F368382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 137 | 516 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0153892|Ga0496112_0153892_460_1068 |
| Length | 202 |
| Sequence | MRVSDLSPGSVELLLQGRLGRPYRFVEECTSTQRLLDADEHEGTTVATDHQTRGRGRLGRVWEAPPGRGLLFSVLLRPSPPMALWPELSLVAGDAVAAALHAKTGIAAELSHPNDVLVEGRKVAGILPEASAGRVVLGIGVNVDQTVEELPADTPKPATSLRNETGREWPRAPLLAAILLELELRYDDWQRLHTNRRGPAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 41 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 60 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 61 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 62 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 63 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 64 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 65 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 66 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 67 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 68 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 69 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 70 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 71 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 72 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 73 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 74 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 75 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 76 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 77 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 78 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 79 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 80 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 81 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 113 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 114 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 115 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 116 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 117 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 122 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.02 |
| Rhizosphere | 87.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0153892 | 3300048915 | Bacteria | 2267 |
| 2 | rootH1_10235143 | 3300003323 | Bacteria | 1509 |
| 3 | Ga0070683_100098993 | 3300005329 | Bacteria | 2744 |
| 4 | Ga0070680_100071793 | 3300005336 | Bacteria | 2845 |
| 5 | Ga0070680_100144597 | 3300005336 | Bacteria | 1995 |
| 6 | Ga0070680_100187495 | 3300005336 | Bacteria | 1743 |
| 7 | Ga0070682_100174946 | 3300005337 | Bacteria | 1494 |
| 8 | Ga0070660_100085622 | 3300005339 | Bacteria | 2479 |
| 9 | Ga0070691_10059915 | 3300005341 | Unclassified | 1829 |
| 10 | Ga0070692_10132304 | 3300005345 | Bacteria | 1403 |
| 11 | Ga0070709_10229916 | 3300005434 | Bacteria | 1326 |
| 12 | Ga0070714_100001730 | 3300005435 | Bacteria | 15912 |
| 13 | Ga0070714_100508474 | 3300005435 | Unclassified | 1149 |
| 14 | Ga0070714_100564096 | 3300005435 | Bacteria | 1091 |
| 15 | Ga0070713_100029682 | 3300005436 | Bacteria | 4333 |
| 16 | Ga0070713_100316899 | 3300005436 | Bacteria | 1439 |
| 17 | Ga0070710_10008746 | 3300005437 | Bacteria | 4938 |
| 18 | Ga0070710_10137054 | 3300005437 | Bacteria | 1497 |
| 19 | Ga0070711_100021022 | 3300005439 | Bacteria | 4215 |
| 20 | Ga0070711_100032777 | 3300005439 | Bacteria | 3457 |
| 21 | Ga0070711_100550090 | 3300005439 | Unclassified | 957 |
| 22 | Ga0070711_100644690 | 3300005439 | Bacteria | 887 |
| 23 | Ga0070694_100043187 | 3300005444 | Bacteria | 3014 |
| 24 | Ga0070708_100447259 | 3300005445 | Unclassified | 1219 |
| 25 | Ga0070681_10027297 | 3300005458 | Bacteria | 5739 |
| 26 | Ga0070681_10093108 | 3300005458 | Bacteria | 2962 |
| 27 | Ga0070681_10236255 | 3300005458 | Bacteria | 1742 |
| 28 | Ga0070706_100521256 | 3300005467 | Bacteria | 1106 |
| 29 | Ga0070707_100001128 | 3300005468 | Bacteria | 26352 |
| 30 | Ga0070679_100051987 | 3300005530 | Bacteria | 4082 |
| 31 | Ga0070679_100065672 | 3300005530 | Bacteria | 3616 |
| 32 | Ga0070679_100343522 | 3300005530 | Unclassified | 1441 |
| 33 | Ga0070695_100000029 | 3300005545 | Bacteria | 53859 |
| 34 | Ga0070693_100437864 | 3300005547 | Bacteria | 915 |
| 35 | Ga0068855_100062367 | 3300005563 | Bacteria | 4352 |
| 36 | Ga0070664_100088058 | 3300005564 | Bacteria | 2685 |
| 37 | Ga0068856_100098363 | 3300005614 | Bacteria | 2916 |
| 38 | Ga0068856_101719359 | 3300005614 | Bacteria | 640 |
| 39 | Ga0070717_10029414 | 3300006028 | Bacteria | 4407 |
| 40 | Ga0070717_10031104 | 3300006028 | Bacteria | 4292 |
| 41 | Ga0070717_10619932 | 3300006028 | Bacteria | 981 |
| 42 | Ga0070716_100041828 | 3300006173 | Bacteria | 2555 |
| 43 | Ga0070712_100087058 | 3300006175 | Bacteria | 2278 |
| 44 | Ga0070712_100384236 | 3300006175 | Bacteria | 1156 |
| 45 | Ga0070712_100583776 | 3300006175 | Bacteria | 944 |
| 46 | Ga0075433_10175377 | 3300006852 | Unclassified | 1908 |
| 47 | Ga0075435_100325860 | 3300007076 | Unclassified | 1315 |
| 48 | Ga0105240_10010108 | 3300009093 | Bacteria | 13279 |
| 49 | Ga0105240_10352124 | 3300009093 | Bacteria | 1670 |
| 50 | Ga0105237_10679555 | 3300009545 | Bacteria | 1036 |
| 51 | Ga0105238_10093907 | 3300009551 | Bacteria | 2988 |
| 52 | Ga0105239_11644923 | 3300010375 | Bacteria | 743 |
| 53 | Ga0105246_10392911 | 3300011119 | Unclassified | 1150 |
| 54 | Ga0157370_10088032 | 3300013104 | Bacteria | 2916 |
| 55 | Ga0157370_10143970 | 3300013104 | Bacteria | 2220 |
| 56 | Ga0157369_10033465 | 3300013105 | Bacteria | 5648 |
| 57 | Ga0157369_10693924 | 3300013105 | Bacteria | 1048 |
| 58 | Ga0157374_10118647 | 3300013296 | Bacteria | 2551 |
| 59 | Ga0157372_10007615 | 3300013307 | Bacteria | 11515 |
| 60 | Ga0157372_10218579 | 3300013307 | Bacteria | 2209 |
| 61 | Ga0157375_11906819 | 3300013308 | Unclassified | 705 |
| 62 | Ga0182008_10025785 | 3300014497 | Bacteria | 2985 |
| 63 | Ga0182008_10318810 | 3300014497 | Unclassified | 817 |
| 64 | Ga0207692_10035846 | 3300025898 | Bacteria | 2413 |
| 65 | Ga0207692_10067860 | 3300025898 | Bacteria | 1868 |
| 66 | Ga0207685_10009934 | 3300025905 | Bacteria | 2786 |
| 67 | Ga0207685_10191661 | 3300025905 | Bacteria | 955 |
| 68 | Ga0207705_10009302 | 3300025909 | Bacteria | 7146 |
| 69 | Ga0207707_10149644 | 3300025912 | Bacteria | 2041 |
| 70 | Ga0207707_10795597 | 3300025912 | Bacteria | 788 |
| 71 | Ga0207695_10640514 | 3300025913 | Bacteria | 944 |
| 72 | Ga0207693_10020457 | 3300025915 | Bacteria | 5264 |
| 73 | Ga0207693_10403482 | 3300025915 | Bacteria | 1069 |
| 74 | Ga0207663_10137913 | 3300025916 | Bacteria | 1695 |
| 75 | Ga0207660_10098505 | 3300025917 | Unclassified | 2181 |
| 76 | Ga0207660_10304188 | 3300025917 | Bacteria | 1270 |
| 77 | Ga0207649_10113448 | 3300025920 | Unclassified | 1815 |
| 78 | Ga0207652_10119434 | 3300025921 | Bacteria | 2344 |
| 79 | Ga0207652_10143944 | 3300025921 | Bacteria | 2132 |
| 80 | Ga0207646_10003943 | 3300025922 | Bacteria | 16459 |
| 81 | Ga0207700_10060095 | 3300025928 | Bacteria | 2877 |
| 82 | Ga0207700_10210800 | 3300025928 | Bacteria | 1642 |
| 83 | Ga0207664_10069571 | 3300025929 | Bacteria | 2830 |
| 84 | Ga0207664_10141877 | 3300025929 | Bacteria | 2033 |
| 85 | Ga0207664_10343397 | 3300025929 | Unclassified | 1320 |
| 86 | Ga0207664_10454281 | 3300025929 | Bacteria | 1144 |
| 87 | Ga0207665_10211145 | 3300025939 | Bacteria | 1418 |
| 88 | Ga0207667_10332438 | 3300025949 | Bacteria | 1551 |
| 89 | Ga0207678_10605088 | 3300026067 | Bacteria | 961 |
| 90 | Ga0207702_10223178 | 3300026078 | Bacteria | 1757 |
| 91 | Ga0207702_10714101 | 3300026078 | Bacteria | 988 |
| 92 | Ga0207641_10039645 | 3300026088 | Bacteria | 3941 |
| 93 | Ga0207428_10253794 | 3300027907 | Bacteria | 1311 |
| 94 | Ga0316583_10029025 | 3300032133 | Bacteria | 1973 |
| 95 | Ga0373943_0132772 | 3300035170 | Unclassified | 1334 |
| 96 | Ga0373924_0234266 | 3300035410 | Bacteria | 812 |
| 97 | Ga0395899_0019902 | 3300037312 | Bacteria | 5092 |
| 98 | Ga0395900_0026133 | 3300037418 | Bacteria | 5978 |
| 99 | Ga0395900_0180783 | 3300037418 | Bacteria | 2143 |
| 100 | Ga0395898_0000824 | 3300037466 | Bacteria | 51781 |
| 101 | Ga0395898_0018968 | 3300037466 | Bacteria | 7008 |
| 102 | Ga0395901_0001584 | 3300038443 | Bacteria | 23533 |
| 103 | Ga0395901_0054876 | 3300038443 | Bacteria | 4142 |
| 104 | Ga0436363_1633358 | 3300039450 | Bacteria | 2287 |
| 105 | Ga0466969_0004821 | 3300044656 | Bacteria | 7183 |
| 106 | Ga0466969_0088694 | 3300044656 | Bacteria | 1468 |
| 107 | Ga0466972_0029731 | 3300044658 | Bacteria | 2690 |
| 108 | Ga0466966_0112405 | 3300044684 | Unclassified | 1678 |
| 109 | Ga0466966_0280825 | 3300044684 | Bacteria | 1002 |
| 110 | Ga0466961_0012817 | 3300044693 | Bacteria | 5366 |
| 111 | Ga0466961_0022246 | 3300044693 | Bacteria | 4079 |
| 112 | Ga0466961_0131055 | 3300044693 | Unclassified | 1571 |
| 113 | Ga0466961_0138107 | 3300044693 | Bacteria | 1527 |
| 114 | Ga0466963_0002189 | 3300044694 | Bacteria | 10808 |
| 115 | Ga0466963_0005777 | 3300044694 | Bacteria | 7278 |
| 116 | Ga0466963_0007093 | 3300044694 | Bacteria | 6673 |
| 117 | Ga0466963_0008092 | 3300044694 | Bacteria | 6295 |
| 118 | Ga0466963_0012284 | 3300044694 | Bacteria | 5237 |
| 119 | Ga0466963_0058287 | 3300044694 | Bacteria | 2574 |
| 120 | Ga0466963_0111807 | 3300044694 | Unclassified | 1875 |
| 121 | Ga0466963_0144464 | 3300044694 | Unclassified | 1650 |
| 122 | Ga0466963_0297611 | 3300044694 | Bacteria | 1134 |
| 123 | Ga0466963_0365466 | 3300044694 | Bacteria | 1016 |
| 124 | Ga0466963_0428222 | 3300044694 | Bacteria | 933 |
| 125 | Ga0466963_0560427 | 3300044694 | Unclassified | 807 |
| 126 | Ga0466964_0022038 | 3300044706 | Bacteria | 2468 |
| 127 | Ga0466964_0038264 | 3300044706 | Bacteria | 1928 |
| 128 | Ga0466964_0039476 | 3300044706 | Bacteria | 1902 |
| 129 | Ga0466964_0041602 | 3300044706 | Unclassified | 1859 |
| 130 | Ga0466964_0101646 | 3300044706 | Unclassified | 1268 |
| 131 | Ga0466964_0150482 | 3300044706 | Unclassified | 1078 |
| 132 | Ga0466964_0339399 | 3300044706 | Unclassified | 769 |
| 133 | Ga0466971_0000170 | 3300044719 | Bacteria | 24398 |
| 134 | Ga0466971_0061243 | 3300044719 | Bacteria | 1701 |
| 135 | Ga0466971_0106625 | 3300044719 | Bacteria | 1291 |
| 136 | Ga0466971_0146472 | 3300044719 | Unclassified | 1101 |
| 137 | Ga0466968_0001006 | 3300044735 | Bacteria | 9928 |
| 138 | Ga0466968_0019982 | 3300044735 | Bacteria | 2700 |
| 139 | Ga0466968_0021702 | 3300044735 | Bacteria | 2602 |
| 140 | Ga0466968_0122103 | 3300044735 | Unclassified | 1179 |
| 141 | Ga0466968_0131485 | 3300044735 | Bacteria | 1139 |
| 142 | Ga0466970_0000806 | 3300044765 | Bacteria | 15112 |
| 143 | Ga0466970_0020042 | 3300044765 | Bacteria | 3471 |
| 144 | Ga0466970_0174156 | 3300044765 | Unclassified | 1193 |
| 145 | Ga0466957_0000671 | 3300044842 | Bacteria | 17426 |
| 146 | Ga0466957_0003280 | 3300044842 | Bacteria | 8862 |
| 147 | Ga0466957_0009740 | 3300044842 | Bacteria | 5488 |
| 148 | Ga0466957_0016682 | 3300044842 | Bacteria | 4296 |
| 149 | Ga0466957_0030148 | 3300044842 | Bacteria | 3238 |
| 150 | Ga0466957_0045424 | 3300044842 | Bacteria | 2664 |
| 151 | Ga0466959_0003637 | 3300045049 | Bacteria | 10171 |
| 152 | Ga0466959_0005938 | 3300045049 | Bacteria | 8416 |
| 153 | Ga0466959_0393081 | 3300045049 | Unclassified | 943 |
| 154 | Ga0466958_0001062 | 3300045836 | Bacteria | 12591 |
| 155 | Ga0466958_0006904 | 3300045836 | Bacteria | 6208 |
| 156 | Ga0466958_0021115 | 3300045836 | Bacteria | 3801 |
| 157 | Ga0466958_0022617 | 3300045836 | Bacteria | 3684 |
| 158 | Ga0466958_0121300 | 3300045836 | Unclassified | 1637 |
| 159 | Ga0466958_0236030 | 3300045836 | Unclassified | 1168 |
| 160 | Ga0466967_0000828 | 3300045976 | Bacteria | 16293 |
| 161 | Ga0466967_0002114 | 3300045976 | Bacteria | 12193 |
| 162 | Ga0466967_0002908 | 3300045976 | Bacteria | 10915 |
| 163 | Ga0466967_0009149 | 3300045976 | Bacteria | 7328 |
| 164 | Ga0466967_0012395 | 3300045976 | Bacteria | 6517 |
| 165 | Ga0466967_0030291 | 3300045976 | Bacteria | 4539 |
| 166 | Ga0466967_0049251 | 3300045976 | Bacteria | 3683 |
| 167 | Ga0466967_0081515 | 3300045976 | Bacteria | 2922 |
| 168 | Ga0466967_0107460 | 3300045976 | Bacteria | 2559 |
| 169 | Ga0466967_0156180 | 3300045976 | Bacteria | 2137 |
| 170 | Ga0466967_0166516 | 3300045976 | Bacteria | 2071 |
| 171 | Ga0466967_0184316 | 3300045976 | Bacteria | 1970 |
| 172 | Ga0466967_0261866 | 3300045976 | Bacteria | 1654 |
| 173 | Ga0466967_0298174 | 3300045976 | Bacteria | 1550 |
| 174 | Ga0466967_0335346 | 3300045976 | Bacteria | 1461 |
| 175 | Ga0466967_0465976 | 3300045976 | Unclassified | 1236 |
| 176 | Ga0466967_0492975 | 3300045976 | Unclassified | 1201 |
| 177 | Ga0466967_0634757 | 3300045976 | Unclassified | 1055 |
| 178 | Ga0495592_0183447 | 3300046454 | Bacteria | 1424 |
| 179 | Ga0495603_0093858 | 3300046455 | Bacteria | 1753 |
| 180 | Ga0495641_0074862 | 3300046461 | Bacteria | 1518 |
| 181 | Ga0495582_0034301 | 3300046473 | Bacteria | 2790 |
| 182 | Ga0495582_0249511 | 3300046473 | Bacteria | 1018 |
| 183 | Ga0495662_0211491 | 3300046476 | Unclassified | 956 |
| 184 | Ga0495664_0549639 | 3300046477 | Bacteria | 688 |
| 185 | Ga0495594_0440169 | 3300046499 | Bacteria | 741 |
| 186 | Ga0495607_0068706 | 3300046501 | Bacteria | 1986 |
| 187 | Ga0495618_0388859 | 3300046514 | Bacteria | 855 |
| 188 | Ga0495628_0041826 | 3300046516 | Bacteria | 3657 |
| 189 | Ga0495630_0052803 | 3300046517 | Bacteria | 3043 |
| 190 | Ga0495644_0021570 | 3300046523 | Bacteria | 2457 |
| 191 | Ga0495642_0245716 | 3300046528 | Unclassified | 782 |
| 192 | Ga0495652_0213596 | 3300046529 | Bacteria | 1454 |
| 193 | Ga0495587_0187499 | 3300046536 | Unclassified | 1172 |
| 194 | Ga0495621_0125625 | 3300046539 | Bacteria | 995 |
| 195 | Ga0495645_0238216 | 3300046543 | Bacteria | 1215 |
| 196 | Ga0495656_0005449 | 3300046615 | Bacteria | 4394 |
| 197 | Ga0495634_0217298 | 3300046642 | Bacteria | 1181 |
| 198 | Ga0495646_0023000 | 3300046680 | Bacteria | 3925 |
| 199 | Ga0495624_0028902 | 3300046690 | Bacteria | 3618 |
| 200 | Ga0495589_0199342 | 3300046794 | Bacteria | 945 |
| 201 | Ga0495604_0052634 | 3300047317 | Bacteria | 3151 |
| 202 | Ga0495636_0173301 | 3300047318 | Bacteria | 976 |
| 203 | Ga0495674_0315196 | 3300047319 | Bacteria | 1275 |
| 204 | Ga0495676_0103099 | 3300047321 | Bacteria | 2107 |
| 205 | Ga0495676_0187184 | 3300047321 | Bacteria | 1446 |
| 206 | Ga0495675_0332192 | 3300047444 | Bacteria | 897 |
| 207 | Ga0495677_0111908 | 3300047445 | Bacteria | 1038 |
| 208 | Ga0495602_0457779 | 3300048088 | Bacteria | 899 |
| 209 | Ga0496100_0404798 | 3300048903 | Unclassified | 1040 |
| 210 | Ga0496100_0548197 | 3300048903 | Bacteria | 894 |
| 211 | Ga0496101_0112730 | 3300048904 | Bacteria | 2049 |
| 212 | Ga0496101_0115049 | 3300048904 | Bacteria | 2028 |
| 213 | Ga0496101_0664690 | 3300048904 | Bacteria | 823 |
| 214 | Ga0496102_0008078 | 3300048905 | Bacteria | 9002 |
| 215 | Ga0496103_0006222 | 3300048906 | Bacteria | 7132 |
| 216 | Ga0496104_0014077 | 3300048907 | Bacteria | 7220 |
| 217 | Ga0496104_0032821 | 3300048907 | Bacteria | 4832 |
| 218 | Ga0496104_0332515 | 3300048907 | Bacteria | 1432 |
| 219 | Ga0496105_0175530 | 3300048908 | Bacteria | 1755 |
| 220 | Ga0496105_0482116 | 3300048908 | Bacteria | 975 |
| 221 | Ga0496106_0181601 | 3300048909 | Bacteria | 1670 |
| 222 | Ga0496106_0230822 | 3300048909 | Bacteria | 1478 |
| 223 | Ga0496106_0757712 | 3300048909 | Bacteria | 772 |
| 224 | Ga0496107_0207876 | 3300048910 | Bacteria | 1455 |
| 225 | Ga0496107_0254202 | 3300048910 | Bacteria | 1307 |
| 226 | Ga0496108_0153510 | 3300048911 | Bacteria | 1987 |
| 227 | Ga0496109_0049496 | 3300048912 | Bacteria | 3825 |
| 228 | Ga0496109_0051890 | 3300048912 | Bacteria | 3736 |
| 229 | Ga0496109_0747782 | 3300048912 | Bacteria | 915 |
| 230 | Ga0496110_0014622 | 3300048913 | Bacteria | 6521 |
| 231 | Ga0496112_0074888 | 3300048915 | Bacteria | 3348 |
| 232 | Ga0496112_0759364 | 3300048915 | Bacteria | 896 |
| 233 | Ga0496113_0120284 | 3300048916 | Bacteria | 2052 |
| 234 | Ga0496113_0426751 | 3300048916 | Bacteria | 1065 |
| 235 | Ga0496114_0008459 | 3300048917 | Bacteria | 8154 |
| 236 | Ga0496114_0407668 | 3300048917 | Bacteria | 1204 |
| 237 | Ga0496115_0040946 | 3300048918 | Bacteria | 3684 |
| 238 | Ga0496115_0081726 | 3300048918 | Bacteria | 2631 |
| 239 | Ga0501047_0025509 | 3300049581 | Bacteria | 5682 |
| 240 | Ga0501067_0171314 | 3300049583 | Bacteria | 1209 |
| 241 | Ga0501069_0117229 | 3300049585 | Bacteria | 1519 |
| 242 | Ga0501070_0008627 | 3300049586 | Bacteria | 8617 |
| 243 | Ga0501070_0147141 | 3300049586 | Bacteria | 1944 |
| 244 | Ga0501070_0255532 | 3300049586 | Unclassified | 1433 |
| 245 | Ga0501070_1039149 | 3300049586 | Unclassified | 634 |
| 246 | Ga0501074_0009427 | 3300049590 | Bacteria | 7090 |
| 247 | Ga0501079_0124448 | 3300049741 | Bacteria | 2006 |
| 248 | Ga0501080_0016173 | 3300049742 | Bacteria | 6887 |
| 249 | Ga0501044_0548451 | 3300049823 | Bacteria | 1053 |
| 250 | nmdc:mga0n895_469_c1 | 3300050512 | Bacteria | 27118 |
| 251 | nmdc:mga0rr50_85581_c1 | 3300050513 | Unclassified | 2443 |
| 252 | nmdc:mga0a205_28421_c2 | 3300050515 | Unclassified | 2062 |
| 253 | Ga0495601_0090028 | 3300053077 | Bacteria | 1973 |
| 254 | Ga0495601_0132427 | 3300053077 | Bacteria | 1624 |
| 255 | Ga0495601_0199287 | 3300053077 | Bacteria | 1308 |
| 256 | Ga0495612_0047393 | 3300053078 | Bacteria | 1761 |
| 257 | Ga0466962_0017357 | 3300061719 | Bacteria | 3465 |
| 258 | Ga0466962_0145970 | 3300061719 | Unclassified | 1147 |
| 259 | Ga0496112_0153892 | |||
| 260 | rootH1_10235143 | |||
| 261 | Ga0070683_100098993 | |||
| 262 | Ga0070680_100071793 | |||
| 263 | Ga0070680_100144597 | |||
| 264 | Ga0070680_100187495 | |||
| 265 | Ga0070682_100174946 | |||
| 266 | Ga0070660_100085622 | |||
| 267 | Ga0070691_10059915 | |||
| 268 | Ga0070692_10132304 | |||
| 269 | Ga0070709_10229916 | |||
| 270 | Ga0070714_100001730 | |||
| 271 | Ga0070714_100508474 | |||
| 272 | Ga0070714_100564096 | |||
| 273 | Ga0070713_100029682 | |||
| 274 | Ga0070713_100316899 | |||
| 275 | Ga0070710_10008746 | |||
| 276 | Ga0070710_10137054 | |||
| 277 | Ga0070711_100021022 | |||
| 278 | Ga0070711_100032777 | |||
| 279 | Ga0070711_100550090 | |||
| 280 | Ga0070711_100644690 | |||
| 281 | Ga0070694_100043187 | |||
| 282 | Ga0070708_100447259 | |||
| 283 | Ga0070681_10027297 | |||
| 284 | Ga0070681_10093108 | |||
| 285 | Ga0070681_10236255 | |||
| 286 | Ga0070706_100521256 | |||
| 287 | Ga0070707_100001128 | |||
| 288 | Ga0070679_100051987 | |||
| 289 | Ga0070679_100065672 | |||
| 290 | Ga0070679_100343522 | |||
| 291 | Ga0070695_100000029 | |||
| 292 | Ga0070693_100437864 | |||
| 293 | Ga0068855_100062367 | |||
| 294 | Ga0070664_100088058 | |||
| 295 | Ga0068856_100098363 | |||
| 296 | Ga0068856_101719359 | |||
| 297 | Ga0070717_10029414 | |||
| 298 | Ga0070717_10031104 | |||
| 299 | Ga0070717_10619932 | |||
| 300 | Ga0070716_100041828 | |||
| 301 | Ga0070712_100087058 | |||
| 302 | Ga0070712_100384236 | |||
| 303 | Ga0070712_100583776 | |||
| 304 | Ga0075433_10175377 | |||
| 305 | Ga0075435_100325860 | |||
| 306 | Ga0105240_10010108 | |||
| 307 | Ga0105240_10352124 | |||
| 308 | Ga0105237_10679555 | |||
| 309 | Ga0105238_10093907 | |||
| 310 | Ga0105239_11644923 | |||
| 311 | Ga0105246_10392911 | |||
| 312 | Ga0157370_10088032 | |||
| 313 | Ga0157370_10143970 | |||
| 314 | Ga0157369_10033465 | |||
| 315 | Ga0157369_10693924 | |||
| 316 | Ga0157374_10118647 | |||
| 317 | Ga0157372_10007615 | |||
| 318 | Ga0157372_10218579 | |||
| 319 | Ga0157375_11906819 | |||
| 320 | Ga0182008_10025785 | |||
| 321 | Ga0182008_10318810 | |||
| 322 | Ga0207692_10035846 | |||
| 323 | Ga0207692_10067860 | |||
| 324 | Ga0207685_10009934 | |||
| 325 | Ga0207685_10191661 | |||
| 326 | Ga0207705_10009302 | |||
| 327 | Ga0207707_10149644 | |||
| 328 | Ga0207707_10795597 | |||
| 329 | Ga0207695_10640514 | |||
| 330 | Ga0207693_10020457 | |||
| 331 | Ga0207693_10403482 | |||
| 332 | Ga0207663_10137913 | |||
| 333 | Ga0207660_10098505 | |||
| 334 | Ga0207660_10304188 | |||
| 335 | Ga0207649_10113448 | |||
| 336 | Ga0207652_10119434 | |||
| 337 | Ga0207652_10143944 | |||
| 338 | Ga0207646_10003943 | |||
| 339 | Ga0207700_10060095 | |||
| 340 | Ga0207700_10210800 | |||
| 341 | Ga0207664_10069571 | |||
| 342 | Ga0207664_10141877 | |||
| 343 | Ga0207664_10343397 | |||
| 344 | Ga0207664_10454281 | |||
| 345 | Ga0207665_10211145 | |||
| 346 | Ga0207667_10332438 | |||
| 347 | Ga0207678_10605088 | |||
| 348 | Ga0207702_10223178 | |||
| 349 | Ga0207702_10714101 | |||
| 350 | Ga0207641_10039645 | |||
| 351 | Ga0207428_10253794 | |||
| 352 | Ga0316583_10029025 | |||
| 353 | Ga0373943_0132772 | |||
| 354 | Ga0373924_0234266 | |||
| 355 | Ga0395899_0019902 | |||
| 356 | Ga0395900_0026133 | |||
| 357 | Ga0395900_0180783 | |||
| 358 | Ga0395898_0000824 | |||
| 359 | Ga0395898_0018968 | |||
| 360 | Ga0395901_0001584 | |||
| 361 | Ga0395901_0054876 | |||
| 362 | Ga0436363_1633358 | |||
| 363 | Ga0466969_0004821 | |||
| 364 | Ga0466969_0088694 | |||
| 365 | Ga0466972_0029731 | |||
| 366 | Ga0466966_0112405 | |||
| 367 | Ga0466966_0280825 | |||
| 368 | Ga0466961_0012817 | |||
| 369 | Ga0466961_0022246 | |||
| 370 | Ga0466961_0131055 | |||
| 371 | Ga0466961_0138107 | |||
| 372 | Ga0466963_0002189 | |||
| 373 | Ga0466963_0005777 | |||
| 374 | Ga0466963_0007093 | |||
| 375 | Ga0466963_0008092 | |||
| 376 | Ga0466963_0012284 | |||
| 377 | Ga0466963_0058287 | |||
| 378 | Ga0466963_0111807 | |||
| 379 | Ga0466963_0144464 | |||
| 380 | Ga0466963_0297611 | |||
| 381 | Ga0466963_0365466 | |||
| 382 | Ga0466963_0428222 | |||
| 383 | Ga0466963_0560427 | |||
| 384 | Ga0466964_0022038 | |||
| 385 | Ga0466964_0038264 | |||
| 386 | Ga0466964_0039476 | |||
| 387 | Ga0466964_0041602 | |||
| 388 | Ga0466964_0101646 | |||
| 389 | Ga0466964_0150482 | |||
| 390 | Ga0466964_0339399 | |||
| 391 | Ga0466971_0000170 | |||
| 392 | Ga0466971_0061243 | |||
| 393 | Ga0466971_0106625 | |||
| 394 | Ga0466971_0146472 | |||
| 395 | Ga0466968_0001006 | |||
| 396 | Ga0466968_0019982 | |||
| 397 | Ga0466968_0021702 | |||
| 398 | Ga0466968_0122103 | |||
| 399 | Ga0466968_0131485 | |||
| 400 | Ga0466970_0000806 | |||
| 401 | Ga0466970_0020042 | |||
| 402 | Ga0466970_0174156 | |||
| 403 | Ga0466957_0000671 | |||
| 404 | Ga0466957_0003280 | |||
| 405 | Ga0466957_0009740 | |||
| 406 | Ga0466957_0016682 | |||
| 407 | Ga0466957_0030148 | |||
| 408 | Ga0466957_0045424 | |||
| 409 | Ga0466959_0003637 | |||
| 410 | Ga0466959_0005938 | |||
| 411 | Ga0466959_0393081 | |||
| 412 | Ga0466958_0001062 | |||
| 413 | Ga0466958_0006904 | |||
| 414 | Ga0466958_0021115 | |||
| 415 | Ga0466958_0022617 | |||
| 416 | Ga0466958_0121300 | |||
| 417 | Ga0466958_0236030 | |||
| 418 | Ga0466967_0000828 | |||
| 419 | Ga0466967_0002114 | |||
| 420 | Ga0466967_0002908 | |||
| 421 | Ga0466967_0009149 | |||
| 422 | Ga0466967_0012395 | |||
| 423 | Ga0466967_0030291 | |||
| 424 | Ga0466967_0049251 | |||
| 425 | Ga0466967_0081515 | |||
| 426 | Ga0466967_0107460 | |||
| 427 | Ga0466967_0156180 | |||
| 428 | Ga0466967_0166516 | |||
| 429 | Ga0466967_0184316 | |||
| 430 | Ga0466967_0261866 | |||
| 431 | Ga0466967_0298174 | |||
| 432 | Ga0466967_0335346 | |||
| 433 | Ga0466967_0465976 | |||
| 434 | Ga0466967_0492975 | |||
| 435 | Ga0466967_0634757 | |||
| 436 | Ga0495592_0183447 | |||
| 437 | Ga0495603_0093858 | |||
| 438 | Ga0495641_0074862 | |||
| 439 | Ga0495582_0034301 | |||
| 440 | Ga0495582_0249511 | |||
| 441 | Ga0495662_0211491 | |||
| 442 | Ga0495664_0549639 | |||
| 443 | Ga0495594_0440169 | |||
| 444 | Ga0495607_0068706 | |||
| 445 | Ga0495618_0388859 | |||
| 446 | Ga0495628_0041826 | |||
| 447 | Ga0495630_0052803 | |||
| 448 | Ga0495644_0021570 | |||
| 449 | Ga0495642_0245716 | |||
| 450 | Ga0495652_0213596 | |||
| 451 | Ga0495587_0187499 | |||
| 452 | Ga0495621_0125625 | |||
| 453 | Ga0495645_0238216 | |||
| 454 | Ga0495656_0005449 | |||
| 455 | Ga0495634_0217298 | |||
| 456 | Ga0495646_0023000 | |||
| 457 | Ga0495624_0028902 | |||
| 458 | Ga0495589_0199342 | |||
| 459 | Ga0495604_0052634 | |||
| 460 | Ga0495636_0173301 | |||
| 461 | Ga0495674_0315196 | |||
| 462 | Ga0495676_0103099 | |||
| 463 | Ga0495676_0187184 | |||
| 464 | Ga0495675_0332192 | |||
| 465 | Ga0495677_0111908 | |||
| 466 | Ga0495602_0457779 | |||
| 467 | Ga0496100_0404798 | |||
| 468 | Ga0496100_0548197 | |||
| 469 | Ga0496101_0112730 | |||
| 470 | Ga0496101_0115049 | |||
| 471 | Ga0496101_0664690 | |||
| 472 | Ga0496102_0008078 | |||
| 473 | Ga0496103_0006222 | |||
| 474 | Ga0496104_0014077 | |||
| 475 | Ga0496104_0032821 | |||
| 476 | Ga0496104_0332515 | |||
| 477 | Ga0496105_0175530 | |||
| 478 | Ga0496105_0482116 | |||
| 479 | Ga0496106_0181601 | |||
| 480 | Ga0496106_0230822 | |||
| 481 | Ga0496106_0757712 | |||
| 482 | Ga0496107_0207876 | |||
| 483 | Ga0496107_0254202 | |||
| 484 | Ga0496108_0153510 | |||
| 485 | Ga0496109_0049496 | |||
| 486 | Ga0496109_0051890 | |||
| 487 | Ga0496109_0747782 | |||
| 488 | Ga0496110_0014622 | |||
| 489 | Ga0496112_0074888 | |||
| 490 | Ga0496112_0759364 | |||
| 491 | Ga0496113_0120284 | |||
| 492 | Ga0496113_0426751 | |||
| 493 | Ga0496114_0008459 | |||
| 494 | Ga0496114_0407668 | |||
| 495 | Ga0496115_0040946 | |||
| 496 | Ga0496115_0081726 | |||
| 497 | Ga0501047_0025509 | |||
| 498 | Ga0501067_0171314 | |||
| 499 | Ga0501069_0117229 | |||
| 500 | Ga0501070_0008627 | |||
| 501 | Ga0501070_0147141 | |||
| 502 | Ga0501070_0255532 | |||
| 503 | Ga0501070_1039149 | |||
| 504 | Ga0501074_0009427 | |||
| 505 | Ga0501079_0124448 | |||
| 506 | Ga0501080_0016173 | |||
| 507 | Ga0501044_0548451 | |||
| 508 | nmdc:mga0n895_469_c1 | |||
| 509 | nmdc:mga0rr50_85581_c1 | |||
| 510 | nmdc:mga0a205_28421_c2 | |||
| 511 | Ga0495601_0090028 | |||
| 512 | Ga0495601_0132427 | |||
| 513 | Ga0495601_0199287 | |||
| 514 | Ga0495612_0047393 | |||
| 515 | Ga0466962_0017357 | |||
| 516 | Ga0466962_0145970 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ejf-assembly2.cif.gz_B | crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9288 | 17 | 191 |
| 2ejg-assembly1.cif.gz_A | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9241 | 15 | 191 |
| 2ejg-assembly2.cif.gz_B | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9225 | 15 | 191 |
| 2deq-assembly1.cif.gz_A | crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation | 0.9191 | 15 | 191 |
| 2hni-assembly1.cif.gz_B | crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation | 0.918 | 15 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e65B01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9071 | 15 | 191 | 3.30.930.10 |
| 2eayB01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8946 | 23 | 191 | 3.30.930.10 |
| 1bibA02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8723 | 11 | 191 | 3.30.930.10 |
| 4xtuA01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8707 | 6 | 192 | 3.30.930.10 |
| 3rkxA02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.847 | 17 | 190 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GY25-F1-model_v4 | Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) | 0.9917 | 4 | 192 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A832A4Y6-F1-model_v4 | Bifunctional ligase/repressor BirA (Biotin--[acetyl-CoA-carboxylase] ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-[acetyl-CoA carboxylase] synthetase) | 0.9723 | 8 | 191 |
GO:0003677
GO:0004077 GO:0005524 GO:0005737 GO:0006355 GO:0036211 |
| AF-A0A7M2YWJ8-F1-model_v4 | Biotin--[acetyl-CoA-carboxylase] ligase | 0.9718 | 1 | 190 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A537TTW7-F1-model_v4 | Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) | 0.967 | 1 | 191 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A1G3CJG2-F1-model_v4 | Biotin--[acetyl-CoA-carboxylase] ligase | 0.9664 | 39 | 193 |
GO:0004077
GO:0005737 GO:0036211 |