F368283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 200 | 516 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0070830|Ga0466966_0070830_466_1578 |
| Length | 370 |
| Sequence | MSYRVAVVGATGNAGSKVLQVLSERALPISELVPFASARSEGKRLPFRGDELVCRSLSEDDLDGFDLAFLAAGGGVASEWAPRFVEHGALVIDKSSYWRMDPDVPLVVPEINPDAVTRALDARRIIASPNCSTMAMVMALYPLQREVGIEEIVVSTYQSVSGTGKAAVEELEAQTHALLHGTEPPQPTVYPQQIAFNVLPHVEKFKDDSGYTTEERKMMDETRKIFGVGEGELRITATCVRVPVINSHSEXIRIRTRRPVEVAQARELLAGAPGVVVVDDPQRASYPTAIGGADRDEVFVGRLRHDPGPGGERYLNLWVVGDNLRKGAATNAVQIAELLHERGLAGAAQRVAVAWQLCDDLHALIEQTDW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 50 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 94 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 95 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 99 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 112 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 113 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 163 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 174 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 185 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 186 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 187 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 188 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 189 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 190 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 191 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 192 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 193 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 194 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 195 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 196 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 197 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 198 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 199 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 200 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.8 |
| Metatranscriptomes | 0 |
| Isolates | 6.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 6.2 |
| Rhizoplane | 7.75 |
| Rhizosphere | 75.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466966_0070830 | 3300044684 | Bacteria | 2185 |
| 2 | JGI24746J21847_1000062 | 3300001977 | Bacteria | 11085 |
| 3 | Ga0070683_100002626 | 3300005329 | Bacteria | 14369 |
| 4 | Ga0070683_100010895 | 3300005329 | Bacteria | 7827 |
| 5 | Ga0070683_100061504 | 3300005329 | Bacteria | 3492 |
| 6 | Ga0070677_10000013 | 3300005333 | Bacteria | 53677 |
| 7 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 8 | Ga0068868_100000467 | 3300005338 | Bacteria | 26933 |
| 9 | Ga0070691_10006337 | 3300005341 | Bacteria | 5406 |
| 10 | Ga0070674_100000063 | 3300005356 | Bacteria | 47714 |
| 11 | Ga0070673_100007764 | 3300005364 | Bacteria | 7096 |
| 12 | Ga0070659_100094166 | 3300005366 | Bacteria | 2405 |
| 13 | Ga0070662_100000015 | 3300005457 | Bacteria | 109379 |
| 14 | Ga0070681_10034512 | 3300005458 | Bacteria | 5079 |
| 15 | Ga0068867_100000814 | 3300005459 | Bacteria | 21051 |
| 16 | Ga0070706_100059066 | 3300005467 | Bacteria | 3539 |
| 17 | Ga0070706_100067884 | 3300005467 | Bacteria | 3298 |
| 18 | Ga0070707_100025611 | 3300005468 | Bacteria | 5599 |
| 19 | Ga0070698_100246892 | 3300005471 | Unclassified | 1718 |
| 20 | Ga0070699_100303492 | 3300005518 | Bacteria | 1433 |
| 21 | Ga0070679_100000069 | 3300005530 | Bacteria | 76557 |
| 22 | Ga0070684_100016077 | 3300005535 | Bacteria | 6112 |
| 23 | Ga0070684_100029658 | 3300005535 | Bacteria | 4639 |
| 24 | Ga0070684_100060374 | 3300005535 | Bacteria | 3316 |
| 25 | Ga0068853_100159137 | 3300005539 | Bacteria | 2037 |
| 26 | Ga0070672_100000175 | 3300005543 | Bacteria | 35613 |
| 27 | Ga0070693_100002758 | 3300005547 | Bacteria | 8083 |
| 28 | Ga0070665_100000068 | 3300005548 | Bacteria | 204531 |
| 29 | Ga0068856_100069387 | 3300005614 | Bacteria | 3485 |
| 30 | Ga0068866_10000011 | 3300005718 | Bacteria | 97191 |
| 31 | Ga0068861_100094754 | 3300005719 | Bacteria | 2363 |
| 32 | Ga0068863_100000136 | 3300005841 | Bacteria | 78102 |
| 33 | Ga0068858_100001203 | 3300005842 | Bacteria | 26823 |
| 34 | Ga0068860_100001635 | 3300005843 | Bacteria | 24018 |
| 35 | Ga0081455_10004899 | 3300005937 | Bacteria | 14838 |
| 36 | Ga0081455_10097350 | 3300005937 | Bacteria | 2371 |
| 37 | Ga0081538_10000023 | 3300005981 | Bacteria | 131101 |
| 38 | Ga0081538_10007272 | 3300005981 | Bacteria | 9596 |
| 39 | Ga0081538_10066305 | 3300005981 | Bacteria | 2025 |
| 40 | Ga0081540_1002959 | 3300005983 | Bacteria | 13617 |
| 41 | Ga0081540_1017419 | 3300005983 | Bacteria | 4449 |
| 42 | Ga0081540_1037540 | 3300005983 | Bacteria | 2566 |
| 43 | Ga0081539_10004231 | 3300005985 | Bacteria | 16154 |
| 44 | Ga0075363_100056741 | 3300006048 | Bacteria | 2100 |
| 45 | Ga0070715_10000011 | 3300006163 | Bacteria | 183857 |
| 46 | Ga0070712_100002580 | 3300006175 | Bacteria | 11192 |
| 47 | Ga0075428_100013716 | 3300006844 | Bacteria | 9023 |
| 48 | Ga0075431_100057406 | 3300006847 | Bacteria | 4015 |
| 49 | Ga0075433_10000057 | 3300006852 | Bacteria | 48581 |
| 50 | Ga0075433_10000968 | 3300006852 | Bacteria | 20370 |
| 51 | Ga0075429_100008952 | 3300006880 | Bacteria | 8696 |
| 52 | Ga0111539_10027064 | 3300009094 | Bacteria | 7004 |
| 53 | Ga0105245_10000667 | 3300009098 | Bacteria | 31104 |
| 54 | Ga0105245_10001759 | 3300009098 | Bacteria | 19752 |
| 55 | Ga0105247_10222682 | 3300009101 | Bacteria | 1278 |
| 56 | Ga0114129_10135942 | 3300009147 | Bacteria | 3373 |
| 57 | Ga0114129_10197607 | 3300009147 | Bacteria | 2726 |
| 58 | Ga0114129_10297264 | 3300009147 | Bacteria | 2153 |
| 59 | Ga0114129_10314579 | 3300009147 | Bacteria | 2083 |
| 60 | Ga0105243_10372173 | 3300009148 | Bacteria | 1318 |
| 61 | Ga0105237_10005339 | 3300009545 | Bacteria | 14538 |
| 62 | Ga0105238_10000172 | 3300009551 | Bacteria | 70799 |
| 63 | Ga0105249_10000235 | 3300009553 | Bacteria | 62630 |
| 64 | Ga0105249_10099644 | 3300009553 | Bacteria | 2731 |
| 65 | Ga0123341_1003530 | 3300009765 | Bacteria | 13433 |
| 66 | Ga0123341_1054452 | 3300009765 | Bacteria | 2145 |
| 67 | Ga0123342_1023658 | 3300009766 | Bacteria | 3954 |
| 68 | Ga0105239_10166747 | 3300010375 | Bacteria | 2463 |
| 69 | Ga0105246_10028564 | 3300011119 | Bacteria | 3665 |
| 70 | Ga0157374_10001879 | 3300013296 | Bacteria | 17641 |
| 71 | Ga0163162_10046138 | 3300013306 | Bacteria | 4367 |
| 72 | Ga0163162_10590022 | 3300013306 | Bacteria | 1238 |
| 73 | Ga0157375_10237788 | 3300013308 | Bacteria | 1981 |
| 74 | Ga0157380_10000550 | 3300014326 | Bacteria | 23107 |
| 75 | Ga0157379_10035197 | 3300014968 | Bacteria | 4465 |
| 76 | Ga0157379_10105513 | 3300014968 | Bacteria | 2529 |
| 77 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 78 | Ga0163161_10221988 | 3300017792 | Bacteria | 1464 |
| 79 | Ga0213876_10012724 | 3300021384 | Bacteria | 4474 |
| 80 | Ga0213876_10015354 | 3300021384 | Bacteria | 4054 |
| 81 | Ga0213875_10081440 | 3300021388 | Bacteria | 1510 |
| 82 | Ga0207682_10000038 | 3300025893 | Bacteria | 53885 |
| 83 | Ga0207642_10000010 | 3300025899 | Bacteria | 99207 |
| 84 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 85 | Ga0207684_10014299 | 3300025910 | Bacteria | 6847 |
| 86 | Ga0207684_10068549 | 3300025910 | Bacteria | 3014 |
| 87 | Ga0207707_10008795 | 3300025912 | Bacteria | 8763 |
| 88 | Ga0207693_10025109 | 3300025915 | Bacteria | 4727 |
| 89 | Ga0207652_10000142 | 3300025921 | Bacteria | 76696 |
| 90 | Ga0207646_10070956 | 3300025922 | Bacteria | 3111 |
| 91 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 92 | Ga0207687_10000133 | 3300025927 | Bacteria | 49874 |
| 93 | Ga0207687_10002795 | 3300025927 | Bacteria | 11839 |
| 94 | Ga0207706_10000062 | 3300025933 | Bacteria | 109344 |
| 95 | Ga0207686_10131522 | 3300025934 | Bacteria | 1717 |
| 96 | Ga0207709_10348523 | 3300025935 | Bacteria | 1117 |
| 97 | Ga0207669_10000800 | 3300025937 | Bacteria | 13464 |
| 98 | Ga0207691_10000609 | 3300025940 | Bacteria | 35618 |
| 99 | Ga0207661_10001316 | 3300025944 | Bacteria | 16623 |
| 100 | Ga0207661_10001925 | 3300025944 | Bacteria | 14265 |
| 101 | Ga0207661_10007862 | 3300025944 | Bacteria | 7599 |
| 102 | Ga0207651_10001295 | 3300025960 | Bacteria | 11260 |
| 103 | Ga0207712_10000037 | 3300025961 | Bacteria | 195906 |
| 104 | Ga0207640_10043231 | 3300025981 | Bacteria | 2879 |
| 105 | Ga0207677_10000464 | 3300026023 | Bacteria | 27017 |
| 106 | Ga0207703_10000128 | 3300026035 | Bacteria | 91359 |
| 107 | Ga0207703_10233581 | 3300026035 | Bacteria | 1650 |
| 108 | Ga0207678_10198703 | 3300026067 | Bacteria | 1714 |
| 109 | Ga0207702_10009876 | 3300026078 | Bacteria | 8000 |
| 110 | Ga0207641_10000265 | 3300026088 | Bacteria | 66346 |
| 111 | Ga0207648_10000271 | 3300026089 | Bacteria | 56175 |
| 112 | Ga0207676_10000065 | 3300026095 | Bacteria | 105757 |
| 113 | Ga0207675_100320519 | 3300026118 | Bacteria | 1513 |
| 114 | Ga0207428_10038354 | 3300027907 | Bacteria | 3895 |
| 115 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 116 | Ga0268264_10001576 | 3300028381 | Bacteria | 21143 |
| 117 | Ga0265319_1006073 | 3300028563 | Bacteria | 5661 |
| 118 | Ga0265338_10144471 | 3300028800 | Bacteria | 1858 |
| 119 | Ga0307513_10024472 | 3300031456 | Bacteria | 7026 |
| 120 | Ga0307514_10007963 | 3300031649 | Bacteria | 9086 |
| 121 | Ga0316576_10129364 | 3300031727 | Bacteria | 1899 |
| 122 | Ga0307416_100428615 | 3300032002 | Bacteria | 1369 |
| 123 | Ga0373955_0097823 | 3300035172 | Bacteria | 1681 |
| 124 | Ga0316574_0044388 | 3300035398 | Bacteria | 2750 |
| 125 | Ga0316574_0115933 | 3300035398 | Bacteria | 1718 |
| 126 | Ga0316584_0006364 | 3300036712 | Bacteria | 7997 |
| 127 | Ga0395900_0186140 | 3300037418 | Bacteria | 2108 |
| 128 | Ga0395898_0093062 | 3300037466 | Bacteria | 2898 |
| 129 | Ga0395898_0418800 | 3300037466 | Bacteria | 1277 |
| 130 | Ga0436364_0533237 | 3300037853 | Bacteria | 6391 |
| 131 | Ga0436364_1389129 | 3300037853 | Bacteria | 2373 |
| 132 | Ga0395901_0254216 | 3300038443 | Bacteria | 1830 |
| 133 | Ga0436365_0304553 | 3300039437 | Bacteria | 2721 |
| 134 | Ga0436365_0467385 | 3300039437 | Bacteria | 19786 |
| 135 | Ga0436365_0624248 | 3300039437 | Bacteria | 23419 |
| 136 | Ga0436365_0977683 | 3300039437 | Bacteria | 2109 |
| 137 | Ga0436365_1092743 | 3300039437 | Bacteria | 30495 |
| 138 | Ga0436365_1305569 | 3300039437 | Bacteria | 2733 |
| 139 | Ga0436362_0527307 | 3300039453 | Bacteria | 1574 |
| 140 | Ga0466969_0018975 | 3300044656 | Bacteria | 3579 |
| 141 | Ga0466961_0067963 | 3300044693 | Bacteria | 2263 |
| 142 | Ga0466963_0000585 | 3300044694 | Bacteria | 17350 |
| 143 | Ga0466963_0002585 | 3300044694 | Bacteria | 10157 |
| 144 | Ga0466960_0040340 | 3300044901 | Bacteria | 2207 |
| 145 | Ga0466960_0068896 | 3300044901 | Bacteria | 1756 |
| 146 | Ga0466959_0001893 | 3300045049 | Bacteria | 13172 |
| 147 | Ga0466958_0001111 | 3300045836 | Bacteria | 12393 |
| 148 | Ga0466967_0119853 | 3300045976 | Bacteria | 2429 |
| 149 | Ga0495592_0000600 | 3300046454 | Bacteria | 25385 |
| 150 | Ga0495592_0093234 | 3300046454 | Bacteria | 2157 |
| 151 | Ga0495603_0000074 | 3300046455 | Bacteria | 43833 |
| 152 | Ga0495603_0001152 | 3300046455 | Bacteria | 15404 |
| 153 | Ga0495603_0034508 | 3300046455 | Bacteria | 3041 |
| 154 | Ga0495641_0000020 | 3300046461 | Bacteria | 115404 |
| 155 | Ga0495641_0081015 | 3300046461 | Bacteria | 1454 |
| 156 | Ga0495651_0064559 | 3300046462 | Bacteria | 2798 |
| 157 | Ga0495582_0000013 | 3300046473 | Bacteria | 110372 |
| 158 | Ga0495662_0000021 | 3300046476 | Bacteria | 54969 |
| 159 | Ga0495594_0143239 | 3300046499 | Bacteria | 1356 |
| 160 | Ga0495608_0000854 | 3300046511 | Bacteria | 21319 |
| 161 | Ga0495608_0061285 | 3300046511 | Bacteria | 2474 |
| 162 | Ga0495618_0000058 | 3300046514 | Bacteria | 79638 |
| 163 | Ga0495620_0000392 | 3300046515 | Bacteria | 29558 |
| 164 | Ga0495628_0074689 | 3300046516 | Bacteria | 2640 |
| 165 | Ga0495628_0123839 | 3300046516 | Bacteria | 1981 |
| 166 | Ga0495630_0000540 | 3300046517 | Bacteria | 27715 |
| 167 | Ga0495644_0013250 | 3300046523 | Bacteria | 3167 |
| 168 | Ga0495640_0018492 | 3300046533 | Bacteria | 5165 |
| 169 | Ga0495586_0002460 | 3300046535 | Bacteria | 10046 |
| 170 | Ga0495645_0000043 | 3300046543 | Bacteria | 91036 |
| 171 | Ga0495645_0079918 | 3300046543 | Bacteria | 2348 |
| 172 | Ga0495634_0000601 | 3300046642 | Bacteria | 34818 |
| 173 | Ga0495635_0000026 | 3300046663 | Bacteria | 142517 |
| 174 | Ga0495657_0003172 | 3300046675 | Bacteria | 13551 |
| 175 | Ga0495599_0039088 | 3300046678 | Bacteria | 2981 |
| 176 | Ga0495647_0000027 | 3300046681 | Bacteria | 58315 |
| 177 | Ga0495658_0000009 | 3300046683 | Bacteria | 110421 |
| 178 | Ga0495669_0000103 | 3300046684 | Bacteria | 53749 |
| 179 | Ga0495613_0000157 | 3300046689 | Bacteria | 66401 |
| 180 | Ga0495624_0000012 | 3300046690 | Bacteria | 124128 |
| 181 | Ga0495649_0000694 | 3300046694 | Bacteria | 27480 |
| 182 | Ga0495600_0059224 | 3300046809 | Bacteria | 2501 |
| 183 | Ga0495604_0000346 | 3300047317 | Bacteria | 41587 |
| 184 | Ga0495672_0096480 | 3300047320 | Bacteria | 1612 |
| 185 | Ga0495676_0001347 | 3300047321 | Bacteria | 21095 |
| 186 | Ga0495680_0000671 | 3300047322 | Bacteria | 38307 |
| 187 | Ga0495680_0001488 | 3300047322 | Bacteria | 25207 |
| 188 | Ga0495602_0069326 | 3300048088 | Bacteria | 3023 |
| 189 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 190 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 191 | Ga0496102_0010397 | 3300048905 | Bacteria | 8010 |
| 192 | Ga0496103_0017508 | 3300048906 | Bacteria | 4289 |
| 193 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 194 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 195 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 196 | Ga0496106_0000873 | 3300048909 | Bacteria | 21961 |
| 197 | Ga0496106_0207089 | 3300048909 | Bacteria | 1562 |
| 198 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 199 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 200 | Ga0496108_0008338 | 3300048911 | Bacteria | 8406 |
| 201 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 202 | Ga0496109_0000248 | 3300048912 | Bacteria | 51780 |
| 203 | Ga0496110_0055716 | 3300048913 | Bacteria | 3479 |
| 204 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 205 | Ga0496113_0004755 | 3300048916 | Bacteria | 8385 |
| 206 | Ga0496113_0114608 | 3300048916 | Bacteria | 2102 |
| 207 | Ga0496114_0150118 | 3300048917 | Bacteria | 2021 |
| 208 | Ga0496115_0000263 | 3300048918 | Bacteria | 46550 |
| 209 | Ga0496117_0025130 | 3300048920 | Bacteria | 4689 |
| 210 | Ga0496118_0014088 | 3300048921 | Bacteria | 7503 |
| 211 | Ga0496119_0043579 | 3300048922 | Bacteria | 2833 |
| 212 | Ga0496120_0003139 | 3300048923 | Bacteria | 15468 |
| 213 | Ga0496121_0032174 | 3300048924 | Bacteria | 4774 |
| 214 | Ga0496125_0061969 | 3300048928 | Bacteria | 2995 |
| 215 | Ga0496125_0070431 | 3300048928 | Bacteria | 2738 |
| 216 | Ga0501032_0264631 | 3300049569 | Bacteria | 1115 |
| 217 | Ga0501038_0335198 | 3300049574 | Unclassified | 1181 |
| 218 | Ga0501040_0129755 | 3300049576 | Bacteria | 1772 |
| 219 | Ga0501042_0160626 | 3300049578 | Bacteria | 1621 |
| 220 | Ga0501070_0012918 | 3300049586 | Bacteria | 7038 |
| 221 | Ga0501075_0027911 | 3300049591 | Bacteria | 4162 |
| 222 | Ga0501075_0053287 | 3300049591 | Bacteria | 3043 |
| 223 | Ga0501081_0306159 | 3300049743 | Bacteria | 1166 |
| 224 | nmdc:mga03n38_86625_c1 | 3300050490 | Bacteria | 1483 |
| 225 | nmdc:mga00v17_180805_c1 | 3300050491 | Bacteria | 1361 |
| 226 | nmdc:mga00v17_21860_c1 | 3300050491 | Bacteria | 3683 |
| 227 | nmdc:mga00v17_57312_c2 | 3300050491 | Bacteria | 1842 |
| 228 | nmdc:mga05p37_193924_c1 | 3300050507 | Bacteria | 2464 |
| 229 | nmdc:mga05p37_19666_c1 | 3300050507 | Bacteria | 8170 |
| 230 | nmdc:mga0qj67_174943_c1 | 3300050509 | Bacteria | 1743 |
| 231 | nmdc:mga06r32_71448_c1 | 3300050510 | Bacteria | 3358 |
| 232 | nmdc:mga08y16_22209_c1 | 3300050511 | Bacteria | 6696 |
| 233 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 234 | nmdc:mga0a205_3267_c1 | 3300050515 | Bacteria | 14417 |
| 235 | nmdc:mga0a205_334870_c1 | 3300050515 | Bacteria | 1383 |
| 236 | Ga0495601_0000196 | 3300053077 | Bacteria | 32072 |
| 237 | Ga0495612_0006294 | 3300053078 | Bacteria | 4891 |
| 238 | Ga0495595_0000167 | 3300053084 | Bacteria | 25731 |
| 239 | Ga0495619_0000061 | 3300053085 | Bacteria | 88943 |
| 240 | Ga0495619_0000327 | 3300053085 | Bacteria | 33238 |
| 241 | Ga0495619_0003222 | 3300053085 | Bacteria | 10568 |
| 242 | Ga0500614_000095 | 3300053123 | Bacteria | 20668 |
| 243 | 2513600125 | 2513237088 | Bacteria | 6927906 |
| 244 | 2530649757 | 2529292951 | Bacteria | 6916614 |
| 245 | 2535520799 | 2534681796 | Bacteria | 7146037 |
| 246 | 2644627502 | 2643221714 | Bacteria | 9015452 |
| 247 | 2793364411 | 2791355266 | Bacteria | 7116587 |
| 248 | 2805938034 | 2802429606 | Bacteria | 6346811 |
| 249 | 2838665651 | 2838661181 | Bacteria | 7385261 |
| 250 | 2842290888 | 2842285085 | Bacteria | 6011953 |
| 251 | 2842408914 | 2842402390 | Bacteria | 6681310 |
| 252 | 2842415479 | 2842409023 | Bacteria | 6687331 |
| 253 | 2842421142 | 2842415677 | Bacteria | 6596907 |
| 254 | 2908759450 | 2908756301 | Bacteria | 8864324 |
| 255 | 2933019752 | 2933016740 | Bacteria | 6355406 |
| 256 | 2946072684 | 2946072368 | Bacteria | 8999607 |
| 257 | 8005550104 | 8005542996 | Bacteria | 7077758 |
| 258 | 8057579134 | 8057575449 | Bacteria | 7367519 |
| 259 | Ga0466966_0070830 | |||
| 260 | JGI24746J21847_1000062 | |||
| 261 | Ga0070683_100002626 | |||
| 262 | Ga0070683_100010895 | |||
| 263 | Ga0070683_100061504 | |||
| 264 | Ga0070677_10000013 | |||
| 265 | Ga0070682_100000077 | |||
| 266 | Ga0068868_100000467 | |||
| 267 | Ga0070691_10006337 | |||
| 268 | Ga0070674_100000063 | |||
| 269 | Ga0070673_100007764 | |||
| 270 | Ga0070659_100094166 | |||
| 271 | Ga0070662_100000015 | |||
| 272 | Ga0070681_10034512 | |||
| 273 | Ga0068867_100000814 | |||
| 274 | Ga0070706_100059066 | |||
| 275 | Ga0070706_100067884 | |||
| 276 | Ga0070707_100025611 | |||
| 277 | Ga0070698_100246892 | |||
| 278 | Ga0070699_100303492 | |||
| 279 | Ga0070679_100000069 | |||
| 280 | Ga0070684_100016077 | |||
| 281 | Ga0070684_100029658 | |||
| 282 | Ga0070684_100060374 | |||
| 283 | Ga0068853_100159137 | |||
| 284 | Ga0070672_100000175 | |||
| 285 | Ga0070693_100002758 | |||
| 286 | Ga0070665_100000068 | |||
| 287 | Ga0068856_100069387 | |||
| 288 | Ga0068866_10000011 | |||
| 289 | Ga0068861_100094754 | |||
| 290 | Ga0068863_100000136 | |||
| 291 | Ga0068858_100001203 | |||
| 292 | Ga0068860_100001635 | |||
| 293 | Ga0081455_10004899 | |||
| 294 | Ga0081455_10097350 | |||
| 295 | Ga0081538_10000023 | |||
| 296 | Ga0081538_10007272 | |||
| 297 | Ga0081538_10066305 | |||
| 298 | Ga0081540_1002959 | |||
| 299 | Ga0081540_1017419 | |||
| 300 | Ga0081540_1037540 | |||
| 301 | Ga0081539_10004231 | |||
| 302 | Ga0075363_100056741 | |||
| 303 | Ga0070715_10000011 | |||
| 304 | Ga0070712_100002580 | |||
| 305 | Ga0075428_100013716 | |||
| 306 | Ga0075431_100057406 | |||
| 307 | Ga0075433_10000057 | |||
| 308 | Ga0075433_10000968 | |||
| 309 | Ga0075429_100008952 | |||
| 310 | Ga0111539_10027064 | |||
| 311 | Ga0105245_10000667 | |||
| 312 | Ga0105245_10001759 | |||
| 313 | Ga0105247_10222682 | |||
| 314 | Ga0114129_10135942 | |||
| 315 | Ga0114129_10197607 | |||
| 316 | Ga0114129_10297264 | |||
| 317 | Ga0114129_10314579 | |||
| 318 | Ga0105243_10372173 | |||
| 319 | Ga0105237_10005339 | |||
| 320 | Ga0105238_10000172 | |||
| 321 | Ga0105249_10000235 | |||
| 322 | Ga0105249_10099644 | |||
| 323 | Ga0123341_1003530 | |||
| 324 | Ga0123341_1054452 | |||
| 325 | Ga0123342_1023658 | |||
| 326 | Ga0105239_10166747 | |||
| 327 | Ga0105246_10028564 | |||
| 328 | Ga0157374_10001879 | |||
| 329 | Ga0163162_10046138 | |||
| 330 | Ga0163162_10590022 | |||
| 331 | Ga0157375_10237788 | |||
| 332 | Ga0157380_10000550 | |||
| 333 | Ga0157379_10035197 | |||
| 334 | Ga0157379_10105513 | |||
| 335 | Ga0163161_10000018 | |||
| 336 | Ga0163161_10221988 | |||
| 337 | Ga0213876_10012724 | |||
| 338 | Ga0213876_10015354 | |||
| 339 | Ga0213875_10081440 | |||
| 340 | Ga0207682_10000038 | |||
| 341 | Ga0207642_10000010 | |||
| 342 | Ga0207685_10000001 | |||
| 343 | Ga0207684_10014299 | |||
| 344 | Ga0207684_10068549 | |||
| 345 | Ga0207707_10008795 | |||
| 346 | Ga0207693_10025109 | |||
| 347 | Ga0207652_10000142 | |||
| 348 | Ga0207646_10070956 | |||
| 349 | Ga0207694_10000004 | |||
| 350 | Ga0207687_10000133 | |||
| 351 | Ga0207687_10002795 | |||
| 352 | Ga0207706_10000062 | |||
| 353 | Ga0207686_10131522 | |||
| 354 | Ga0207709_10348523 | |||
| 355 | Ga0207669_10000800 | |||
| 356 | Ga0207691_10000609 | |||
| 357 | Ga0207661_10001316 | |||
| 358 | Ga0207661_10001925 | |||
| 359 | Ga0207661_10007862 | |||
| 360 | Ga0207651_10001295 | |||
| 361 | Ga0207712_10000037 | |||
| 362 | Ga0207640_10043231 | |||
| 363 | Ga0207677_10000464 | |||
| 364 | Ga0207703_10000128 | |||
| 365 | Ga0207703_10233581 | |||
| 366 | Ga0207678_10198703 | |||
| 367 | Ga0207702_10009876 | |||
| 368 | Ga0207641_10000265 | |||
| 369 | Ga0207648_10000271 | |||
| 370 | Ga0207676_10000065 | |||
| 371 | Ga0207675_100320519 | |||
| 372 | Ga0207428_10038354 | |||
| 373 | Ga0268266_10000020 | |||
| 374 | Ga0268264_10001576 | |||
| 375 | Ga0265319_1006073 | |||
| 376 | Ga0265338_10144471 | |||
| 377 | Ga0307513_10024472 | |||
| 378 | Ga0307514_10007963 | |||
| 379 | Ga0316576_10129364 | |||
| 380 | Ga0307416_100428615 | |||
| 381 | Ga0373955_0097823 | |||
| 382 | Ga0316574_0044388 | |||
| 383 | Ga0316574_0115933 | |||
| 384 | Ga0316584_0006364 | |||
| 385 | Ga0395900_0186140 | |||
| 386 | Ga0395898_0093062 | |||
| 387 | Ga0395898_0418800 | |||
| 388 | Ga0436364_0533237 | |||
| 389 | Ga0436364_1389129 | |||
| 390 | Ga0395901_0254216 | |||
| 391 | Ga0436365_0304553 | |||
| 392 | Ga0436365_0467385 | |||
| 393 | Ga0436365_0624248 | |||
| 394 | Ga0436365_0977683 | |||
| 395 | Ga0436365_1092743 | |||
| 396 | Ga0436365_1305569 | |||
| 397 | Ga0436362_0527307 | |||
| 398 | Ga0466969_0018975 | |||
| 399 | Ga0466961_0067963 | |||
| 400 | Ga0466963_0000585 | |||
| 401 | Ga0466963_0002585 | |||
| 402 | Ga0466960_0040340 | |||
| 403 | Ga0466960_0068896 | |||
| 404 | Ga0466959_0001893 | |||
| 405 | Ga0466958_0001111 | |||
| 406 | Ga0466967_0119853 | |||
| 407 | Ga0495592_0000600 | |||
| 408 | Ga0495592_0093234 | |||
| 409 | Ga0495603_0000074 | |||
| 410 | Ga0495603_0001152 | |||
| 411 | Ga0495603_0034508 | |||
| 412 | Ga0495641_0000020 | |||
| 413 | Ga0495641_0081015 | |||
| 414 | Ga0495651_0064559 | |||
| 415 | Ga0495582_0000013 | |||
| 416 | Ga0495662_0000021 | |||
| 417 | Ga0495594_0143239 | |||
| 418 | Ga0495608_0000854 | |||
| 419 | Ga0495608_0061285 | |||
| 420 | Ga0495618_0000058 | |||
| 421 | Ga0495620_0000392 | |||
| 422 | Ga0495628_0074689 | |||
| 423 | Ga0495628_0123839 | |||
| 424 | Ga0495630_0000540 | |||
| 425 | Ga0495644_0013250 | |||
| 426 | Ga0495640_0018492 | |||
| 427 | Ga0495586_0002460 | |||
| 428 | Ga0495645_0000043 | |||
| 429 | Ga0495645_0079918 | |||
| 430 | Ga0495634_0000601 | |||
| 431 | Ga0495635_0000026 | |||
| 432 | Ga0495657_0003172 | |||
| 433 | Ga0495599_0039088 | |||
| 434 | Ga0495647_0000027 | |||
| 435 | Ga0495658_0000009 | |||
| 436 | Ga0495669_0000103 | |||
| 437 | Ga0495613_0000157 | |||
| 438 | Ga0495624_0000012 | |||
| 439 | Ga0495649_0000694 | |||
| 440 | Ga0495600_0059224 | |||
| 441 | Ga0495604_0000346 | |||
| 442 | Ga0495672_0096480 | |||
| 443 | Ga0495676_0001347 | |||
| 444 | Ga0495680_0000671 | |||
| 445 | Ga0495680_0001488 | |||
| 446 | Ga0495602_0069326 | |||
| 447 | Ga0496100_0000007 | |||
| 448 | Ga0496101_0000013 | |||
| 449 | Ga0496102_0010397 | |||
| 450 | Ga0496103_0017508 | |||
| 451 | Ga0496104_0000013 | |||
| 452 | Ga0496105_0000006 | |||
| 453 | Ga0496106_0000006 | |||
| 454 | Ga0496106_0000873 | |||
| 455 | Ga0496106_0207089 | |||
| 456 | Ga0496107_0000007 | |||
| 457 | Ga0496108_0000001 | |||
| 458 | Ga0496108_0008338 | |||
| 459 | Ga0496109_0000006 | |||
| 460 | Ga0496109_0000248 | |||
| 461 | Ga0496110_0055716 | |||
| 462 | Ga0496112_0000003 | |||
| 463 | Ga0496113_0004755 | |||
| 464 | Ga0496113_0114608 | |||
| 465 | Ga0496114_0150118 | |||
| 466 | Ga0496115_0000263 | |||
| 467 | Ga0496117_0025130 | |||
| 468 | Ga0496118_0014088 | |||
| 469 | Ga0496119_0043579 | |||
| 470 | Ga0496120_0003139 | |||
| 471 | Ga0496121_0032174 | |||
| 472 | Ga0496125_0061969 | |||
| 473 | Ga0496125_0070431 | |||
| 474 | Ga0501032_0264631 | |||
| 475 | Ga0501038_0335198 | |||
| 476 | Ga0501040_0129755 | |||
| 477 | Ga0501042_0160626 | |||
| 478 | Ga0501070_0012918 | |||
| 479 | Ga0501075_0027911 | |||
| 480 | Ga0501075_0053287 | |||
| 481 | Ga0501081_0306159 | |||
| 482 | nmdc:mga03n38_86625_c1 | |||
| 483 | nmdc:mga00v17_180805_c1 | |||
| 484 | nmdc:mga00v17_21860_c1 | |||
| 485 | nmdc:mga00v17_57312_c2 | |||
| 486 | nmdc:mga05p37_193924_c1 | |||
| 487 | nmdc:mga05p37_19666_c1 | |||
| 488 | nmdc:mga0qj67_174943_c1 | |||
| 489 | nmdc:mga06r32_71448_c1 | |||
| 490 | nmdc:mga08y16_22209_c1 | |||
| 491 | nmdc:mga0a205_1_c2 | |||
| 492 | nmdc:mga0a205_3267_c1 | |||
| 493 | nmdc:mga0a205_334870_c1 | |||
| 494 | Ga0495601_0000196 | |||
| 495 | Ga0495612_0006294 | |||
| 496 | Ga0495595_0000167 | |||
| 497 | Ga0495619_0000061 | |||
| 498 | Ga0495619_0000327 | |||
| 499 | Ga0495619_0003222 | |||
| 500 | Ga0500614_000095 | |||
| 501 | 2513600125 | |||
| 502 | 2530649757 | |||
| 503 | 2535520799 | |||
| 504 | 2644627502 | |||
| 505 | 2793364411 | |||
| 506 | 2805938034 | |||
| 507 | 2838665651 | |||
| 508 | 2842290888 | |||
| 509 | 2842408914 | |||
| 510 | 2842415479 | |||
| 511 | 2842421142 | |||
| 512 | 2908759450 | |||
| 513 | 2933019752 | |||
| 514 | 2946072684 | |||
| 515 | 8005550104 | |||
| 516 | 8057579134 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gz3-assembly1.cif.gz_C | structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with nadp and aspartate-semialdehyde | 0.9737 | 5 | 342 |
| 3pwk-assembly1.cif.gz_B | crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2-aminoadipate | 0.973 | 5 | 342 |
| 2yv3-assembly1.cif.gz_B | crystal structure of aspartate semialdehyde dehydrogenase from thermus thermophilus hb8 | 0.9703 | 7 | 334 |
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.969 | 4 | 338 |
| 2r00-assembly2.cif.gz_C-2 | crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae | 0.9675 | 3 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gz3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9781 | 5 | 128 | 3.40.50.720 |
| 2yv3B02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9703 | 129 | 319 | 3.30.360.10 |
| af_P08390_5_140_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9689 | 6 | 139 | 3.40.50.720 |
| 2r00C02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9611 | 129 | 319 | 3.30.360.10 |
| 2yv3B02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9603 | 129 | 319 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L4Y693-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9913 | 240 | 338 |
GO:0008652
GO:0016620 GO:0046983 |
| AF-A0A1M3BJ56-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) | 0.9903 | 1 | 342 |
GO:0004073
GO:0009088 GO:0009089 GO:0009097 GO:0019877 GO:0046983 GO:0050661 GO:0051287 GO:0071266 |
| AF-A0A0F9BHP6-F1-model_v4 | aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) | 0.989 | 17 | 329 |
GO:0004073
GO:0009086 GO:0009088 GO:0009089 GO:0009097 GO:0019877 GO:0046983 GO:0050661 GO:0051287 |
| AF-A0A3A4PLF7-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) | 0.9865 | 4 | 338 |
GO:0004073
GO:0009088 GO:0009089 GO:0009097 GO:0019877 GO:0046983 GO:0050661 GO:0051287 GO:0071266 |
| AF-A0A535LQQ2-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) | 0.9864 | 17 | 342 |
GO:0004073
GO:0009086 GO:0009088 GO:0009089 GO:0009097 GO:0019877 GO:0046983 GO:0050661 GO:0051287 |