F368283

General Info

Members Datasets Scaffolds Average Seq Length
258 200 516 343

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0070830|Ga0466966_0070830_466_1578
Length 370
Sequence MSYRVAVVGATGNAGSKVLQVLSERALPISELVPFASARSEGKRLPFRGDELVCRSLSEDDLDGFDLAFLAAGGGVASEWAPRFVEHGALVIDKSSYWRMDPDVPLVVPEINPDAVTRALDARRIIASPNCSTMAMVMALYPLQREVGIEEIVVSTYQSVSGTGKAAVEELEAQTHALLHGTEPPQPTVYPQQIAFNVLPHVEKFKDDSGYTTEERKMMDETRKIFGVGEGELRITATCVRVPVINSHSEXIRIRTRRPVEVAQARELLAGAPGVVVVDDPQRASYPTAIGGADRDEVFVGRLRHDPGPGGERYLNLWVVGDNLRKGAATNAVQIAELLHERGLAGAAQRVAVAWQLCDDLHALIEQTDW

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
185 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
186 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
187 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
188 2643221714 Streptomyces sp. Root264 Isolate Unclassified
189 2791355266 Rhizobium sp. L43 Isolate Nodule
190 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
191 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
192 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
193 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
194 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
195 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
196 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
197 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
198 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
199 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
200 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 6.2
Rhizoplane 7.75
Rhizosphere 75.19
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0070830 3300044684 Bacteria 2185
2 JGI24746J21847_1000062 3300001977 Bacteria 11085
3 Ga0070683_100002626 3300005329 Bacteria 14369
4 Ga0070683_100010895 3300005329 Bacteria 7827
5 Ga0070683_100061504 3300005329 Bacteria 3492
6 Ga0070677_10000013 3300005333 Bacteria 53677
7 Ga0070682_100000077 3300005337 Bacteria 89055
8 Ga0068868_100000467 3300005338 Bacteria 26933
9 Ga0070691_10006337 3300005341 Bacteria 5406
10 Ga0070674_100000063 3300005356 Bacteria 47714
11 Ga0070673_100007764 3300005364 Bacteria 7096
12 Ga0070659_100094166 3300005366 Bacteria 2405
13 Ga0070662_100000015 3300005457 Bacteria 109379
14 Ga0070681_10034512 3300005458 Bacteria 5079
15 Ga0068867_100000814 3300005459 Bacteria 21051
16 Ga0070706_100059066 3300005467 Bacteria 3539
17 Ga0070706_100067884 3300005467 Bacteria 3298
18 Ga0070707_100025611 3300005468 Bacteria 5599
19 Ga0070698_100246892 3300005471 Unclassified 1718
20 Ga0070699_100303492 3300005518 Bacteria 1433
21 Ga0070679_100000069 3300005530 Bacteria 76557
22 Ga0070684_100016077 3300005535 Bacteria 6112
23 Ga0070684_100029658 3300005535 Bacteria 4639
24 Ga0070684_100060374 3300005535 Bacteria 3316
25 Ga0068853_100159137 3300005539 Bacteria 2037
26 Ga0070672_100000175 3300005543 Bacteria 35613
27 Ga0070693_100002758 3300005547 Bacteria 8083
28 Ga0070665_100000068 3300005548 Bacteria 204531
29 Ga0068856_100069387 3300005614 Bacteria 3485
30 Ga0068866_10000011 3300005718 Bacteria 97191
31 Ga0068861_100094754 3300005719 Bacteria 2363
32 Ga0068863_100000136 3300005841 Bacteria 78102
33 Ga0068858_100001203 3300005842 Bacteria 26823
34 Ga0068860_100001635 3300005843 Bacteria 24018
35 Ga0081455_10004899 3300005937 Bacteria 14838
36 Ga0081455_10097350 3300005937 Bacteria 2371
37 Ga0081538_10000023 3300005981 Bacteria 131101
38 Ga0081538_10007272 3300005981 Bacteria 9596
39 Ga0081538_10066305 3300005981 Bacteria 2025
40 Ga0081540_1002959 3300005983 Bacteria 13617
41 Ga0081540_1017419 3300005983 Bacteria 4449
42 Ga0081540_1037540 3300005983 Bacteria 2566
43 Ga0081539_10004231 3300005985 Bacteria 16154
44 Ga0075363_100056741 3300006048 Bacteria 2100
45 Ga0070715_10000011 3300006163 Bacteria 183857
46 Ga0070712_100002580 3300006175 Bacteria 11192
47 Ga0075428_100013716 3300006844 Bacteria 9023
48 Ga0075431_100057406 3300006847 Bacteria 4015
49 Ga0075433_10000057 3300006852 Bacteria 48581
50 Ga0075433_10000968 3300006852 Bacteria 20370
51 Ga0075429_100008952 3300006880 Bacteria 8696
52 Ga0111539_10027064 3300009094 Bacteria 7004
53 Ga0105245_10000667 3300009098 Bacteria 31104
54 Ga0105245_10001759 3300009098 Bacteria 19752
55 Ga0105247_10222682 3300009101 Bacteria 1278
56 Ga0114129_10135942 3300009147 Bacteria 3373
57 Ga0114129_10197607 3300009147 Bacteria 2726
58 Ga0114129_10297264 3300009147 Bacteria 2153
59 Ga0114129_10314579 3300009147 Bacteria 2083
60 Ga0105243_10372173 3300009148 Bacteria 1318
61 Ga0105237_10005339 3300009545 Bacteria 14538
62 Ga0105238_10000172 3300009551 Bacteria 70799
63 Ga0105249_10000235 3300009553 Bacteria 62630
64 Ga0105249_10099644 3300009553 Bacteria 2731
65 Ga0123341_1003530 3300009765 Bacteria 13433
66 Ga0123341_1054452 3300009765 Bacteria 2145
67 Ga0123342_1023658 3300009766 Bacteria 3954
68 Ga0105239_10166747 3300010375 Bacteria 2463
69 Ga0105246_10028564 3300011119 Bacteria 3665
70 Ga0157374_10001879 3300013296 Bacteria 17641
71 Ga0163162_10046138 3300013306 Bacteria 4367
72 Ga0163162_10590022 3300013306 Bacteria 1238
73 Ga0157375_10237788 3300013308 Bacteria 1981
74 Ga0157380_10000550 3300014326 Bacteria 23107
75 Ga0157379_10035197 3300014968 Bacteria 4465
76 Ga0157379_10105513 3300014968 Bacteria 2529
77 Ga0163161_10000018 3300017792 Bacteria 228801
78 Ga0163161_10221988 3300017792 Bacteria 1464
79 Ga0213876_10012724 3300021384 Bacteria 4474
80 Ga0213876_10015354 3300021384 Bacteria 4054
81 Ga0213875_10081440 3300021388 Bacteria 1510
82 Ga0207682_10000038 3300025893 Bacteria 53885
83 Ga0207642_10000010 3300025899 Bacteria 99207
84 Ga0207685_10000001 3300025905 Bacteria 604473
85 Ga0207684_10014299 3300025910 Bacteria 6847
86 Ga0207684_10068549 3300025910 Bacteria 3014
87 Ga0207707_10008795 3300025912 Bacteria 8763
88 Ga0207693_10025109 3300025915 Bacteria 4727
89 Ga0207652_10000142 3300025921 Bacteria 76696
90 Ga0207646_10070956 3300025922 Bacteria 3111
91 Ga0207694_10000004 3300025924 Bacteria 967075
92 Ga0207687_10000133 3300025927 Bacteria 49874
93 Ga0207687_10002795 3300025927 Bacteria 11839
94 Ga0207706_10000062 3300025933 Bacteria 109344
95 Ga0207686_10131522 3300025934 Bacteria 1717
96 Ga0207709_10348523 3300025935 Bacteria 1117
97 Ga0207669_10000800 3300025937 Bacteria 13464
98 Ga0207691_10000609 3300025940 Bacteria 35618
99 Ga0207661_10001316 3300025944 Bacteria 16623
100 Ga0207661_10001925 3300025944 Bacteria 14265
101 Ga0207661_10007862 3300025944 Bacteria 7599
102 Ga0207651_10001295 3300025960 Bacteria 11260
103 Ga0207712_10000037 3300025961 Bacteria 195906
104 Ga0207640_10043231 3300025981 Bacteria 2879
105 Ga0207677_10000464 3300026023 Bacteria 27017
106 Ga0207703_10000128 3300026035 Bacteria 91359
107 Ga0207703_10233581 3300026035 Bacteria 1650
108 Ga0207678_10198703 3300026067 Bacteria 1714
109 Ga0207702_10009876 3300026078 Bacteria 8000
110 Ga0207641_10000265 3300026088 Bacteria 66346
111 Ga0207648_10000271 3300026089 Bacteria 56175
112 Ga0207676_10000065 3300026095 Bacteria 105757
113 Ga0207675_100320519 3300026118 Bacteria 1513
114 Ga0207428_10038354 3300027907 Bacteria 3895
115 Ga0268266_10000020 3300028379 Bacteria 527065
116 Ga0268264_10001576 3300028381 Bacteria 21143
117 Ga0265319_1006073 3300028563 Bacteria 5661
118 Ga0265338_10144471 3300028800 Bacteria 1858
119 Ga0307513_10024472 3300031456 Bacteria 7026
120 Ga0307514_10007963 3300031649 Bacteria 9086
121 Ga0316576_10129364 3300031727 Bacteria 1899
122 Ga0307416_100428615 3300032002 Bacteria 1369
123 Ga0373955_0097823 3300035172 Bacteria 1681
124 Ga0316574_0044388 3300035398 Bacteria 2750
125 Ga0316574_0115933 3300035398 Bacteria 1718
126 Ga0316584_0006364 3300036712 Bacteria 7997
127 Ga0395900_0186140 3300037418 Bacteria 2108
128 Ga0395898_0093062 3300037466 Bacteria 2898
129 Ga0395898_0418800 3300037466 Bacteria 1277
130 Ga0436364_0533237 3300037853 Bacteria 6391
131 Ga0436364_1389129 3300037853 Bacteria 2373
132 Ga0395901_0254216 3300038443 Bacteria 1830
133 Ga0436365_0304553 3300039437 Bacteria 2721
134 Ga0436365_0467385 3300039437 Bacteria 19786
135 Ga0436365_0624248 3300039437 Bacteria 23419
136 Ga0436365_0977683 3300039437 Bacteria 2109
137 Ga0436365_1092743 3300039437 Bacteria 30495
138 Ga0436365_1305569 3300039437 Bacteria 2733
139 Ga0436362_0527307 3300039453 Bacteria 1574
140 Ga0466969_0018975 3300044656 Bacteria 3579
141 Ga0466961_0067963 3300044693 Bacteria 2263
142 Ga0466963_0000585 3300044694 Bacteria 17350
143 Ga0466963_0002585 3300044694 Bacteria 10157
144 Ga0466960_0040340 3300044901 Bacteria 2207
145 Ga0466960_0068896 3300044901 Bacteria 1756
146 Ga0466959_0001893 3300045049 Bacteria 13172
147 Ga0466958_0001111 3300045836 Bacteria 12393
148 Ga0466967_0119853 3300045976 Bacteria 2429
149 Ga0495592_0000600 3300046454 Bacteria 25385
150 Ga0495592_0093234 3300046454 Bacteria 2157
151 Ga0495603_0000074 3300046455 Bacteria 43833
152 Ga0495603_0001152 3300046455 Bacteria 15404
153 Ga0495603_0034508 3300046455 Bacteria 3041
154 Ga0495641_0000020 3300046461 Bacteria 115404
155 Ga0495641_0081015 3300046461 Bacteria 1454
156 Ga0495651_0064559 3300046462 Bacteria 2798
157 Ga0495582_0000013 3300046473 Bacteria 110372
158 Ga0495662_0000021 3300046476 Bacteria 54969
159 Ga0495594_0143239 3300046499 Bacteria 1356
160 Ga0495608_0000854 3300046511 Bacteria 21319
161 Ga0495608_0061285 3300046511 Bacteria 2474
162 Ga0495618_0000058 3300046514 Bacteria 79638
163 Ga0495620_0000392 3300046515 Bacteria 29558
164 Ga0495628_0074689 3300046516 Bacteria 2640
165 Ga0495628_0123839 3300046516 Bacteria 1981
166 Ga0495630_0000540 3300046517 Bacteria 27715
167 Ga0495644_0013250 3300046523 Bacteria 3167
168 Ga0495640_0018492 3300046533 Bacteria 5165
169 Ga0495586_0002460 3300046535 Bacteria 10046
170 Ga0495645_0000043 3300046543 Bacteria 91036
171 Ga0495645_0079918 3300046543 Bacteria 2348
172 Ga0495634_0000601 3300046642 Bacteria 34818
173 Ga0495635_0000026 3300046663 Bacteria 142517
174 Ga0495657_0003172 3300046675 Bacteria 13551
175 Ga0495599_0039088 3300046678 Bacteria 2981
176 Ga0495647_0000027 3300046681 Bacteria 58315
177 Ga0495658_0000009 3300046683 Bacteria 110421
178 Ga0495669_0000103 3300046684 Bacteria 53749
179 Ga0495613_0000157 3300046689 Bacteria 66401
180 Ga0495624_0000012 3300046690 Bacteria 124128
181 Ga0495649_0000694 3300046694 Bacteria 27480
182 Ga0495600_0059224 3300046809 Bacteria 2501
183 Ga0495604_0000346 3300047317 Bacteria 41587
184 Ga0495672_0096480 3300047320 Bacteria 1612
185 Ga0495676_0001347 3300047321 Bacteria 21095
186 Ga0495680_0000671 3300047322 Bacteria 38307
187 Ga0495680_0001488 3300047322 Bacteria 25207
188 Ga0495602_0069326 3300048088 Bacteria 3023
189 Ga0496100_0000007 3300048903 Bacteria 261266
190 Ga0496101_0000013 3300048904 Bacteria 261266
191 Ga0496102_0010397 3300048905 Bacteria 8010
192 Ga0496103_0017508 3300048906 Bacteria 4289
193 Ga0496104_0000013 3300048907 Bacteria 397163
194 Ga0496105_0000006 3300048908 Bacteria 393578
195 Ga0496106_0000006 3300048909 Bacteria 251855
196 Ga0496106_0000873 3300048909 Bacteria 21961
197 Ga0496106_0207089 3300048909 Bacteria 1562
198 Ga0496107_0000007 3300048910 Bacteria 257113
199 Ga0496108_0000001 3300048911 Bacteria 919044
200 Ga0496108_0008338 3300048911 Bacteria 8406
201 Ga0496109_0000006 3300048912 Bacteria 325513
202 Ga0496109_0000248 3300048912 Bacteria 51780
203 Ga0496110_0055716 3300048913 Bacteria 3479
204 Ga0496112_0000003 3300048915 Bacteria 660147
205 Ga0496113_0004755 3300048916 Bacteria 8385
206 Ga0496113_0114608 3300048916 Bacteria 2102
207 Ga0496114_0150118 3300048917 Bacteria 2021
208 Ga0496115_0000263 3300048918 Bacteria 46550
209 Ga0496117_0025130 3300048920 Bacteria 4689
210 Ga0496118_0014088 3300048921 Bacteria 7503
211 Ga0496119_0043579 3300048922 Bacteria 2833
212 Ga0496120_0003139 3300048923 Bacteria 15468
213 Ga0496121_0032174 3300048924 Bacteria 4774
214 Ga0496125_0061969 3300048928 Bacteria 2995
215 Ga0496125_0070431 3300048928 Bacteria 2738
216 Ga0501032_0264631 3300049569 Bacteria 1115
217 Ga0501038_0335198 3300049574 Unclassified 1181
218 Ga0501040_0129755 3300049576 Bacteria 1772
219 Ga0501042_0160626 3300049578 Bacteria 1621
220 Ga0501070_0012918 3300049586 Bacteria 7038
221 Ga0501075_0027911 3300049591 Bacteria 4162
222 Ga0501075_0053287 3300049591 Bacteria 3043
223 Ga0501081_0306159 3300049743 Bacteria 1166
224 nmdc:mga03n38_86625_c1 3300050490 Bacteria 1483
225 nmdc:mga00v17_180805_c1 3300050491 Bacteria 1361
226 nmdc:mga00v17_21860_c1 3300050491 Bacteria 3683
227 nmdc:mga00v17_57312_c2 3300050491 Bacteria 1842
228 nmdc:mga05p37_193924_c1 3300050507 Bacteria 2464
229 nmdc:mga05p37_19666_c1 3300050507 Bacteria 8170
230 nmdc:mga0qj67_174943_c1 3300050509 Bacteria 1743
231 nmdc:mga06r32_71448_c1 3300050510 Bacteria 3358
232 nmdc:mga08y16_22209_c1 3300050511 Bacteria 6696
233 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
234 nmdc:mga0a205_3267_c1 3300050515 Bacteria 14417
235 nmdc:mga0a205_334870_c1 3300050515 Bacteria 1383
236 Ga0495601_0000196 3300053077 Bacteria 32072
237 Ga0495612_0006294 3300053078 Bacteria 4891
238 Ga0495595_0000167 3300053084 Bacteria 25731
239 Ga0495619_0000061 3300053085 Bacteria 88943
240 Ga0495619_0000327 3300053085 Bacteria 33238
241 Ga0495619_0003222 3300053085 Bacteria 10568
242 Ga0500614_000095 3300053123 Bacteria 20668
243 2513600125 2513237088 Bacteria 6927906
244 2530649757 2529292951 Bacteria 6916614
245 2535520799 2534681796 Bacteria 7146037
246 2644627502 2643221714 Bacteria 9015452
247 2793364411 2791355266 Bacteria 7116587
248 2805938034 2802429606 Bacteria 6346811
249 2838665651 2838661181 Bacteria 7385261
250 2842290888 2842285085 Bacteria 6011953
251 2842408914 2842402390 Bacteria 6681310
252 2842415479 2842409023 Bacteria 6687331
253 2842421142 2842415677 Bacteria 6596907
254 2908759450 2908756301 Bacteria 8864324
255 2933019752 2933016740 Bacteria 6355406
256 2946072684 2946072368 Bacteria 8999607
257 8005550104 8005542996 Bacteria 7077758
258 8057579134 8057575449 Bacteria 7367519
259 Ga0466966_0070830
260 JGI24746J21847_1000062
261 Ga0070683_100002626
262 Ga0070683_100010895
263 Ga0070683_100061504
264 Ga0070677_10000013
265 Ga0070682_100000077
266 Ga0068868_100000467
267 Ga0070691_10006337
268 Ga0070674_100000063
269 Ga0070673_100007764
270 Ga0070659_100094166
271 Ga0070662_100000015
272 Ga0070681_10034512
273 Ga0068867_100000814
274 Ga0070706_100059066
275 Ga0070706_100067884
276 Ga0070707_100025611
277 Ga0070698_100246892
278 Ga0070699_100303492
279 Ga0070679_100000069
280 Ga0070684_100016077
281 Ga0070684_100029658
282 Ga0070684_100060374
283 Ga0068853_100159137
284 Ga0070672_100000175
285 Ga0070693_100002758
286 Ga0070665_100000068
287 Ga0068856_100069387
288 Ga0068866_10000011
289 Ga0068861_100094754
290 Ga0068863_100000136
291 Ga0068858_100001203
292 Ga0068860_100001635
293 Ga0081455_10004899
294 Ga0081455_10097350
295 Ga0081538_10000023
296 Ga0081538_10007272
297 Ga0081538_10066305
298 Ga0081540_1002959
299 Ga0081540_1017419
300 Ga0081540_1037540
301 Ga0081539_10004231
302 Ga0075363_100056741
303 Ga0070715_10000011
304 Ga0070712_100002580
305 Ga0075428_100013716
306 Ga0075431_100057406
307 Ga0075433_10000057
308 Ga0075433_10000968
309 Ga0075429_100008952
310 Ga0111539_10027064
311 Ga0105245_10000667
312 Ga0105245_10001759
313 Ga0105247_10222682
314 Ga0114129_10135942
315 Ga0114129_10197607
316 Ga0114129_10297264
317 Ga0114129_10314579
318 Ga0105243_10372173
319 Ga0105237_10005339
320 Ga0105238_10000172
321 Ga0105249_10000235
322 Ga0105249_10099644
323 Ga0123341_1003530
324 Ga0123341_1054452
325 Ga0123342_1023658
326 Ga0105239_10166747
327 Ga0105246_10028564
328 Ga0157374_10001879
329 Ga0163162_10046138
330 Ga0163162_10590022
331 Ga0157375_10237788
332 Ga0157380_10000550
333 Ga0157379_10035197
334 Ga0157379_10105513
335 Ga0163161_10000018
336 Ga0163161_10221988
337 Ga0213876_10012724
338 Ga0213876_10015354
339 Ga0213875_10081440
340 Ga0207682_10000038
341 Ga0207642_10000010
342 Ga0207685_10000001
343 Ga0207684_10014299
344 Ga0207684_10068549
345 Ga0207707_10008795
346 Ga0207693_10025109
347 Ga0207652_10000142
348 Ga0207646_10070956
349 Ga0207694_10000004
350 Ga0207687_10000133
351 Ga0207687_10002795
352 Ga0207706_10000062
353 Ga0207686_10131522
354 Ga0207709_10348523
355 Ga0207669_10000800
356 Ga0207691_10000609
357 Ga0207661_10001316
358 Ga0207661_10001925
359 Ga0207661_10007862
360 Ga0207651_10001295
361 Ga0207712_10000037
362 Ga0207640_10043231
363 Ga0207677_10000464
364 Ga0207703_10000128
365 Ga0207703_10233581
366 Ga0207678_10198703
367 Ga0207702_10009876
368 Ga0207641_10000265
369 Ga0207648_10000271
370 Ga0207676_10000065
371 Ga0207675_100320519
372 Ga0207428_10038354
373 Ga0268266_10000020
374 Ga0268264_10001576
375 Ga0265319_1006073
376 Ga0265338_10144471
377 Ga0307513_10024472
378 Ga0307514_10007963
379 Ga0316576_10129364
380 Ga0307416_100428615
381 Ga0373955_0097823
382 Ga0316574_0044388
383 Ga0316574_0115933
384 Ga0316584_0006364
385 Ga0395900_0186140
386 Ga0395898_0093062
387 Ga0395898_0418800
388 Ga0436364_0533237
389 Ga0436364_1389129
390 Ga0395901_0254216
391 Ga0436365_0304553
392 Ga0436365_0467385
393 Ga0436365_0624248
394 Ga0436365_0977683
395 Ga0436365_1092743
396 Ga0436365_1305569
397 Ga0436362_0527307
398 Ga0466969_0018975
399 Ga0466961_0067963
400 Ga0466963_0000585
401 Ga0466963_0002585
402 Ga0466960_0040340
403 Ga0466960_0068896
404 Ga0466959_0001893
405 Ga0466958_0001111
406 Ga0466967_0119853
407 Ga0495592_0000600
408 Ga0495592_0093234
409 Ga0495603_0000074
410 Ga0495603_0001152
411 Ga0495603_0034508
412 Ga0495641_0000020
413 Ga0495641_0081015
414 Ga0495651_0064559
415 Ga0495582_0000013
416 Ga0495662_0000021
417 Ga0495594_0143239
418 Ga0495608_0000854
419 Ga0495608_0061285
420 Ga0495618_0000058
421 Ga0495620_0000392
422 Ga0495628_0074689
423 Ga0495628_0123839
424 Ga0495630_0000540
425 Ga0495644_0013250
426 Ga0495640_0018492
427 Ga0495586_0002460
428 Ga0495645_0000043
429 Ga0495645_0079918
430 Ga0495634_0000601
431 Ga0495635_0000026
432 Ga0495657_0003172
433 Ga0495599_0039088
434 Ga0495647_0000027
435 Ga0495658_0000009
436 Ga0495669_0000103
437 Ga0495613_0000157
438 Ga0495624_0000012
439 Ga0495649_0000694
440 Ga0495600_0059224
441 Ga0495604_0000346
442 Ga0495672_0096480
443 Ga0495676_0001347
444 Ga0495680_0000671
445 Ga0495680_0001488
446 Ga0495602_0069326
447 Ga0496100_0000007
448 Ga0496101_0000013
449 Ga0496102_0010397
450 Ga0496103_0017508
451 Ga0496104_0000013
452 Ga0496105_0000006
453 Ga0496106_0000006
454 Ga0496106_0000873
455 Ga0496106_0207089
456 Ga0496107_0000007
457 Ga0496108_0000001
458 Ga0496108_0008338
459 Ga0496109_0000006
460 Ga0496109_0000248
461 Ga0496110_0055716
462 Ga0496112_0000003
463 Ga0496113_0004755
464 Ga0496113_0114608
465 Ga0496114_0150118
466 Ga0496115_0000263
467 Ga0496117_0025130
468 Ga0496118_0014088
469 Ga0496119_0043579
470 Ga0496120_0003139
471 Ga0496121_0032174
472 Ga0496125_0061969
473 Ga0496125_0070431
474 Ga0501032_0264631
475 Ga0501038_0335198
476 Ga0501040_0129755
477 Ga0501042_0160626
478 Ga0501070_0012918
479 Ga0501075_0027911
480 Ga0501075_0053287
481 Ga0501081_0306159
482 nmdc:mga03n38_86625_c1
483 nmdc:mga00v17_180805_c1
484 nmdc:mga00v17_21860_c1
485 nmdc:mga00v17_57312_c2
486 nmdc:mga05p37_193924_c1
487 nmdc:mga05p37_19666_c1
488 nmdc:mga0qj67_174943_c1
489 nmdc:mga06r32_71448_c1
490 nmdc:mga08y16_22209_c1
491 nmdc:mga0a205_1_c2
492 nmdc:mga0a205_3267_c1
493 nmdc:mga0a205_334870_c1
494 Ga0495601_0000196
495 Ga0495612_0006294
496 Ga0495595_0000167
497 Ga0495619_0000061
498 Ga0495619_0000327
499 Ga0495619_0003222
500 Ga0500614_000095
501 2513600125
502 2530649757
503 2535520799
504 2644627502
505 2793364411
506 2805938034
507 2838665651
508 2842290888
509 2842408914
510 2842415479
511 2842421142
512 2908759450
513 2933019752
514 2946072684
515 8005550104
516 8057579134

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

4

119

0.98

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

140

326

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gz3-assembly1.cif.gz_C structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with nadp and aspartate-semialdehyde 0.9737 5 342
3pwk-assembly1.cif.gz_B crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2-aminoadipate 0.973 5 342
2yv3-assembly1.cif.gz_B crystal structure of aspartate semialdehyde dehydrogenase from thermus thermophilus hb8 0.9703 7 334
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.969 4 338
2r00-assembly2.cif.gz_C-2 crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.9675 3 338
ID Description Score Start End Superfamily
2gz3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9781 5 128 3.40.50.720
2yv3B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9703 129 319 3.30.360.10
af_P08390_5_140_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9689 6 139 3.40.50.720
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9611 129 319 3.30.360.10
2yv3B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9603 129 319 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6L4Y693-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9913 240 338 GO:0008652
GO:0016620
GO:0046983
AF-A0A1M3BJ56-F1-model_v4 Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) 0.9903 1 342 GO:0004073
GO:0009088
GO:0009089
GO:0009097
GO:0019877
GO:0046983
GO:0050661
GO:0051287
GO:0071266
AF-A0A0F9BHP6-F1-model_v4 aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.989 17 329 GO:0004073
GO:0009086
GO:0009088
GO:0009089
GO:0009097
GO:0019877
GO:0046983
GO:0050661
GO:0051287
AF-A0A3A4PLF7-F1-model_v4 Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) 0.9865 4 338 GO:0004073
GO:0009088
GO:0009089
GO:0009097
GO:0019877
GO:0046983
GO:0050661
GO:0051287
GO:0071266
AF-A0A535LQQ2-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.9864 17 342 GO:0004073
GO:0009086
GO:0009088
GO:0009089
GO:0009097
GO:0019877
GO:0046983
GO:0050661
GO:0051287

Map