F368382

General Info

Members Datasets Scaffolds Average Seq Length
258 137 516 194

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0153892|Ga0496112_0153892_460_1068
Length 202
Sequence MRVSDLSPGSVELLLQGRLGRPYRFVEECTSTQRLLDADEHEGTTVATDHQTRGRGRLGRVWEAPPGRGLLFSVLLRPSPPMALWPELSLVAGDAVAAALHAKTGIAAELSHPNDVLVEGRKVAGILPEASAGRVVLGIGVNVDQTVEELPADTPKPATSLRNETGREWPRAPLLAAILLELELRYDDWQRLHTNRRGPAGS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.02
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 15.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0153892 3300048915 Bacteria 2267
2 rootH1_10235143 3300003323 Bacteria 1509
3 Ga0070683_100098993 3300005329 Bacteria 2744
4 Ga0070680_100071793 3300005336 Bacteria 2845
5 Ga0070680_100144597 3300005336 Bacteria 1995
6 Ga0070680_100187495 3300005336 Bacteria 1743
7 Ga0070682_100174946 3300005337 Bacteria 1494
8 Ga0070660_100085622 3300005339 Bacteria 2479
9 Ga0070691_10059915 3300005341 Unclassified 1829
10 Ga0070692_10132304 3300005345 Bacteria 1403
11 Ga0070709_10229916 3300005434 Bacteria 1326
12 Ga0070714_100001730 3300005435 Bacteria 15912
13 Ga0070714_100508474 3300005435 Unclassified 1149
14 Ga0070714_100564096 3300005435 Bacteria 1091
15 Ga0070713_100029682 3300005436 Bacteria 4333
16 Ga0070713_100316899 3300005436 Bacteria 1439
17 Ga0070710_10008746 3300005437 Bacteria 4938
18 Ga0070710_10137054 3300005437 Bacteria 1497
19 Ga0070711_100021022 3300005439 Bacteria 4215
20 Ga0070711_100032777 3300005439 Bacteria 3457
21 Ga0070711_100550090 3300005439 Unclassified 957
22 Ga0070711_100644690 3300005439 Bacteria 887
23 Ga0070694_100043187 3300005444 Bacteria 3014
24 Ga0070708_100447259 3300005445 Unclassified 1219
25 Ga0070681_10027297 3300005458 Bacteria 5739
26 Ga0070681_10093108 3300005458 Bacteria 2962
27 Ga0070681_10236255 3300005458 Bacteria 1742
28 Ga0070706_100521256 3300005467 Bacteria 1106
29 Ga0070707_100001128 3300005468 Bacteria 26352
30 Ga0070679_100051987 3300005530 Bacteria 4082
31 Ga0070679_100065672 3300005530 Bacteria 3616
32 Ga0070679_100343522 3300005530 Unclassified 1441
33 Ga0070695_100000029 3300005545 Bacteria 53859
34 Ga0070693_100437864 3300005547 Bacteria 915
35 Ga0068855_100062367 3300005563 Bacteria 4352
36 Ga0070664_100088058 3300005564 Bacteria 2685
37 Ga0068856_100098363 3300005614 Bacteria 2916
38 Ga0068856_101719359 3300005614 Bacteria 640
39 Ga0070717_10029414 3300006028 Bacteria 4407
40 Ga0070717_10031104 3300006028 Bacteria 4292
41 Ga0070717_10619932 3300006028 Bacteria 981
42 Ga0070716_100041828 3300006173 Bacteria 2555
43 Ga0070712_100087058 3300006175 Bacteria 2278
44 Ga0070712_100384236 3300006175 Bacteria 1156
45 Ga0070712_100583776 3300006175 Bacteria 944
46 Ga0075433_10175377 3300006852 Unclassified 1908
47 Ga0075435_100325860 3300007076 Unclassified 1315
48 Ga0105240_10010108 3300009093 Bacteria 13279
49 Ga0105240_10352124 3300009093 Bacteria 1670
50 Ga0105237_10679555 3300009545 Bacteria 1036
51 Ga0105238_10093907 3300009551 Bacteria 2988
52 Ga0105239_11644923 3300010375 Bacteria 743
53 Ga0105246_10392911 3300011119 Unclassified 1150
54 Ga0157370_10088032 3300013104 Bacteria 2916
55 Ga0157370_10143970 3300013104 Bacteria 2220
56 Ga0157369_10033465 3300013105 Bacteria 5648
57 Ga0157369_10693924 3300013105 Bacteria 1048
58 Ga0157374_10118647 3300013296 Bacteria 2551
59 Ga0157372_10007615 3300013307 Bacteria 11515
60 Ga0157372_10218579 3300013307 Bacteria 2209
61 Ga0157375_11906819 3300013308 Unclassified 705
62 Ga0182008_10025785 3300014497 Bacteria 2985
63 Ga0182008_10318810 3300014497 Unclassified 817
64 Ga0207692_10035846 3300025898 Bacteria 2413
65 Ga0207692_10067860 3300025898 Bacteria 1868
66 Ga0207685_10009934 3300025905 Bacteria 2786
67 Ga0207685_10191661 3300025905 Bacteria 955
68 Ga0207705_10009302 3300025909 Bacteria 7146
69 Ga0207707_10149644 3300025912 Bacteria 2041
70 Ga0207707_10795597 3300025912 Bacteria 788
71 Ga0207695_10640514 3300025913 Bacteria 944
72 Ga0207693_10020457 3300025915 Bacteria 5264
73 Ga0207693_10403482 3300025915 Bacteria 1069
74 Ga0207663_10137913 3300025916 Bacteria 1695
75 Ga0207660_10098505 3300025917 Unclassified 2181
76 Ga0207660_10304188 3300025917 Bacteria 1270
77 Ga0207649_10113448 3300025920 Unclassified 1815
78 Ga0207652_10119434 3300025921 Bacteria 2344
79 Ga0207652_10143944 3300025921 Bacteria 2132
80 Ga0207646_10003943 3300025922 Bacteria 16459
81 Ga0207700_10060095 3300025928 Bacteria 2877
82 Ga0207700_10210800 3300025928 Bacteria 1642
83 Ga0207664_10069571 3300025929 Bacteria 2830
84 Ga0207664_10141877 3300025929 Bacteria 2033
85 Ga0207664_10343397 3300025929 Unclassified 1320
86 Ga0207664_10454281 3300025929 Bacteria 1144
87 Ga0207665_10211145 3300025939 Bacteria 1418
88 Ga0207667_10332438 3300025949 Bacteria 1551
89 Ga0207678_10605088 3300026067 Bacteria 961
90 Ga0207702_10223178 3300026078 Bacteria 1757
91 Ga0207702_10714101 3300026078 Bacteria 988
92 Ga0207641_10039645 3300026088 Bacteria 3941
93 Ga0207428_10253794 3300027907 Bacteria 1311
94 Ga0316583_10029025 3300032133 Bacteria 1973
95 Ga0373943_0132772 3300035170 Unclassified 1334
96 Ga0373924_0234266 3300035410 Bacteria 812
97 Ga0395899_0019902 3300037312 Bacteria 5092
98 Ga0395900_0026133 3300037418 Bacteria 5978
99 Ga0395900_0180783 3300037418 Bacteria 2143
100 Ga0395898_0000824 3300037466 Bacteria 51781
101 Ga0395898_0018968 3300037466 Bacteria 7008
102 Ga0395901_0001584 3300038443 Bacteria 23533
103 Ga0395901_0054876 3300038443 Bacteria 4142
104 Ga0436363_1633358 3300039450 Bacteria 2287
105 Ga0466969_0004821 3300044656 Bacteria 7183
106 Ga0466969_0088694 3300044656 Bacteria 1468
107 Ga0466972_0029731 3300044658 Bacteria 2690
108 Ga0466966_0112405 3300044684 Unclassified 1678
109 Ga0466966_0280825 3300044684 Bacteria 1002
110 Ga0466961_0012817 3300044693 Bacteria 5366
111 Ga0466961_0022246 3300044693 Bacteria 4079
112 Ga0466961_0131055 3300044693 Unclassified 1571
113 Ga0466961_0138107 3300044693 Bacteria 1527
114 Ga0466963_0002189 3300044694 Bacteria 10808
115 Ga0466963_0005777 3300044694 Bacteria 7278
116 Ga0466963_0007093 3300044694 Bacteria 6673
117 Ga0466963_0008092 3300044694 Bacteria 6295
118 Ga0466963_0012284 3300044694 Bacteria 5237
119 Ga0466963_0058287 3300044694 Bacteria 2574
120 Ga0466963_0111807 3300044694 Unclassified 1875
121 Ga0466963_0144464 3300044694 Unclassified 1650
122 Ga0466963_0297611 3300044694 Bacteria 1134
123 Ga0466963_0365466 3300044694 Bacteria 1016
124 Ga0466963_0428222 3300044694 Bacteria 933
125 Ga0466963_0560427 3300044694 Unclassified 807
126 Ga0466964_0022038 3300044706 Bacteria 2468
127 Ga0466964_0038264 3300044706 Bacteria 1928
128 Ga0466964_0039476 3300044706 Bacteria 1902
129 Ga0466964_0041602 3300044706 Unclassified 1859
130 Ga0466964_0101646 3300044706 Unclassified 1268
131 Ga0466964_0150482 3300044706 Unclassified 1078
132 Ga0466964_0339399 3300044706 Unclassified 769
133 Ga0466971_0000170 3300044719 Bacteria 24398
134 Ga0466971_0061243 3300044719 Bacteria 1701
135 Ga0466971_0106625 3300044719 Bacteria 1291
136 Ga0466971_0146472 3300044719 Unclassified 1101
137 Ga0466968_0001006 3300044735 Bacteria 9928
138 Ga0466968_0019982 3300044735 Bacteria 2700
139 Ga0466968_0021702 3300044735 Bacteria 2602
140 Ga0466968_0122103 3300044735 Unclassified 1179
141 Ga0466968_0131485 3300044735 Bacteria 1139
142 Ga0466970_0000806 3300044765 Bacteria 15112
143 Ga0466970_0020042 3300044765 Bacteria 3471
144 Ga0466970_0174156 3300044765 Unclassified 1193
145 Ga0466957_0000671 3300044842 Bacteria 17426
146 Ga0466957_0003280 3300044842 Bacteria 8862
147 Ga0466957_0009740 3300044842 Bacteria 5488
148 Ga0466957_0016682 3300044842 Bacteria 4296
149 Ga0466957_0030148 3300044842 Bacteria 3238
150 Ga0466957_0045424 3300044842 Bacteria 2664
151 Ga0466959_0003637 3300045049 Bacteria 10171
152 Ga0466959_0005938 3300045049 Bacteria 8416
153 Ga0466959_0393081 3300045049 Unclassified 943
154 Ga0466958_0001062 3300045836 Bacteria 12591
155 Ga0466958_0006904 3300045836 Bacteria 6208
156 Ga0466958_0021115 3300045836 Bacteria 3801
157 Ga0466958_0022617 3300045836 Bacteria 3684
158 Ga0466958_0121300 3300045836 Unclassified 1637
159 Ga0466958_0236030 3300045836 Unclassified 1168
160 Ga0466967_0000828 3300045976 Bacteria 16293
161 Ga0466967_0002114 3300045976 Bacteria 12193
162 Ga0466967_0002908 3300045976 Bacteria 10915
163 Ga0466967_0009149 3300045976 Bacteria 7328
164 Ga0466967_0012395 3300045976 Bacteria 6517
165 Ga0466967_0030291 3300045976 Bacteria 4539
166 Ga0466967_0049251 3300045976 Bacteria 3683
167 Ga0466967_0081515 3300045976 Bacteria 2922
168 Ga0466967_0107460 3300045976 Bacteria 2559
169 Ga0466967_0156180 3300045976 Bacteria 2137
170 Ga0466967_0166516 3300045976 Bacteria 2071
171 Ga0466967_0184316 3300045976 Bacteria 1970
172 Ga0466967_0261866 3300045976 Bacteria 1654
173 Ga0466967_0298174 3300045976 Bacteria 1550
174 Ga0466967_0335346 3300045976 Bacteria 1461
175 Ga0466967_0465976 3300045976 Unclassified 1236
176 Ga0466967_0492975 3300045976 Unclassified 1201
177 Ga0466967_0634757 3300045976 Unclassified 1055
178 Ga0495592_0183447 3300046454 Bacteria 1424
179 Ga0495603_0093858 3300046455 Bacteria 1753
180 Ga0495641_0074862 3300046461 Bacteria 1518
181 Ga0495582_0034301 3300046473 Bacteria 2790
182 Ga0495582_0249511 3300046473 Bacteria 1018
183 Ga0495662_0211491 3300046476 Unclassified 956
184 Ga0495664_0549639 3300046477 Bacteria 688
185 Ga0495594_0440169 3300046499 Bacteria 741
186 Ga0495607_0068706 3300046501 Bacteria 1986
187 Ga0495618_0388859 3300046514 Bacteria 855
188 Ga0495628_0041826 3300046516 Bacteria 3657
189 Ga0495630_0052803 3300046517 Bacteria 3043
190 Ga0495644_0021570 3300046523 Bacteria 2457
191 Ga0495642_0245716 3300046528 Unclassified 782
192 Ga0495652_0213596 3300046529 Bacteria 1454
193 Ga0495587_0187499 3300046536 Unclassified 1172
194 Ga0495621_0125625 3300046539 Bacteria 995
195 Ga0495645_0238216 3300046543 Bacteria 1215
196 Ga0495656_0005449 3300046615 Bacteria 4394
197 Ga0495634_0217298 3300046642 Bacteria 1181
198 Ga0495646_0023000 3300046680 Bacteria 3925
199 Ga0495624_0028902 3300046690 Bacteria 3618
200 Ga0495589_0199342 3300046794 Bacteria 945
201 Ga0495604_0052634 3300047317 Bacteria 3151
202 Ga0495636_0173301 3300047318 Bacteria 976
203 Ga0495674_0315196 3300047319 Bacteria 1275
204 Ga0495676_0103099 3300047321 Bacteria 2107
205 Ga0495676_0187184 3300047321 Bacteria 1446
206 Ga0495675_0332192 3300047444 Bacteria 897
207 Ga0495677_0111908 3300047445 Bacteria 1038
208 Ga0495602_0457779 3300048088 Bacteria 899
209 Ga0496100_0404798 3300048903 Unclassified 1040
210 Ga0496100_0548197 3300048903 Bacteria 894
211 Ga0496101_0112730 3300048904 Bacteria 2049
212 Ga0496101_0115049 3300048904 Bacteria 2028
213 Ga0496101_0664690 3300048904 Bacteria 823
214 Ga0496102_0008078 3300048905 Bacteria 9002
215 Ga0496103_0006222 3300048906 Bacteria 7132
216 Ga0496104_0014077 3300048907 Bacteria 7220
217 Ga0496104_0032821 3300048907 Bacteria 4832
218 Ga0496104_0332515 3300048907 Bacteria 1432
219 Ga0496105_0175530 3300048908 Bacteria 1755
220 Ga0496105_0482116 3300048908 Bacteria 975
221 Ga0496106_0181601 3300048909 Bacteria 1670
222 Ga0496106_0230822 3300048909 Bacteria 1478
223 Ga0496106_0757712 3300048909 Bacteria 772
224 Ga0496107_0207876 3300048910 Bacteria 1455
225 Ga0496107_0254202 3300048910 Bacteria 1307
226 Ga0496108_0153510 3300048911 Bacteria 1987
227 Ga0496109_0049496 3300048912 Bacteria 3825
228 Ga0496109_0051890 3300048912 Bacteria 3736
229 Ga0496109_0747782 3300048912 Bacteria 915
230 Ga0496110_0014622 3300048913 Bacteria 6521
231 Ga0496112_0074888 3300048915 Bacteria 3348
232 Ga0496112_0759364 3300048915 Bacteria 896
233 Ga0496113_0120284 3300048916 Bacteria 2052
234 Ga0496113_0426751 3300048916 Bacteria 1065
235 Ga0496114_0008459 3300048917 Bacteria 8154
236 Ga0496114_0407668 3300048917 Bacteria 1204
237 Ga0496115_0040946 3300048918 Bacteria 3684
238 Ga0496115_0081726 3300048918 Bacteria 2631
239 Ga0501047_0025509 3300049581 Bacteria 5682
240 Ga0501067_0171314 3300049583 Bacteria 1209
241 Ga0501069_0117229 3300049585 Bacteria 1519
242 Ga0501070_0008627 3300049586 Bacteria 8617
243 Ga0501070_0147141 3300049586 Bacteria 1944
244 Ga0501070_0255532 3300049586 Unclassified 1433
245 Ga0501070_1039149 3300049586 Unclassified 634
246 Ga0501074_0009427 3300049590 Bacteria 7090
247 Ga0501079_0124448 3300049741 Bacteria 2006
248 Ga0501080_0016173 3300049742 Bacteria 6887
249 Ga0501044_0548451 3300049823 Bacteria 1053
250 nmdc:mga0n895_469_c1 3300050512 Bacteria 27118
251 nmdc:mga0rr50_85581_c1 3300050513 Unclassified 2443
252 nmdc:mga0a205_28421_c2 3300050515 Unclassified 2062
253 Ga0495601_0090028 3300053077 Bacteria 1973
254 Ga0495601_0132427 3300053077 Bacteria 1624
255 Ga0495601_0199287 3300053077 Bacteria 1308
256 Ga0495612_0047393 3300053078 Bacteria 1761
257 Ga0466962_0017357 3300061719 Bacteria 3465
258 Ga0466962_0145970 3300061719 Unclassified 1147
259 Ga0496112_0153892
260 rootH1_10235143
261 Ga0070683_100098993
262 Ga0070680_100071793
263 Ga0070680_100144597
264 Ga0070680_100187495
265 Ga0070682_100174946
266 Ga0070660_100085622
267 Ga0070691_10059915
268 Ga0070692_10132304
269 Ga0070709_10229916
270 Ga0070714_100001730
271 Ga0070714_100508474
272 Ga0070714_100564096
273 Ga0070713_100029682
274 Ga0070713_100316899
275 Ga0070710_10008746
276 Ga0070710_10137054
277 Ga0070711_100021022
278 Ga0070711_100032777
279 Ga0070711_100550090
280 Ga0070711_100644690
281 Ga0070694_100043187
282 Ga0070708_100447259
283 Ga0070681_10027297
284 Ga0070681_10093108
285 Ga0070681_10236255
286 Ga0070706_100521256
287 Ga0070707_100001128
288 Ga0070679_100051987
289 Ga0070679_100065672
290 Ga0070679_100343522
291 Ga0070695_100000029
292 Ga0070693_100437864
293 Ga0068855_100062367
294 Ga0070664_100088058
295 Ga0068856_100098363
296 Ga0068856_101719359
297 Ga0070717_10029414
298 Ga0070717_10031104
299 Ga0070717_10619932
300 Ga0070716_100041828
301 Ga0070712_100087058
302 Ga0070712_100384236
303 Ga0070712_100583776
304 Ga0075433_10175377
305 Ga0075435_100325860
306 Ga0105240_10010108
307 Ga0105240_10352124
308 Ga0105237_10679555
309 Ga0105238_10093907
310 Ga0105239_11644923
311 Ga0105246_10392911
312 Ga0157370_10088032
313 Ga0157370_10143970
314 Ga0157369_10033465
315 Ga0157369_10693924
316 Ga0157374_10118647
317 Ga0157372_10007615
318 Ga0157372_10218579
319 Ga0157375_11906819
320 Ga0182008_10025785
321 Ga0182008_10318810
322 Ga0207692_10035846
323 Ga0207692_10067860
324 Ga0207685_10009934
325 Ga0207685_10191661
326 Ga0207705_10009302
327 Ga0207707_10149644
328 Ga0207707_10795597
329 Ga0207695_10640514
330 Ga0207693_10020457
331 Ga0207693_10403482
332 Ga0207663_10137913
333 Ga0207660_10098505
334 Ga0207660_10304188
335 Ga0207649_10113448
336 Ga0207652_10119434
337 Ga0207652_10143944
338 Ga0207646_10003943
339 Ga0207700_10060095
340 Ga0207700_10210800
341 Ga0207664_10069571
342 Ga0207664_10141877
343 Ga0207664_10343397
344 Ga0207664_10454281
345 Ga0207665_10211145
346 Ga0207667_10332438
347 Ga0207678_10605088
348 Ga0207702_10223178
349 Ga0207702_10714101
350 Ga0207641_10039645
351 Ga0207428_10253794
352 Ga0316583_10029025
353 Ga0373943_0132772
354 Ga0373924_0234266
355 Ga0395899_0019902
356 Ga0395900_0026133
357 Ga0395900_0180783
358 Ga0395898_0000824
359 Ga0395898_0018968
360 Ga0395901_0001584
361 Ga0395901_0054876
362 Ga0436363_1633358
363 Ga0466969_0004821
364 Ga0466969_0088694
365 Ga0466972_0029731
366 Ga0466966_0112405
367 Ga0466966_0280825
368 Ga0466961_0012817
369 Ga0466961_0022246
370 Ga0466961_0131055
371 Ga0466961_0138107
372 Ga0466963_0002189
373 Ga0466963_0005777
374 Ga0466963_0007093
375 Ga0466963_0008092
376 Ga0466963_0012284
377 Ga0466963_0058287
378 Ga0466963_0111807
379 Ga0466963_0144464
380 Ga0466963_0297611
381 Ga0466963_0365466
382 Ga0466963_0428222
383 Ga0466963_0560427
384 Ga0466964_0022038
385 Ga0466964_0038264
386 Ga0466964_0039476
387 Ga0466964_0041602
388 Ga0466964_0101646
389 Ga0466964_0150482
390 Ga0466964_0339399
391 Ga0466971_0000170
392 Ga0466971_0061243
393 Ga0466971_0106625
394 Ga0466971_0146472
395 Ga0466968_0001006
396 Ga0466968_0019982
397 Ga0466968_0021702
398 Ga0466968_0122103
399 Ga0466968_0131485
400 Ga0466970_0000806
401 Ga0466970_0020042
402 Ga0466970_0174156
403 Ga0466957_0000671
404 Ga0466957_0003280
405 Ga0466957_0009740
406 Ga0466957_0016682
407 Ga0466957_0030148
408 Ga0466957_0045424
409 Ga0466959_0003637
410 Ga0466959_0005938
411 Ga0466959_0393081
412 Ga0466958_0001062
413 Ga0466958_0006904
414 Ga0466958_0021115
415 Ga0466958_0022617
416 Ga0466958_0121300
417 Ga0466958_0236030
418 Ga0466967_0000828
419 Ga0466967_0002114
420 Ga0466967_0002908
421 Ga0466967_0009149
422 Ga0466967_0012395
423 Ga0466967_0030291
424 Ga0466967_0049251
425 Ga0466967_0081515
426 Ga0466967_0107460
427 Ga0466967_0156180
428 Ga0466967_0166516
429 Ga0466967_0184316
430 Ga0466967_0261866
431 Ga0466967_0298174
432 Ga0466967_0335346
433 Ga0466967_0465976
434 Ga0466967_0492975
435 Ga0466967_0634757
436 Ga0495592_0183447
437 Ga0495603_0093858
438 Ga0495641_0074862
439 Ga0495582_0034301
440 Ga0495582_0249511
441 Ga0495662_0211491
442 Ga0495664_0549639
443 Ga0495594_0440169
444 Ga0495607_0068706
445 Ga0495618_0388859
446 Ga0495628_0041826
447 Ga0495630_0052803
448 Ga0495644_0021570
449 Ga0495642_0245716
450 Ga0495652_0213596
451 Ga0495587_0187499
452 Ga0495621_0125625
453 Ga0495645_0238216
454 Ga0495656_0005449
455 Ga0495634_0217298
456 Ga0495646_0023000
457 Ga0495624_0028902
458 Ga0495589_0199342
459 Ga0495604_0052634
460 Ga0495636_0173301
461 Ga0495674_0315196
462 Ga0495676_0103099
463 Ga0495676_0187184
464 Ga0495675_0332192
465 Ga0495677_0111908
466 Ga0495602_0457779
467 Ga0496100_0404798
468 Ga0496100_0548197
469 Ga0496101_0112730
470 Ga0496101_0115049
471 Ga0496101_0664690
472 Ga0496102_0008078
473 Ga0496103_0006222
474 Ga0496104_0014077
475 Ga0496104_0032821
476 Ga0496104_0332515
477 Ga0496105_0175530
478 Ga0496105_0482116
479 Ga0496106_0181601
480 Ga0496106_0230822
481 Ga0496106_0757712
482 Ga0496107_0207876
483 Ga0496107_0254202
484 Ga0496108_0153510
485 Ga0496109_0049496
486 Ga0496109_0051890
487 Ga0496109_0747782
488 Ga0496110_0014622
489 Ga0496112_0074888
490 Ga0496112_0759364
491 Ga0496113_0120284
492 Ga0496113_0426751
493 Ga0496114_0008459
494 Ga0496114_0407668
495 Ga0496115_0040946
496 Ga0496115_0081726
497 Ga0501047_0025509
498 Ga0501067_0171314
499 Ga0501069_0117229
500 Ga0501070_0008627
501 Ga0501070_0147141
502 Ga0501070_0255532
503 Ga0501070_1039149
504 Ga0501074_0009427
505 Ga0501079_0124448
506 Ga0501080_0016173
507 Ga0501044_0548451
508 nmdc:mga0n895_469_c1
509 nmdc:mga0rr50_85581_c1
510 nmdc:mga0a205_28421_c2
511 Ga0495601_0090028
512 Ga0495601_0132427
513 Ga0495601_0199287
514 Ga0495612_0047393
515 Ga0466962_0017357
516 Ga0466962_0145970

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

25

145

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejf-assembly2.cif.gz_B crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9288 17 191
2ejg-assembly1.cif.gz_A crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9241 15 191
2ejg-assembly2.cif.gz_B crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9225 15 191
2deq-assembly1.cif.gz_A crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation 0.9191 15 191
2hni-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111a mutation 0.918 15 192
ID Description Score Start End Superfamily
2e65B01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9071 15 191 3.30.930.10
2eayB01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8946 23 191 3.30.930.10
1bibA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8723 11 191 3.30.930.10
4xtuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8707 6 192 3.30.930.10
3rkxA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.847 17 190 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A538GY25-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) 0.9917 4 192 GO:0004077
GO:0005737
GO:0036211
AF-A0A832A4Y6-F1-model_v4 Bifunctional ligase/repressor BirA (Biotin--[acetyl-CoA-carboxylase] ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-[acetyl-CoA carboxylase] synthetase) 0.9723 8 191 GO:0003677
GO:0004077
GO:0005524
GO:0005737
GO:0006355
GO:0036211
AF-A0A7M2YWJ8-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase 0.9718 1 190 GO:0004077
GO:0005737
GO:0036211
AF-A0A537TTW7-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) 0.967 1 191 GO:0004077
GO:0005737
GO:0036211
AF-A0A1G3CJG2-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase 0.9664 39 193 GO:0004077
GO:0005737
GO:0036211

Map