F368436

General Info

Members Datasets Scaffolds Average Seq Length
258 143 516 239

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_51975_c1|nmdc:mga03683_51975_c1_361_1209
Length 282
Sequence MYSAPAATVVLRLNELTTYVKKEPPMELLERTGLAFGFRWLHVLGGITWIGLLYYFNLVQVPAFAAFGDDGKSRNMAIDKVARRALWWFRWAAVFTLVTGLLIVGITKDYMKDFMSDTSLGGAGHDSVIAVGMIFGITMAANVWMVIWKNQKIVLANAANVLAGNPADPAAAAAGRSAFLASRQNTIFSVSMLFFMVGASHFYSGAFGNVEGSKAVTFFLIAIIIGAAMEVLCLGLIGGKAPKTADGGNKLLWPYESHKNAIITAFALWAVLWILTEILFAK

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
69 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
70 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
71 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
72 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
73 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
78 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
79 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
80 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0
Rhizoplane 3.1
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_51975_c1 3300050489 Unclassified 1712
2 JGI25405J52794_10025985 3300003911 Bacteria 1201
3 Ga0070680_100035559 3300005336 Bacteria 4022
4 Ga0070682_100182824 3300005337 Bacteria 1466
5 Ga0070682_100238644 3300005337 Bacteria 1304
6 Ga0068868_100540365 3300005338 Bacteria 1026
7 Ga0070691_10187698 3300005341 Bacteria 1079
8 Ga0070671_100012005 3300005355 Bacteria 6968
9 Ga0070671_100015246 3300005355 Bacteria 6207
10 Ga0070705_100150512 3300005440 Bacteria 1543
11 Ga0070694_100016372 3300005444 Bacteria 4666
12 Ga0070694_100283818 3300005444 Bacteria 1263
13 Ga0070708_100003977 3300005445 Bacteria 11603
14 Ga0070708_100007333 3300005445 Bacteria 8821
15 Ga0070708_100508169 3300005445 Bacteria 1137
16 Ga0070681_10258937 3300005458 Bacteria 1652
17 Ga0070706_100016727 3300005467 Bacteria 6774
18 Ga0070706_100027566 3300005467 Bacteria 5228
19 Ga0070706_100185216 3300005467 Bacteria 1945
20 Ga0070707_100029549 3300005468 Bacteria 5217
21 Ga0070707_100303709 3300005468 Bacteria 1551
22 Ga0070698_100016448 3300005471 Bacteria 7805
23 Ga0070699_100383114 3300005518 Bacteria 1270
24 Ga0070697_100013162 3300005536 Bacteria 6485
25 Ga0070695_100032180 3300005545 Bacteria 3278
26 Ga0070704_100007046 3300005549 Bacteria 6671
27 Ga0070704_100041381 3300005549 Bacteria 3180
28 Ga0068859_100580140 3300005617 Bacteria 1215
29 Ga0068861_100140775 3300005719 Bacteria 1969
30 Ga0068858_100011799 3300005842 Bacteria 8241
31 Ga0068858_100085539 3300005842 Bacteria 2934
32 Ga0068860_100062814 3300005843 Bacteria 3529
33 Ga0068860_100176280 3300005843 Bacteria 2066
34 Ga0068860_100176931 3300005843 Bacteria 2062
35 Ga0068860_100231156 3300005843 Bacteria 1797
36 Ga0068862_100123268 3300005844 Bacteria 2286
37 Ga0081455_10001211 3300005937 Bacteria 32318
38 Ga0081455_10006278 3300005937 Bacteria 12780
39 Ga0075365_10006582 3300006038 Bacteria 6409
40 Ga0075365_10007389 3300006038 Bacteria 6146
41 Ga0075363_100002349 3300006048 Bacteria 7693
42 Ga0075364_10004829 3300006051 Bacteria 7805
43 Ga0075364_10040537 3300006051 Bacteria 3020
44 Ga0075364_10097254 3300006051 Bacteria 1958
45 Ga0075364_10125154 3300006051 Unclassified 1723
46 Ga0075362_10010025 3300006177 Bacteria 3684
47 Ga0075362_10053795 3300006177 Unclassified 1808
48 Ga0075367_10030955 3300006178 Bacteria 3071
49 Ga0075369_10033035 3300006186 Bacteria 2192
50 Ga0068871_100347633 3300006358 Bacteria 1311
51 Ga0075428_100119641 3300006844 Unclassified 2867
52 Ga0075428_100468435 3300006844 Bacteria 1349
53 Ga0075430_100008690 3300006846 Bacteria 8573
54 Ga0075430_100020721 3300006846 Bacteria 5593
55 Ga0075430_100179572 3300006846 Bacteria 1761
56 Ga0075431_100071808 3300006847 Bacteria 3572
57 Ga0075431_100610118 3300006847 Bacteria 1074
58 Ga0075433_10057311 3300006852 Bacteria 3405
59 Ga0075433_10250337 3300006852 Bacteria 1572
60 Ga0075434_100076598 3300006871 Bacteria 3340
61 Ga0075434_100145988 3300006871 Bacteria 2386
62 Ga0075434_100226844 3300006871 Bacteria 1887
63 Ga0075434_100291783 3300006871 Bacteria 1651
64 Ga0075429_100056232 3300006880 Bacteria 3424
65 Ga0097620_100580114 3300006931 Bacteria 1215
66 Ga0075435_100029063 3300007076 Bacteria 4337
67 Ga0111539_10060775 3300009094 Bacteria 4478
68 Ga0105245_10248323 3300009098 Bacteria 1728
69 Ga0105245_10340902 3300009098 Bacteria 1482
70 Ga0114129_10141058 3300009147 Bacteria 3303
71 Ga0114129_10184135 3300009147 Bacteria 2840
72 Ga0114129_10301722 3300009147 Bacteria 2134
73 Ga0114129_10572611 3300009147 Bacteria 1466
74 Ga0157374_10734855 3300013296 Bacteria 1001
75 Ga0163162_10326052 3300013306 Bacteria 1668
76 Ga0157375_10143463 3300013308 Bacteria 2517
77 Ga0157375_11457969 3300013308 Bacteria 807
78 Ga0163163_10026305 3300014325 Bacteria 5560
79 Ga0157379_10047805 3300014968 Bacteria 3818
80 Ga0207684_10121861 3300025910 Bacteria 2236
81 Ga0207684_10202875 3300025910 Bacteria 1711
82 Ga0207684_10320408 3300025910 Bacteria 1336
83 Ga0207707_10098862 3300025912 Bacteria 2550
84 Ga0207646_10004845 3300025922 Bacteria 14421
85 Ga0207681_10264091 3300025923 Unclassified 1349
86 Ga0207687_10223608 3300025927 Bacteria 1483
87 Ga0207644_10023420 3300025931 Bacteria 4229
88 Ga0207644_10055245 3300025931 Bacteria 2862
89 Ga0207689_10278122 3300025942 Bacteria 1386
90 Ga0207668_10022610 3300025972 Bacteria 4029
91 Ga0207677_10301117 3300026023 Bacteria 1325
92 Ga0207677_10469979 3300026023 Bacteria 1081
93 Ga0207703_10007940 3300026035 Bacteria 8387
94 Ga0207678_10429861 3300026067 Bacteria 1146
95 Ga0207641_10286093 3300026088 Bacteria 1552
96 Ga0207675_100018880 3300026118 Bacteria 6435
97 Ga0207675_101490523 3300026118 Bacteria 697
98 Ga0207683_10126205 3300026121 Bacteria 2300
99 Ga0209588_1028404 3300027671 Bacteria 1780
100 Ga0268265_10204670 3300028380 Bacteria 1715
101 Ga0268264_10054131 3300028381 Bacteria 3350
102 Ga0268264_10081966 3300028381 Bacteria 2759
103 Ga0307407_10357374 3300031903 Bacteria 1036
104 Ga0307411_10335103 3300032005 Bacteria 1227
105 Ga0307415_100464329 3300032126 Bacteria 1098
106 Ga0373930_0036259 3300034816 Bacteria 1034
107 Ga0373948_0008817 3300034817 Bacteria 1726
108 Ga0373938_0078096 3300034957 Unclassified 802
109 Ga0373928_0000344 3300035084 Bacteria 9307
110 Ga0373949_0012738 3300035090 Bacteria 1862
111 Ga0373932_0009819 3300035112 Bacteria 2309
112 Ga0373931_0000003 3300035691 Bacteria 560286
113 Ga0373931_0000056 3300035691 Bacteria 56750
114 Ga0373925_0114192 3300037068 Bacteria 2090
115 Ga0436365_0136871 3300039437 Unclassified 1177
116 Ga0439443_019016 3300042003 Unclassified 1068
117 Ga0439448_0025850 3300042005 Bacteria 1843
118 Ga0439450_024744 3300042008 Unclassified 1312
119 Ga0439463_008250 3300042016 Bacteria 2566
120 Ga0439464_0038380 3300042439 Bacteria 1360
121 Ga0451577_0001623 3300042876 Bacteria 29183
122 Ga0453683_0033915 3300044673 Bacteria 3219
123 Ga0453683_0166757 3300044673 Bacteria 1394
124 Ga0453684_0037432 3300044712 Bacteria 6659
125 Ga0466967_0303456 3300045976 Bacteria 1537
126 Ga0495653_0070418 3300046463 Bacteria 2618
127 Ga0495653_0104411 3300046463 Bacteria 2048
128 Ga0495639_0077188 3300046475 Bacteria 1546
129 Ga0495640_0168770 3300046533 Bacteria 1399
130 Ga0495680_0088741 3300047322 Bacteria 2323
131 Ga0496102_0005201 3300048905 Bacteria 11046
132 Ga0496108_0019142 3300048911 Bacteria 5619
133 Ga0496109_0030737 3300048912 Bacteria 4814
134 Ga0496110_0010637 3300048913 Bacteria 7491
135 Ga0496111_0040290 3300048914 Bacteria 3351
136 Ga0496111_0150676 3300048914 Unclassified 1725
137 Ga0496114_0048855 3300048917 Bacteria 3520
138 Ga0496114_0554426 3300048917 Bacteria 1015
139 Ga0501031_0026574 3300049568 Bacteria 3774
140 Ga0501031_0106505 3300049568 Bacteria 1830
141 Ga0501033_0026983 3300049570 Bacteria 4320
142 Ga0501033_0038782 3300049570 Bacteria 3559
143 Ga0501034_0006104 3300049571 Bacteria 12998
144 Ga0501034_0045836 3300049571 Bacteria 4417
145 Ga0501034_0050324 3300049571 Bacteria 4203
146 Ga0501036_0304888 3300049572 Bacteria 1332
147 Ga0501037_0124149 3300049573 Bacteria 1854
148 Ga0501037_0317649 3300049573 Bacteria 1079
149 Ga0501039_0029908 3300049575 Bacteria 4197
150 Ga0501039_0183528 3300049575 Bacteria 1645
151 Ga0501040_0002294 3300049576 Bacteria 12292
152 Ga0501040_0105317 3300049576 Unclassified 1970
153 Ga0501041_0006495 3300049577 Bacteria 6844
154 Ga0501041_0028744 3300049577 Bacteria 3354
155 Ga0501041_0189486 3300049577 Bacteria 1288
156 Ga0501042_0011037 3300049578 Bacteria 6082
157 Ga0501042_0055505 3300049578 Bacteria 2827
158 Ga0501043_0134147 3300049579 Bacteria 1940
159 Ga0501047_0072008 3300049581 Bacteria 3326
160 Ga0501048_0043877 3300049582 Bacteria 3199
161 Ga0501069_0000754 3300049585 Bacteria 15112
162 Ga0501069_0152169 3300049585 Bacteria 1330
163 Ga0501070_0016222 3300049586 Bacteria 6259
164 Ga0501071_0009541 3300049587 Bacteria 6470
165 Ga0501071_0180271 3300049587 Bacteria 1582
166 Ga0501072_0019852 3300049588 Bacteria 5200
167 Ga0501073_0000404 3300049589 Bacteria 29460
168 Ga0501074_0016605 3300049590 Bacteria 5343
169 Ga0501074_0081295 3300049590 Bacteria 2324
170 Ga0501074_0313852 3300049590 Bacteria 1114
171 Ga0501075_0019270 3300049591 Bacteria 4947
172 Ga0501075_0020878 3300049591 Bacteria 4769
173 Ga0501075_0028149 3300049591 Bacteria 4146
174 Ga0501075_0083629 3300049591 Unclassified 2417
175 Ga0501075_0248400 3300049591 Bacteria 1356
176 Ga0501076_0002662 3300049592 Bacteria 12325
177 Ga0501076_0004549 3300049592 Bacteria 9879
178 Ga0501076_0018861 3300049592 Bacteria 5264
179 Ga0501076_0210584 3300049592 Unclassified 1588
180 Ga0501077_0002244 3300049593 Bacteria 11652
181 Ga0501077_0015589 3300049593 Bacteria 4785
182 Ga0501079_0021952 3300049741 Bacteria 4889
183 Ga0501079_0025717 3300049741 Bacteria 4514
184 Ga0501079_0085299 3300049741 Bacteria 2444
185 Ga0501079_0098680 3300049741 Bacteria 2264
186 Ga0501079_0225002 3300049741 Bacteria 1466
187 Ga0501080_0086323 3300049742 Bacteria 2916
188 Ga0501080_0133535 3300049742 Bacteria 2297
189 Ga0501080_0432840 3300049742 Unclassified 1181
190 Ga0501080_0838601 3300049742 Bacteria 804
191 Ga0501081_0000139 3300049743 Bacteria 32505
192 Ga0501081_0094954 3300049743 Bacteria 2101
193 Ga0501081_0248779 3300049743 Bacteria 1297
194 Ga0501081_0370518 3300049743 Bacteria 1057
195 Ga0501083_0001352 3300049744 Bacteria 16651
196 Ga0501035_0128852 3300049822 Bacteria 2207
197 Ga0501035_0363517 3300049822 Unclassified 1209
198 Ga0501044_0001341 3300049823 Bacteria 28925
199 Ga0501045_0001980 3300049824 Bacteria 13844
200 Ga0501045_0009816 3300049824 Bacteria 6698
201 Ga0501045_0028307 3300049824 Bacteria 4041
202 Ga0501045_0037539 3300049824 Bacteria 3522
203 nmdc:mga03683_45241_c1 3300050489 Bacteria 1821
204 nmdc:mga03n38_32886_c1 3300050490 Bacteria 2201
205 nmdc:mga00v17_21741_c1 3300050491 Bacteria 3692
206 nmdc:mga00v17_45364_c1 3300050491 Unclassified 2655
207 nmdc:mga00v17_53745_c1 3300050491 Bacteria 2456
208 nmdc:mga00v17_78327_c1 3300050491 Bacteria 2059
209 nmdc:mga0yw44_29187_c1 3300050492 Unclassified 3182
210 nmdc:mga0yw44_41647_c1 3300050492 Bacteria 2735
211 nmdc:mga0yw44_42164_c1 3300050492 Bacteria 2720
212 nmdc:mga06z11_50676_c1 3300050494 Bacteria 2123
213 nmdc:mga05p37_139093_c1 3300050507 Bacteria 2975
214 nmdc:mga05p37_260183_c1 3300050507 Bacteria 2077
215 nmdc:mga05p37_279693_c1 3300050507 Bacteria 1991
216 nmdc:mga05p37_399232_c1 3300050507 Bacteria 1606
217 nmdc:mga09592_282042_c1 3300050508 Bacteria 1441
218 nmdc:mga09592_45250_c1 3300050508 Bacteria 3707
219 nmdc:mga0qj67_149843_c1 3300050509 Bacteria 1892
220 nmdc:mga0qj67_163316_c1 3300050509 Bacteria 1808
221 nmdc:mga06r32_293067_c1 3300050510 Bacteria 1614
222 nmdc:mga06r32_419795_c1 3300050510 Bacteria 1319
223 nmdc:mga06r32_77634_c1 3300050510 Bacteria 3227
224 nmdc:mga0n895_172948_c1 3300050512 Bacteria 2192
225 nmdc:mga0n895_64580_c1 3300050512 Bacteria 3621
226 nmdc:mga0n895_73663_c1 3300050512 Bacteria 3391
227 nmdc:mga0rr50_136599_c1 3300050513 Bacteria 1969
228 nmdc:mga0rr50_30902_c1 3300050513 Bacteria 3797
229 nmdc:mga0rr50_40545_c2 3300050513 Bacteria 2579
230 nmdc:mga0rr50_68516_c1 3300050513 Bacteria 2699
231 nmdc:mga08x19_200612_c1 3300050514 Bacteria 1367
232 nmdc:mga08x19_249254_c1 3300050514 Bacteria 1226
233 nmdc:mga08x19_8632_c1 3300050514 Bacteria 6073
234 nmdc:mga0a205_341100_c1 3300050515 Bacteria 1367
235 nmdc:mga0a205_73112_c1 3300050515 Bacteria 3313
236 nmdc:mga0a205_77575_c1 3300050515 Bacteria 3210
237 nmdc:mga0sz30_24648_c1 3300050516 Bacteria 2456
238 Ga0495619_0073138 3300053085 Unclassified 2297
239 Ga0500566_0007438 3300053094 Bacteria 6490
240 Ga0500616_0000315 3300053153 Bacteria 69443
241 Ga0500616_0001980 3300053153 Bacteria 18206
242 Ga0501084_0000058 3300054114 Bacteria 87566
243 Ga0501084_0007124 3300054114 Bacteria 9213
244 Ga0501084_0014700 3300054114 Bacteria 6492
245 Ga0501084_0033488 3300054114 Bacteria 4298
246 Ga0501084_0099653 3300054114 Bacteria 2440
247 Ga0587085_020679 3300059506 Bacteria 998
248 Ga0501082_0003597 3300060353 Bacteria 13539
249 Ga0501082_0005270 3300060353 Bacteria 11236
250 Ga0501082_0022024 3300060353 Bacteria 5495
251 Ga0501082_0428883 3300060353 Bacteria 1155
252 Ga0530510_0000915 3300061734 Bacteria 19464
253 Ga0530510_0002127 3300061734 Bacteria 13574
254 Ga0530510_0004745 3300061734 Bacteria 9411
255 Ga0530510_0006075 3300061734 Bacteria 8386
256 Ga0530510_0073413 3300061734 Bacteria 2483
257 Ga0530510_0119954 3300061734 Bacteria 1930
258 Ga0530510_0640618 3300061734 Bacteria 809
259 nmdc:mga03683_51975_c1
260 JGI25405J52794_10025985
261 Ga0070680_100035559
262 Ga0070682_100182824
263 Ga0070682_100238644
264 Ga0068868_100540365
265 Ga0070691_10187698
266 Ga0070671_100012005
267 Ga0070671_100015246
268 Ga0070705_100150512
269 Ga0070694_100016372
270 Ga0070694_100283818
271 Ga0070708_100003977
272 Ga0070708_100007333
273 Ga0070708_100508169
274 Ga0070681_10258937
275 Ga0070706_100016727
276 Ga0070706_100027566
277 Ga0070706_100185216
278 Ga0070707_100029549
279 Ga0070707_100303709
280 Ga0070698_100016448
281 Ga0070699_100383114
282 Ga0070697_100013162
283 Ga0070695_100032180
284 Ga0070704_100007046
285 Ga0070704_100041381
286 Ga0068859_100580140
287 Ga0068861_100140775
288 Ga0068858_100011799
289 Ga0068858_100085539
290 Ga0068860_100062814
291 Ga0068860_100176280
292 Ga0068860_100176931
293 Ga0068860_100231156
294 Ga0068862_100123268
295 Ga0081455_10001211
296 Ga0081455_10006278
297 Ga0075365_10006582
298 Ga0075365_10007389
299 Ga0075363_100002349
300 Ga0075364_10004829
301 Ga0075364_10040537
302 Ga0075364_10097254
303 Ga0075364_10125154
304 Ga0075362_10010025
305 Ga0075362_10053795
306 Ga0075367_10030955
307 Ga0075369_10033035
308 Ga0068871_100347633
309 Ga0075428_100119641
310 Ga0075428_100468435
311 Ga0075430_100008690
312 Ga0075430_100020721
313 Ga0075430_100179572
314 Ga0075431_100071808
315 Ga0075431_100610118
316 Ga0075433_10057311
317 Ga0075433_10250337
318 Ga0075434_100076598
319 Ga0075434_100145988
320 Ga0075434_100226844
321 Ga0075434_100291783
322 Ga0075429_100056232
323 Ga0097620_100580114
324 Ga0075435_100029063
325 Ga0111539_10060775
326 Ga0105245_10248323
327 Ga0105245_10340902
328 Ga0114129_10141058
329 Ga0114129_10184135
330 Ga0114129_10301722
331 Ga0114129_10572611
332 Ga0157374_10734855
333 Ga0163162_10326052
334 Ga0157375_10143463
335 Ga0157375_11457969
336 Ga0163163_10026305
337 Ga0157379_10047805
338 Ga0207684_10121861
339 Ga0207684_10202875
340 Ga0207684_10320408
341 Ga0207707_10098862
342 Ga0207646_10004845
343 Ga0207681_10264091
344 Ga0207687_10223608
345 Ga0207644_10023420
346 Ga0207644_10055245
347 Ga0207689_10278122
348 Ga0207668_10022610
349 Ga0207677_10301117
350 Ga0207677_10469979
351 Ga0207703_10007940
352 Ga0207678_10429861
353 Ga0207641_10286093
354 Ga0207675_100018880
355 Ga0207675_101490523
356 Ga0207683_10126205
357 Ga0209588_1028404
358 Ga0268265_10204670
359 Ga0268264_10054131
360 Ga0268264_10081966
361 Ga0307407_10357374
362 Ga0307411_10335103
363 Ga0307415_100464329
364 Ga0373930_0036259
365 Ga0373948_0008817
366 Ga0373938_0078096
367 Ga0373928_0000344
368 Ga0373949_0012738
369 Ga0373932_0009819
370 Ga0373931_0000003
371 Ga0373931_0000056
372 Ga0373925_0114192
373 Ga0436365_0136871
374 Ga0439443_019016
375 Ga0439448_0025850
376 Ga0439450_024744
377 Ga0439463_008250
378 Ga0439464_0038380
379 Ga0451577_0001623
380 Ga0453683_0033915
381 Ga0453683_0166757
382 Ga0453684_0037432
383 Ga0466967_0303456
384 Ga0495653_0070418
385 Ga0495653_0104411
386 Ga0495639_0077188
387 Ga0495640_0168770
388 Ga0495680_0088741
389 Ga0496102_0005201
390 Ga0496108_0019142
391 Ga0496109_0030737
392 Ga0496110_0010637
393 Ga0496111_0040290
394 Ga0496111_0150676
395 Ga0496114_0048855
396 Ga0496114_0554426
397 Ga0501031_0026574
398 Ga0501031_0106505
399 Ga0501033_0026983
400 Ga0501033_0038782
401 Ga0501034_0006104
402 Ga0501034_0045836
403 Ga0501034_0050324
404 Ga0501036_0304888
405 Ga0501037_0124149
406 Ga0501037_0317649
407 Ga0501039_0029908
408 Ga0501039_0183528
409 Ga0501040_0002294
410 Ga0501040_0105317
411 Ga0501041_0006495
412 Ga0501041_0028744
413 Ga0501041_0189486
414 Ga0501042_0011037
415 Ga0501042_0055505
416 Ga0501043_0134147
417 Ga0501047_0072008
418 Ga0501048_0043877
419 Ga0501069_0000754
420 Ga0501069_0152169
421 Ga0501070_0016222
422 Ga0501071_0009541
423 Ga0501071_0180271
424 Ga0501072_0019852
425 Ga0501073_0000404
426 Ga0501074_0016605
427 Ga0501074_0081295
428 Ga0501074_0313852
429 Ga0501075_0019270
430 Ga0501075_0020878
431 Ga0501075_0028149
432 Ga0501075_0083629
433 Ga0501075_0248400
434 Ga0501076_0002662
435 Ga0501076_0004549
436 Ga0501076_0018861
437 Ga0501076_0210584
438 Ga0501077_0002244
439 Ga0501077_0015589
440 Ga0501079_0021952
441 Ga0501079_0025717
442 Ga0501079_0085299
443 Ga0501079_0098680
444 Ga0501079_0225002
445 Ga0501080_0086323
446 Ga0501080_0133535
447 Ga0501080_0432840
448 Ga0501080_0838601
449 Ga0501081_0000139
450 Ga0501081_0094954
451 Ga0501081_0248779
452 Ga0501081_0370518
453 Ga0501083_0001352
454 Ga0501035_0128852
455 Ga0501035_0363517
456 Ga0501044_0001341
457 Ga0501045_0001980
458 Ga0501045_0009816
459 Ga0501045_0028307
460 Ga0501045_0037539
461 nmdc:mga03683_45241_c1
462 nmdc:mga03n38_32886_c1
463 nmdc:mga00v17_21741_c1
464 nmdc:mga00v17_45364_c1
465 nmdc:mga00v17_53745_c1
466 nmdc:mga00v17_78327_c1
467 nmdc:mga0yw44_29187_c1
468 nmdc:mga0yw44_41647_c1
469 nmdc:mga0yw44_42164_c1
470 nmdc:mga06z11_50676_c1
471 nmdc:mga05p37_139093_c1
472 nmdc:mga05p37_260183_c1
473 nmdc:mga05p37_279693_c1
474 nmdc:mga05p37_399232_c1
475 nmdc:mga09592_282042_c1
476 nmdc:mga09592_45250_c1
477 nmdc:mga0qj67_149843_c1
478 nmdc:mga0qj67_163316_c1
479 nmdc:mga06r32_293067_c1
480 nmdc:mga06r32_419795_c1
481 nmdc:mga06r32_77634_c1
482 nmdc:mga0n895_172948_c1
483 nmdc:mga0n895_64580_c1
484 nmdc:mga0n895_73663_c1
485 nmdc:mga0rr50_136599_c1
486 nmdc:mga0rr50_30902_c1
487 nmdc:mga0rr50_40545_c2
488 nmdc:mga0rr50_68516_c1
489 nmdc:mga08x19_200612_c1
490 nmdc:mga08x19_249254_c1
491 nmdc:mga08x19_8632_c1
492 nmdc:mga0a205_341100_c1
493 nmdc:mga0a205_73112_c1
494 nmdc:mga0a205_77575_c1
495 nmdc:mga0sz30_24648_c1
496 Ga0495619_0073138
497 Ga0500566_0007438
498 Ga0500616_0000315
499 Ga0500616_0001980
500 Ga0501084_0000058
501 Ga0501084_0007124
502 Ga0501084_0014700
503 Ga0501084_0033488
504 Ga0501084_0099653
505 Ga0587085_020679
506 Ga0501082_0003597
507 Ga0501082_0005270
508 Ga0501082_0022024
509 Ga0501082_0428883
510 Ga0530510_0000915
511 Ga0530510_0002127
512 Ga0530510_0004745
513 Ga0530510_0006075
514 Ga0530510_0073413
515 Ga0530510_0119954
516 Ga0530510_0640618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

111

232

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3frs-assembly1.cif.gz_A-2 structure of human ist1(ntd) (residues 1-189)(p43212) 0.4537 95 242
6e8g-assembly1.cif.gz_S cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.4341 95 235
4ntj-assembly1.cif.gz_A structure of the human p2y12 receptor in complex with an antithrombotic drug 0.3844 95 241
5nen-assembly1.cif.gz_B crystal structure of the soluble domain of lipc, a membrane fusion protein of a type i secretion system 0.369 11 232
2rfq-assembly1.cif.gz_D crystal structure of 3-hsa hydroxylase from rhodococcus sp. rha1 0.3685 63 233
ID Description Score Start End Superfamily
af_D4A8Z3_354_540_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5635 17 200 1.20.120.1770
af_F1Q9X5_1_304_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.544 82 236 1.20.1070.10
af_Q8TDN1_193_353_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4923 16 171 1.20.120.350
af_D4A8Z3_354_540_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4913 17 200 1.20.120.1770
af_A0A486WXC8_744_938_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4903 10 205 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A3B9AH75-F1-model_v4 Antitermination protein NusG 0.9724 14 83 GO:0016020
AF-A0A2V9NB98-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9562 9 85 GO:0016020
AF-A0A538JPW9-F1-model_v4 Antitermination protein NusG 0.9455 11 242 GO:0016020
AF-A0A2N5JW88-F1-model_v4 deleted 0.9448 9 242
AF-A0A533X3W3-F1-model_v4 Copper-binding protein 0.943 15 89 GO:0016020

Map