 Ga0466966_0003193 3300044684 Bacteria 10795
215 Ga0466966_0198847 3300044684 Bacteria 1213
216 Ga0466961_0017575 3300044693 Bacteria 4595
217 Ga0466961_0106430 3300044693 Bacteria 1765
218 Ga0466963_0030862 3300044694 Bacteria 3461
219 Ga0466963_0061343 3300044694 Bacteria 2513
220 Ga0466971_0010040 3300044719 Bacteria 4136
221 Ga0466971_0118122 3300044719 Bacteria 1226
222 Ga0466970_0046589 3300044765 Bacteria 2309
223 Ga0466957_0088904 3300044842 Bacteria 1933
224 Ga0466959_0048725 3300045049 Bacteria 3113
225 Ga0466959_0097197 3300045049 Bacteria 2110
226 Ga0466959_0116078 3300045049 Bacteria 1906
227 Ga0466958_0024698 3300045836 Bacteria 3537
228 Ga0466958_0110031 3300045836 Bacteria 1719
229 Ga0466958_0188786 3300045836 Bacteria 1309
230 Ga0466967_0013379 3300045976 Bacteria 6337
231 Ga0466967_0032864 3300045976 Bacteria 4386
232 Ga0466967_0058801 3300045976 Bacteria 3399
233 Ga0466967_0094786 3300045976 Bacteria 2719
234 Ga0466967_0626158 3300045976 Bacteria 1063
235 Ga0495629_0481664 3300046459 Unclassified 838
236 Ga0495584_0120270 3300046491 Bacteria 1330
237 Ga0495585_0017274 3300046492 Bacteria 4171
238 Ga0495663_0001960 3300046525 Bacteria 6333
239 Ga0495666_0005759 3300046526 Bacteria 6247
240 Ga0495598_0001109 3300046537 Bacteria 5175
241 Ga0495621_0000837 3300046539 Bacteria 7820
242 Ga0495633_0020451 3300046558 Bacteria 3329
243 Ga0495661_0054948 3300046665 Bacteria 2389
244 Ga0495588_0156330 3300046674 Bacteria 1205
245 Ga0495669_0036662 3300046684 Bacteria 2168
246 Ga0495670_0019553 3300046691 Bacteria 3335
247 Ga0495604_0004249 3300047317 Bacteria 11337
248 Ga0495677_0010876 3300047445 Bacteria 3335
249 Ga0496101_0406286 3300048904 Bacteria 1073
250 Ga0496107_1202838 3300048910 Bacteria 545
251 Ga0496109_0276937 3300048912 Bacteria 1581
252 Ga0501067_0753237 3300049583 Bacteria 548
253 Ga0501074_0072758 3300049590 Bacteria 2469
254 Ga0495601_0210876 3300053077 Unclassified 1269
255 Ga0495619_0244048 3300053085 Unclassified 1245
256 Ga0500643_080617 3300053087 Bacteria 894
257 Ga0466962_0013574 3300061719 Bacteria 3922
258 Ga0466962_0447234 3300061719 Bacteria 650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0013379 Ga0466967_0013379_4950_5366 135
2 3300005327 Ga0070658_10620710 Ga0070658_106207102 136
3 3300005842 Ga0068858_100018040 Ga0068858_1000180402 136
4 3300025919 Ga0207657_10944776 Ga0207657_109447762 136
5 3300025920 Ga0207649_10325682 Ga0207649_103256821 136
6 3300025932 Ga0207690_10045972 Ga0207690_100459722 136
7 3300032004 Ga0307414_10666823 Ga0307414_106668232 136
8 3300037312 Ga0395899_0018641 Ga0395899_0018641_1405_1848 136
9 3300037418 Ga0395900_0356179 Ga0395900_0356179_262_681 136
10 3300037471 Ga0395905_0235958 Ga0395905_0235958_555_998 136
11 3300038443 Ga0395901_0068985 Ga0395901_0068985_2813_3256 136
12 iso_pu_bacteria 2896253425 2896255603 136
13 3300005327 Ga0070658_10051662 Ga0070658_100516623 137
14 3300005327 Ga0070658_10639349 Ga0070658_106393491 137
15 3300005329 Ga0070683_100009638 Ga0070683_1000096387 137
16 3300005330 Ga0070690_100401979 Ga0070690_1004019792 137
17 3300005331 Ga0070670_100953360 Ga0070670_1009533602 137
18 3300005339 Ga0070660_100372133 Ga0070660_1003721332 137
19 3300005344 Ga0070661_100139939 Ga0070661_1001399392 137
20 3300005364 Ga0070673_100529048 Ga0070673_1005290481 137
21 3300005366 Ga0070659_100009865 Ga0070659_1000098657 137
22 3300005366 Ga0070659_100056857 Ga0070659_1000568573 137
23 3300005366 Ga0070659_100187565 Ga0070659_1001875651 137
24 3300005366 Ga0070659_100388406 Ga0070659_1003884062 137
25 3300005367 Ga0070667_100224434 Ga0070667_1002244342 137
26 3300005435 Ga0070714_100070658 Ga0070714_1000706582 137
27 3300005455 Ga0070663_100049025 Ga0070663_1000490251 137
28 3300005455 Ga0070663_100718350 Ga0070663_1007183502 137
29 3300005457 Ga0070662_100004338 Ga0070662_1000043386 137
30 3300005458 Ga0070681_10051073 Ga0070681_100510734 137
31 3300005458 Ga0070681_10551096 Ga0070681_105510962 137
32 3300005530 Ga0070679_100150657 Ga0070679_1001506574 137
33 3300005539 Ga0068853_100035057 Ga0068853_1000350573 137
34 3300005539 Ga0068853_100165446 Ga0068853_1001654462 137
35 3300005548 Ga0070665_100055144 Ga0070665_1000551442 137
36 3300005563 Ga0068855_100029176 Ga0068855_1000291768 137
37 3300005563 Ga0068855_100393677 Ga0068855_1003936772 137
38 3300005563 Ga0068855_100604303 Ga0068855_1006043032 137
39 3300005564 Ga0070664_100601286 Ga0070664_1006012862 137
40 3300005578 Ga0068854_100025543 Ga0068854_1000255432 137
41 3300005614 Ga0068856_100123447 Ga0068856_1001234473 137
42 3300005614 Ga0068856_100184735 Ga0068856_1001847352 137
43 3300005616 Ga0068852_100010165 Ga0068852_1000101655 137
44 3300005616 Ga0068852_100307537 Ga0068852_1003075372 137
45 3300005842 Ga0068858_100596711 Ga0068858_1005967112 137
46 3300009093 Ga0105240_10620197 Ga0105240_106201972 137
47 3300009093 Ga0105240_11194564 Ga0105240_111945642 137
48 3300009093 Ga0105240_11783249 Ga0105240_117832491 137
49 3300009545 Ga0105237_10042281 Ga0105237_100422817 137
50 3300009545 Ga0105237_10888559 Ga0105237_108885592 137
51 3300013100 Ga0157373_10018959 Ga0157373_100189593 137
52 3300013100 Ga0157373_10242854 Ga0157373_102428542 137
53 3300013100 Ga0157373_10478484 Ga0157373_104784842 137
54 3300013100 Ga0157373_10905308 Ga0157373_109053082 137
55 3300013100 Ga0157373_10972094 Ga0157373_109720942 137
56 3300013102 Ga0157371_10007494 Ga0157371_100074947 137
57 3300013102 Ga0157371_10020954 Ga0157371_100209543 137
58 3300013104 Ga0157370_10168381 Ga0157370_101683812 137
59 3300013104 Ga0157370_10259448 Ga0157370_102594482 137
60 3300013104 Ga0157370_10436566 Ga0157370_104365662 137
61 3300013105 Ga0157369_10000239 Ga0157369_1000023911 137
62 3300013105 Ga0157369_10005009 Ga0157369_100050099 137
63 3300013105 Ga0157369_10058439 Ga0157369_100584394 137
64 3300013105 Ga0157369_10174326 Ga0157369_101743262 137
65 3300013105 Ga0157369_10423883 Ga0157369_104238832 137
66 3300013105 Ga0157369_10519585 Ga0157369_105195852 137
67 3300013307 Ga0157372_10008388 Ga0157372_100083885 137
68 3300013307 Ga0157372_10067564 Ga0157372_100675644 137
69 3300013307 Ga0157372_10460899 Ga0157372_104608992 137
70 3300013307 Ga0157372_10609535 Ga0157372_106095352 137
71 3300014325 Ga0163163_11130797 Ga0163163_111307972 137
72 3300014497 Ga0182008_10616847 Ga0182008_106168471 137
73 3300025893 Ga0207682_10083119 Ga0207682_100831191 137
74 3300025909 Ga0207705_10000003 Ga0207705_10000003590 137
75 3300025909 Ga0207705_10079319 Ga0207705_100793191 137
76 3300025913 Ga0207695_10106749 Ga0207695_101067492 137
77 3300025913 Ga0207695_10438648 Ga0207695_104386482 137
78 3300025913 Ga0207695_10445611 Ga0207695_104456112 137
79 3300025917 Ga0207660_10148378 Ga0207660_101483782 137
80 3300025919 Ga0207657_10093546 Ga0207657_100935462 137
81 3300025919 Ga0207657_10320817 Ga0207657_103208172 137
82 3300025920 Ga0207649_10001056 Ga0207649_1000105615 137
83 3300025920 Ga0207649_10245450 Ga0207649_102454502 137
84 3300025921 Ga0207652_10533599 Ga0207652_105335992 137
85 3300025921 Ga0207652_11038115 Ga0207652_110381151 137
86 3300025925 Ga0207650_10277746 Ga0207650_102777462 137
87 3300025929 Ga0207664_10602660 Ga0207664_106026602 137
88 3300025929 Ga0207664_10661877 Ga0207664_106618772 137
89 3300025932 Ga0207690_10006163 Ga0207690_100061632 137
90 3300025932 Ga0207690_10019155 Ga0207690_100191554 137
91 3300025932 Ga0207690_10570093 Ga0207690_105700932 137
92 3300025933 Ga0207706_10001143 Ga0207706_1000114323 137
93 3300025933 Ga0207706_10285316 Ga0207706_102853162 137
94 3300025944 Ga0207661_10670151 Ga0207661_106701512 137
95 3300025945 Ga0207679_10004431 Ga0207679_100044319 137
96 3300025945 Ga0207679_10448338 Ga0207679_104483382 137
97 3300025945 Ga0207679_11158943 Ga0207679_111589431 137
98 3300025949 Ga0207667_10007152 Ga0207667_1000715212 137
99 3300025949 Ga0207667_10441932 Ga0207667_104419322 137
100 3300025949 Ga0207667_10603190 Ga0207667_106031902 137
101 3300025981 Ga0207640_10002216 Ga0207640_100022164 137
102 3300026041 Ga0207639_10093713 Ga0207639_100937133 137
103 3300026067 Ga0207678_10060986 Ga0207678_100609863 137
104 3300026067 Ga0207678_10172432 Ga0207678_101724322 137
105 3300026067 Ga0207678_10364109 Ga0207678_103641092 137
106 3300026078 Ga0207702_10004323 Ga0207702_1000432313 137
107 3300026078 Ga0207702_10221519 Ga0207702_102215192 137
108 3300026078 Ga0207702_10492022 Ga0207702_104920222 137
109 3300026142 Ga0207698_10005194 Ga0207698_100051945 137
110 3300026142 Ga0207698_10236257 Ga0207698_102362572 137
111 3300026142 Ga0207698_10249722 Ga0207698_102497222 137
112 3300031901 Ga0307406_10844158 Ga0307406_108441582 137
113 3300031911 Ga0307412_10302905 Ga0307412_103029052 137
114 3300031995 Ga0307409_101009887 Ga0307409_1010098872 137
115 3300032126 Ga0307415_100046325 Ga0307415_1000463252 137
116 3300036401 Ga0373937_2010011 Ga0373937_2010011_61_474 137
117 3300037312 Ga0395899_0066326 Ga0395899_0066326_1744_2166 137
118 3300037312 Ga0395899_0144689 Ga0395899_0144689_787_1209 137
119 3300037418 Ga0395900_0024203 Ga0395900_0024203_2697_3119 137
120 3300037418 Ga0395900_0089535 Ga0395900_0089535_703_1125 137
121 3300037418 Ga0395900_0122181 Ga0395900_0122181_2218_2640 137
122 3300037418 Ga0395900_0452774 Ga0395900_0452774_695_1117 137
123 3300037418 Ga0395900_0653868 Ga0395900_0653868_35_457 137
124 3300037418 Ga0395900_0738310 Ga0395900_0738310_395_817 137
125 3300037418 Ga0395900_1063191 Ga0395900_1063191_186_608 137
126 3300037466 Ga0395898_0013237 Ga0395898_0013237_7137_7559 137
127 3300037466 Ga0395898_0343232 Ga0395898_0343232_544_966 137
128 3300037466 Ga0395898_0987987 Ga0395898_0987987_216_638 137
129 3300037471 Ga0395905_0008910 Ga0395905_0008910_6004_6426 137
130 3300037471 Ga0395905_0130161 Ga0395905_0130161_17_439 137
131 3300037471 Ga0395905_0663024 Ga0395905_0663024_246_722 137
132 3300037471 Ga0395905_0807726 Ga0395905_0807726_66_488 137
133 3300037471 Ga0395905_0817965 Ga0395905_0817965_182_658 137
134 3300037471 Ga0395905_0917126 Ga0395905_0917126_16_438 137
135 3300038443 Ga0395901_0000973 Ga0395901_0000973_3731_4153 137
136 3300038443 Ga0395901_0012581 Ga0395901_0012581_1573_1995 137
137 3300038443 Ga0395901_0484251 Ga0395901_0484251_238_660 137
138 3300038443 Ga0395901_0552404 Ga0395901_0552404_130_552 137
139 3300044684 Ga0466966_0000039 Ga0466966_0000039_34399_34821 137
140 3300044684 Ga0466966_0198847 Ga0466966_0198847_150_572 137
141 3300044694 Ga0466963_0030862 Ga0466963_0030862_2508_2930 137
142 3300044694 Ga0466963_0061343 Ga0466963_0061343_362_784 137
143 3300045836 Ga0466958_0024698 Ga0466958_0024698_153_575 137
144 3300045976 Ga0466967_0032864 Ga0466967_0032864_2167_2589 137
145 3300045976 Ga0466967_0058801 Ga0466967_0058801_320_742 137
146 3300045976 Ga0466967_0094786 Ga0466967_0094786_2204_2626 137
147 3300045976 Ga0466967_0626158 Ga0466967_0626158_462_896 137
148 3300046459 Ga0495629_0481664 Ga0495629_0481664_333_746 137
149 3300046491 Ga0495584_0120270 Ga0495584_0120270_795_1208 137
150 3300046492 Ga0495585_0017274 Ga0495585_0017274_828_1250 137
151 3300046525 Ga0495663_0001960 Ga0495663_0001960_5158_5580 137
152 3300046526 Ga0495666_0005759 Ga0495666_0005759_5359_5772 137
153 3300046537 Ga0495598_0001109 Ga0495598_0001109_1805_2227 137
154 3300046539 Ga0495621_0000837 Ga0495621_0000837_242_664 137
155 3300046558 Ga0495633_0020451 Ga0495633_0020451_853_1275 137
156 3300046665 Ga0495661_0054948 Ga0495661_0054948_430_852 137
157 3300046674 Ga0495588_0156330 Ga0495588_0156330_691_1104 137
158 3300046684 Ga0495669_0036662 Ga0495669_0036662_991_1413 137
159 3300046691 Ga0495670_0019553 Ga0495670_0019553_2722_3144 137
160 3300047317 Ga0495604_0004249 Ga0495604_0004249_7488_7901 137
161 3300047445 Ga0495677_0010876 Ga0495677_0010876_2597_3019 137
162 3300048910 Ga0496107_1202838 Ga0496107_1202838_106_528 137
163 3300049583 Ga0501067_0753237 Ga0501067_0753237_23_445 137
164 3300049590 Ga0501074_0072758 Ga0501074_0072758_1239_1661 137
165 3300053077 Ga0495601_0210876 Ga0495601_0210876_657_1070 137
166 3300053085 Ga0495619_0244048 Ga0495619_0244048_565_978 137
167 3300053087 Ga0500643_080617 Ga0500643_080617_102_521 137
168 3300005290 Ga0065712_10269339 Ga0065712_102693391 138
169 3300005327 Ga0070658_10546850 Ga0070658_105468502 138
170 3300005333 Ga0070677_10601685 Ga0070677_106016851 138
171 3300005344 Ga0070661_100473264 Ga0070661_1004732642 138
172 3300005355 Ga0070671_100040710 Ga0070671_1000407104 138
173 3300005355 Ga0070671_100111643 Ga0070671_1001116432 138
174 3300005355 Ga0070671_100430458 Ga0070671_1004304582 138
175 3300005355 Ga0070671_100469287 Ga0070671_1004692872 138
176 3300005367 Ga0070667_100830744 Ga0070667_1008307442 138
177 3300005440 Ga0070705_101901672 Ga0070705_1019016721 138
178 3300005455 Ga0070663_100317286 Ga0070663_1003172862 138
179 3300005457 Ga0070662_100990283 Ga0070662_1009902832 138
180 3300005616 Ga0068852_100968248 Ga0068852_1009682481 138
181 3300005617 Ga0068859_100592604 Ga0068859_1005926042 138
182 3300005618 Ga0068864_100302188 Ga0068864_1003021882 138
183 3300005719 Ga0068861_100157090 Ga0068861_1001570902 138
184 3300005841 Ga0068863_100134351 Ga0068863_1001343513 138
185 3300005841 Ga0068863_101323093 Ga0068863_1013230932 138
186 3300005842 Ga0068858_100805522 Ga0068858_1008055222 138
187 3300005842 Ga0068858_101201393 Ga0068858_1012013932 138
188 3300005843 Ga0068860_101558182 Ga0068860_1015581821 138
189 3300006237 Ga0097621_100024196 Ga0097621_1000241964 138
190 3300006237 Ga0097621_101260061 Ga0097621_1012600611 138
191 3300006358 Ga0068871_100143642 Ga0068871_1001436422 138
192 3300006881 Ga0068865_100470417 Ga0068865_1004704172 138
193 3300006931 Ga0097620_100592693 Ga0097620_1005926932 138
194 3300009094 Ga0111539_12051486 Ga0111539_120514861 138
195 3300009176 Ga0105242_10134656 Ga0105242_101346563 138
196 3300009177 Ga0105248_10462766 Ga0105248_104627662 138
197 3300009177 Ga0105248_10872975 Ga0105248_108729752 138
198 3300009553 Ga0105249_11041484 Ga0105249_110414841 138
199 3300013296 Ga0157374_10377618 Ga0157374_103776182 138
200 3300013297 Ga0157378_10950910 Ga0157378_109509102 138
201 3300013297 Ga0157378_11223367 Ga0157378_112233672 138
202 3300013306 Ga0163162_10300607 Ga0163162_103006072 138
203 3300013306 Ga0163162_10309381 Ga0163162_103093812 138
204 3300013308 Ga0157375_10347221 Ga0157375_103472212 138
205 3300013308 Ga0157375_10461811 Ga0157375_104618113 138
206 3300014325 Ga0163163_10408626 Ga0163163_104086262 138
207 3300014497 Ga0182008_10393424 Ga0182008_103934241 138
208 3300014968 Ga0157379_10300771 Ga0157379_103007712 138
209 3300014968 Ga0157379_10304370 Ga0157379_103043702 138
210 3300014968 Ga0157379_11024528 Ga0157379_110245282 138
211 3300014969 Ga0157376_10314969 Ga0157376_103149692 138
212 3300017792 Ga0163161_10004275 Ga0163161_100042756 138
213 3300017792 Ga0163161_10231079 Ga0163161_102310792 138
214 3300025931 Ga0207644_10211271 Ga0207644_102112712 138
215 3300025933 Ga0207706_10716335 Ga0207706_107163352 138
216 3300025941 Ga0207711_10586091 Ga0207711_105860912 138
217 3300026035 Ga0207703_10037809 Ga0207703_100378094 138
218 3300026067 Ga0207678_10256237 Ga0207678_102562372 138
219 3300026088 Ga0207641_10125691 Ga0207641_101256912 138
220 3300026095 Ga0207676_10426138 Ga0207676_104261382 138
221 3300026118 Ga0207675_100335503 Ga0207675_1003355032 138
222 3300028381 Ga0268264_10172075 Ga0268264_101720752 138
223 3300031241 Ga0265325_10002474 Ga0265325_1000247415 138
224 3300031595 Ga0265313_10086674 Ga0265313_100866742 138
225 3300031824 Ga0307413_10010650 Ga0307413_100106504 138
226 3300031824 Ga0307413_10346075 Ga0307413_103460752 138
227 3300031824 Ga0307413_10736439 Ga0307413_107364392 138
228 3300031852 Ga0307410_10103411 Ga0307410_101034112 138
229 3300031852 Ga0307410_10147292 Ga0307410_101472923 138
230 3300031901 Ga0307406_10342665 Ga0307406_103426652 138
231 3300031903 Ga0307407_10000424 Ga0307407_100004243 138
232 3300031903 Ga0307407_11347683 Ga0307407_113476831 138
233 3300031911 Ga0307412_10142026 Ga0307412_101420263 138
234 3300031995 Ga0307409_100093311 Ga0307409_1000933112 138
235 3300031995 Ga0307409_100243890 Ga0307409_1002438902 138
236 3300031995 Ga0307409_101422242 Ga0307409_1014222421 138
237 3300032002 Ga0307416_100111765 Ga0307416_1001117652 138
238 3300032004 Ga0307414_10663320 Ga0307414_106633202 138
239 3300032004 Ga0307414_12276350 Ga0307414_122763501 138
240 3300032005 Ga0307411_10013078 Ga0307411_100130786 138
241 3300032005 Ga0307411_10035870 Ga0307411_100358702 138
242 3300044656 Ga0466969_0008825 Ga0466969_0008825_3808_4233 138
243 3300044684 Ga0466966_0000939 Ga0466966_0000939_4175_4600 138
244 3300044684 Ga0466966_0003193 Ga0466966_0003193_739_1155 138
245 3300044693 Ga0466961_0017575 Ga0466961_0017575_948_1373 138
246 3300044693 Ga0466961_0106430 Ga0466961_0106430_430_846 138
247 3300044719 Ga0466971_0010040 Ga0466971_0010040_283_708 138
248 3300044719 Ga0466971_0118122 Ga0466971_0118122_73_513 138
249 3300044765 Ga0466970_0046589 Ga0466970_0046589_1764_2189 138
250 3300044842 Ga0466957_0088904 Ga0466957_0088904_1234_1674 138
251 3300045049 Ga0466959_0048725 Ga0466959_0048725_1320_1745 138
252 3300045049 Ga0466959_0097197 Ga0466959_0097197_1403_1843 138
253 3300045049 Ga0466959_0116078 Ga0466959_0116078_1377_1793 138
254 3300045836 Ga0466958_0110031 Ga0466958_0110031_948_1373 138
255 3300045836 Ga0466958_0188786 Ga0466958_0188786_835_1275 138
256 3300048904 Ga0496101_0406286 Ga0496101_0406286_246_662 138
257 3300048912 Ga0496109_0276937 Ga0496109_0276937_284_700 138
258 3300061719 Ga0466962_0013574 Ga0466962_0013574_75_500 138
259 3300061719 Ga0466962_0447234 Ga0466962_0447234_75_515 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

34

156

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8341 2 136
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8333 1 126
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8292 1 126
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8156 1 128
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.8058 1 128
ID Description Score Start End Superfamily
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8476 3 51 3.30.720.120
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8322 2 131 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8192 1 128 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8063 1 128 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8023 1 128 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A351EV51-F1-model_v4 Glyoxalase (VOC family protein) 0.9815 4 138
AF-A0A238H7H8-F1-model_v4 Probable dioxygenase 0.9806 4 138 GO:0051213
AF-A0A245ZVH6-F1-model_v4 Glyoxalase-like domain protein 0.9787 1 138
AF-A0A4R1P7Z3-F1-model_v4 deleted 0.9786 1 138
AF-A0A7C4E557-F1-model_v4 Glyoxalase 0.9774 1 138

Feature Viewer

pLDDT pTM Quality
94.2 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map