F368222

General Info

Members Datasets Scaffolds Average Seq Length
258 148 516 396

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0002849|Ga0373955_0002849_1547_2842
Length 431
Sequence MKLAQFEAHAIFPQISRRDGTIAPPPPASQSDENVMDAWFHCENPYPFVPDQVLDAADSVRASLPNRYCDPKVAAQLFEETLDEYLLCDELGLNITSSEHHAGINCLYGASPLVLGIVARQTKNIRLLSMGTLVTVRQDPVRVAEEYATADVISRGRLEIGFVKSGGTEMASGNANPIGVRERFWEAIDLIGKTLTTHDGPFSWEGKHFTHRHVNIWPRPYQDPHPPMWAATSDPADTAEIGRRGMVNIMVMRGVEVTKRAWASYRQARAEAGLSKPATDRFGYSAFVYVGDSDEEAVRVGSKLLWFVNTSMKSAPQYAKFLPGQTPAEFAPQLYRNPAAVGVGRPGRDSALNRPGVTAEMAMAGGRMYAGNPDTVYKQIMEFYDKVGGFGHLIMVGKTGFITHDEAVKNITLFAKEVLPRLREIKPVVTE

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
148 2841917233 Bosea caraganae RCAM04680 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.78
Rhizoplane 1.16
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0002849 3300035172 Bacteria 7591
2 Ga0065707_10016484 3300005295 Bacteria 3197
3 Ga0070671_100054808 3300005355 Bacteria 3316
4 Ga0070703_10005264 3300005406 Bacteria 3616
5 Ga0070703_10031507 3300005406 Bacteria 1604
6 Ga0070714_100325673 3300005435 Bacteria 1438
7 Ga0070710_10030396 3300005437 Bacteria 2906
8 Ga0070711_100031835 3300005439 Bacteria 3504
9 Ga0070711_100067736 3300005439 Bacteria 2506
10 Ga0070705_100119856 3300005440 Bacteria 1697
11 Ga0070694_100008315 3300005444 Bacteria 6346
12 Ga0070708_100017010 3300005445 Bacteria 6053
13 Ga0070708_100056833 3300005445 Bacteria 3482
14 Ga0070708_100088977 3300005445 Bacteria 2809
15 Ga0070708_100149305 3300005445 Bacteria 2173
16 Ga0070708_100208390 3300005445 Unclassified 1831
17 Ga0070681_10235694 3300005458 Unclassified 1744
18 Ga0070706_100005291 3300005467 Bacteria 12303
19 Ga0070706_100037690 3300005467 Bacteria 4464
20 Ga0070706_100064784 3300005467 Bacteria 3378
21 Ga0070706_100103119 3300005467 Bacteria 2652
22 Ga0070706_100345829 3300005467 Bacteria 1386
23 Ga0070707_100003626 3300005468 Bacteria 14563
24 Ga0070707_100023010 3300005468 Bacteria 5894
25 Ga0070707_100083795 3300005468 Bacteria 3081
26 Ga0070698_100003535 3300005471 Bacteria 17175
27 Ga0070698_100032702 3300005471 Bacteria 5386
28 Ga0070698_100063576 3300005471 Bacteria 3721
29 Ga0070698_100171744 3300005471 Bacteria 2109
30 Ga0070699_100012104 3300005518 Bacteria 7446
31 Ga0070699_100018002 3300005518 Bacteria 6068
32 Ga0070699_100024298 3300005518 Bacteria 5221
33 Ga0070699_100078828 3300005518 Bacteria 2868
34 Ga0070697_100011136 3300005536 Bacteria 7029
35 Ga0070697_100130309 3300005536 Bacteria 2109
36 Ga0070665_100024552 3300005548 Bacteria 6074
37 Ga0070704_100036669 3300005549 Bacteria 3343
38 Ga0068856_100058555 3300005614 Bacteria 3805
39 Ga0068859_100085010 3300005617 Bacteria 3209
40 Ga0068863_100146781 3300005841 Bacteria 2256
41 Ga0068858_100038291 3300005842 Bacteria 4448
42 Ga0081455_10015153 3300005937 Bacteria 7504
43 Ga0081538_10016433 3300005981 Bacteria 5674
44 Ga0081538_10078090 3300005981 Bacteria 1779
45 Ga0081540_1006126 3300005983 Bacteria 8834
46 Ga0081540_1010377 3300005983 Bacteria 6315
47 Ga0070712_100008278 3300006175 Bacteria 6534
48 Ga0070712_100218273 3300006175 Bacteria 1508
49 Ga0075428_100006205 3300006844 Bacteria 13296
50 Ga0075431_100033888 3300006847 Bacteria 5262
51 Ga0075431_100063840 3300006847 Bacteria 3801
52 Ga0075433_10037441 3300006852 Bacteria 4186
53 Ga0075433_10103551 3300006852 Bacteria 2521
54 Ga0075434_100009601 3300006871 Bacteria 9033
55 Ga0075434_100014577 3300006871 Bacteria 7518
56 Ga0075434_100022089 3300006871 Bacteria 6196
57 Ga0075434_100085680 3300006871 Bacteria 3150
58 Ga0075434_100149523 3300006871 Unclassified 2355
59 Ga0075429_100028235 3300006880 Bacteria 4871
60 Ga0075436_100030110 3300006914 Bacteria 3735
61 Ga0075436_100053438 3300006914 Bacteria 2789
62 Ga0097620_100085007 3300006931 Bacteria 3209
63 Ga0075435_100030928 3300007076 Bacteria 4214
64 Ga0075435_100072718 3300007076 Bacteria 2809
65 Ga0075435_100168154 3300007076 Bacteria 1849
66 Ga0099794_10007852 3300007265 Bacteria 4406
67 Ga0111539_10001660 3300009094 Bacteria 29729
68 Ga0111539_10002352 3300009094 Bacteria 25154
69 Ga0111539_10024045 3300009094 Bacteria 7483
70 Ga0114129_10089162 3300009147 Bacteria 4276
71 Ga0114129_10216111 3300009147 Bacteria 2589
72 Ga0114129_10221978 3300009147 Bacteria 2549
73 Ga0114129_10722633 3300009147 Bacteria 1278
74 Ga0105248_10050304 3300009177 Bacteria 4674
75 Ga0105248_10150412 3300009177 Bacteria 2626
76 Ga0105239_10138346 3300010375 Bacteria 2712
77 Ga0157374_10186580 3300013296 Bacteria 2028
78 Ga0163162_10171445 3300013306 Unclassified 2295
79 Ga0157375_10176207 3300013308 Bacteria 2288
80 Ga0163163_10025563 3300014325 Bacteria 5630
81 Ga0157379_10163838 3300014968 Bacteria 2007
82 Ga0213875_10000860 3300021388 Bacteria 22443
83 Ga0213875_10001761 3300021388 Bacteria 13554
84 Ga0213875_10002311 3300021388 Bacteria 11538
85 Ga0213875_10013457 3300021388 Bacteria 4015
86 Ga0207653_10006219 3300025885 Bacteria 3723
87 Ga0207692_10031824 3300025898 Bacteria 2529
88 Ga0207692_10067151 3300025898 Bacteria 1877
89 Ga0207699_10073858 3300025906 Bacteria 2093
90 Ga0207699_10094370 3300025906 Bacteria 1884
91 Ga0207699_10109122 3300025906 Bacteria 1770
92 Ga0207684_10001099 3300025910 Bacteria 30273
93 Ga0207684_10018270 3300025910 Bacteria 6002
94 Ga0207684_10020683 3300025910 Bacteria 5623
95 Ga0207684_10098173 3300025910 Bacteria 2501
96 Ga0207684_10099341 3300025910 Bacteria 2486
97 Ga0207684_10140103 3300025910 Unclassified 2079
98 Ga0207707_10217114 3300025912 Bacteria 1665
99 Ga0207707_10247245 3300025912 Bacteria 1550
100 Ga0207707_10264790 3300025912 Unclassified 1491
101 Ga0207693_10006385 3300025915 Bacteria 9770
102 Ga0207663_10043819 3300025916 Bacteria 2743
103 Ga0207646_10011048 3300025922 Bacteria 8769
104 Ga0207646_10029150 3300025922 Bacteria 5018
105 Ga0207646_10047002 3300025922 Bacteria 3872
106 Ga0207646_10126071 3300025922 Bacteria 2302
107 Ga0207681_10060965 3300025923 Bacteria 2592
108 Ga0207700_10221078 3300025928 Bacteria 1605
109 Ga0207664_10031122 3300025929 Bacteria 4080
110 Ga0207664_10187437 3300025929 Bacteria 1779
111 Ga0207644_10035620 3300025931 Bacteria 3489
112 Ga0207704_10114666 3300025938 Bacteria 1830
113 Ga0207665_10005809 3300025939 Bacteria 8208
114 Ga0207665_10055705 3300025939 Bacteria 2668
115 Ga0207711_10053472 3300025941 Bacteria 3463
116 Ga0207703_10060725 3300026035 Unclassified 3092
117 Ga0207703_10115677 3300026035 Bacteria 2295
118 Ga0207708_10054782 3300026075 Bacteria 3041
119 Ga0207708_10071340 3300026075 Unclassified 2661
120 Ga0207702_10118006 3300026078 Bacteria 2370
121 Ga0207648_10109007 3300026089 Bacteria 2431
122 Ga0209983_1009657 3300027665 Unclassified 1972
123 Ga0207428_10000013 3300027907 Bacteria 346742
124 Ga0207428_10004620 3300027907 Bacteria 13054
125 Ga0268266_10018526 3300028379 Bacteria 5933
126 Ga0265338_10165970 3300028800 Bacteria 1700
127 Ga0373953_0066065 3300035117 Bacteria 1486
128 Ga0373954_0028595 3300035118 Unclassified 2563
129 Ga0373957_0011846 3300035120 Plasmid 2922
130 Ga0373957_0059217 3300035120 Bacteria 1481
131 Ga0373931_0057778 3300035691 Bacteria 2081
132 Ga0373931_0079356 3300035691 Bacteria 1808
133 Ga0373935_0082730 3300035692 Bacteria 2089
134 Ga0373935_0093309 3300035692 Bacteria 1974
135 Ga0373927_0029571 3300035695 Unclassified 3572
136 Ga0373927_0043846 3300035695 Bacteria 2895
137 Ga0373933_0008143 3300035724 Bacteria 5718
138 Ga0373933_0016454 3300035724 Bacteria 4136
139 Ga0373933_0041966 3300035724 Bacteria 2702
140 Ga0373937_0001071 3300036401 Bacteria 23094
141 Ga0373937_0005356 3300036401 Bacteria 10973
142 Ga0373937_0075648 3300036401 Bacteria 3109
143 Ga0373937_0082730 3300036401 Bacteria 2970
144 Ga0373937_0206035 3300036401 Unclassified 1849
145 Ga0373937_0283289 3300036401 Bacteria 1565
146 Ga0373937_0287759 3300036401 Bacteria 1552
147 Ga0373925_0013423 3300037068 Bacteria 5928
148 Ga0373925_0188192 3300037068 Unclassified 1637
149 Ga0436364_0354566 3300037853 Bacteria 1517
150 Ga0436364_0457918 3300037853 Bacteria 19712
151 Ga0436364_0497143 3300037853 Bacteria 41875
152 Ga0436364_0517016 3300037853 Bacteria 3609
153 Ga0436364_0755832 3300037853 Bacteria 50614
154 Ga0436364_1171513 3300037853 Bacteria 122046
155 Ga0436365_0002647 3300039437 Unclassified 2970
156 Ga0436365_0025929 3300039437 Bacteria 3328
157 Ga0436360_0299780 3300039438 Bacteria 2021
158 Ga0436360_0564861 3300039438 Bacteria 1739
159 Ga0436360_0577150 3300039438 Unclassified 1475
160 Ga0436363_1620111 3300039450 Bacteria 1536
161 Ga0436362_0613308 3300039453 Bacteria 2274
162 Ga0436362_0881313 3300039453 Bacteria 3038
163 Ga0439441_003895 3300042001 Bacteria 2230
164 Ga0453683_0051795 3300044673 Bacteria 2571
165 Ga0451576_0022999 3300045051 Bacteria 6755
166 Ga0451576_0117175 3300045051 Unclassified 2772
167 Ga0466967_0252180 3300045976 Unclassified 1686
168 Ga0495592_0035708 3300046454 Bacteria 3745
169 Ga0495629_0157143 3300046459 Unclassified 1580
170 Ga0495651_0010306 3300046462 Bacteria 7182
171 Ga0495580_0002686 3300046472 Bacteria 15394
172 Ga0495662_0010262 3300046476 Bacteria 4591
173 Ga0495662_0093583 3300046476 Bacteria 1467
174 Ga0495608_0006521 3300046511 Bacteria 8276
175 Ga0495628_0133457 3300046516 Bacteria 1898
176 Ga0495652_0055403 3300046529 Bacteria 3372
177 Ga0495640_0012157 3300046533 Bacteria 6591
178 Ga0495586_0117137 3300046535 Bacteria 1486
179 Ga0495587_0001398 3300046536 Bacteria 16059
180 Ga0495645_0001188 3300046543 Bacteria 17779
181 Ga0495667_0004767 3300046559 Bacteria 9174
182 Ga0495667_0082036 3300046559 Bacteria 2096
183 Ga0495635_0016455 3300046663 Bacteria 5166
184 Ga0495657_0016801 3300046675 Bacteria 5322
185 Ga0495599_0008092 3300046678 Bacteria 6384
186 Ga0495600_0014802 3300046809 Bacteria 4921
187 Ga0495600_0021028 3300046809 Bacteria 4176
188 Ga0495600_0114481 3300046809 Bacteria 1756
189 Ga0495604_0003907 3300047317 Bacteria 11864
190 Ga0495674_0004585 3300047319 Bacteria 13288
191 Ga0495674_0116981 3300047319 Bacteria 2255
192 Ga0495680_0115567 3300047322 Bacteria 1985
193 Ga0495675_0001602 3300047444 Bacteria 13605
194 Ga0495684_0025674 3300047471 Bacteria 4527
195 Ga0495602_0000230 3300048088 Bacteria 52313
196 Ga0496102_0038133 3300048905 Bacteria 4336
197 Ga0496112_0039697 3300048915 Bacteria 4601
198 Ga0496112_0332927 3300048915 Bacteria 1462
199 Ga0501032_0000001 3300049569 Bacteria 422097
200 Ga0501033_0000546 3300049570 Bacteria 35016
201 Ga0501034_0000023 3300049571 Bacteria 263892
202 Ga0501036_0000634 3300049572 Bacteria 25617
203 Ga0501037_0000065 3300049573 Bacteria 96747
204 Ga0501038_0000043 3300049574 Bacteria 113010
205 Ga0501039_0000022 3300049575 Bacteria 160858
206 Ga0501040_0033613 3300049576 Bacteria 3475
207 Ga0501040_0050504 3300049576 Bacteria 2845
208 Ga0501041_0003797 3300049577 Bacteria 8695
209 Ga0501041_0067476 3300049577 Bacteria 2193
210 Ga0501042_0105285 3300049578 Bacteria 2030
211 Ga0501043_0000093 3300049579 Bacteria 80521
212 Ga0501070_0088250 3300049586 Bacteria 2567
213 Ga0501072_0036051 3300049588 Bacteria 3877
214 Ga0501076_0006907 3300049592 Bacteria 8248
215 Ga0501076_0243654 3300049592 Bacteria 1471
216 Ga0501077_0003646 3300049593 Bacteria 9264
217 Ga0501079_0013952 3300049741 Bacteria 6128
218 Ga0501080_0178233 3300049742 Bacteria 1957
219 Ga0501081_0005245 3300049743 Bacteria 8350
220 Ga0501035_0000234 3300049822 Bacteria 66162
221 Ga0501044_0017535 3300049823 Bacteria 7683
222 Ga0501044_0207878 3300049823 Bacteria 1913
223 Ga0501045_0048280 3300049824 Bacteria 3103
224 nmdc:mga05p37_136931_c1 3300050507 Bacteria 3002
225 nmdc:mga05p37_168305_c1 3300050507 Bacteria 2674
226 nmdc:mga05p37_182923_c1 3300050507 Bacteria 2549
227 nmdc:mga09592_9651_c1 3300050508 Bacteria 7842
228 nmdc:mga06r32_95133_c1 3300050510 Unclassified 2915
229 nmdc:mga08y16_1298_c1 3300050511 Bacteria 24803
230 nmdc:mga08y16_29457_c1 3300050511 Bacteria 5784
231 nmdc:mga08y16_361205_c1 3300050511 Unclassified 1491
232 nmdc:mga08y16_70948_c1 3300050511 Bacteria 3631
233 nmdc:mga0n895_106586_c1 3300050512 Bacteria 2816
234 nmdc:mga0n895_14271_c1 3300050512 Bacteria 7209
235 nmdc:mga0n895_17031_c1 3300050512 Bacteria 6688
236 nmdc:mga0n895_400276_c1 3300050512 Bacteria 1388
237 nmdc:mga0rr50_148877_c1 3300050513 Bacteria 1890
238 nmdc:mga08x19_30961_c1 3300050514 Bacteria 3363
239 nmdc:mga08x19_31193_c1 3300050514 Bacteria 3352
240 nmdc:mga08x19_64465_c1 3300050514 Bacteria 2379
241 nmdc:mga0a205_127314_c1 3300050515 Bacteria 2447
242 nmdc:mga0a205_147606_c1 3300050515 Bacteria 2252
243 nmdc:mga0a205_36309_c1 3300050515 Bacteria 4735
244 Ga0495601_0001753 3300053077 Bacteria 12008
245 Ga0495601_0004144 3300053077 Bacteria 8355
246 Ga0495601_0013392 3300053077 Bacteria 4931
247 Ga0495595_0014478 3300053084 Bacteria 3348
248 Ga0495595_0026561 3300053084 Bacteria 2573
249 Ga0495619_0021893 3300053085 Bacteria 4085
250 Ga0501084_0019054 3300054114 Bacteria 5715
251 Ga0501082_0006752 3300060353 Bacteria 9921
252 Ga0501082_0135973 3300060353 Bacteria 2132
253 Ga0530510_0005759 3300061734 Bacteria 8587
254 Ga0530510_0015179 3300061734 Bacteria 5439
255 Ga0530510_0024035 3300061734 Unclassified 4346
256 Ga0530510_0056691 3300061734 Bacteria 2831
257 2841916048 2841911363 Bacteria 6173697
258 2841921572 2841917233 Bacteria 6173500
259 Ga0373955_0002849
260 Ga0065707_10016484
261 Ga0070671_100054808
262 Ga0070703_10005264
263 Ga0070703_10031507
264 Ga0070714_100325673
265 Ga0070710_10030396
266 Ga0070711_100031835
267 Ga0070711_100067736
268 Ga0070705_100119856
269 Ga0070694_100008315
270 Ga0070708_100017010
271 Ga0070708_100056833
272 Ga0070708_100088977
273 Ga0070708_100149305
274 Ga0070708_100208390
275 Ga0070681_10235694
276 Ga0070706_100005291
277 Ga0070706_100037690
278 Ga0070706_100064784
279 Ga0070706_100103119
280 Ga0070706_100345829
281 Ga0070707_100003626
282 Ga0070707_100023010
283 Ga0070707_100083795
284 Ga0070698_100003535
285 Ga0070698_100032702
286 Ga0070698_100063576
287 Ga0070698_100171744
288 Ga0070699_100012104
289 Ga0070699_100018002
290 Ga0070699_100024298
291 Ga0070699_100078828
292 Ga0070697_100011136
293 Ga0070697_100130309
294 Ga0070665_100024552
295 Ga0070704_100036669
296 Ga0068856_100058555
297 Ga0068859_100085010
298 Ga0068863_100146781
299 Ga0068858_100038291
300 Ga0081455_10015153
301 Ga0081538_10016433
302 Ga0081538_10078090
303 Ga0081540_1006126
304 Ga0081540_1010377
305 Ga0070712_100008278
306 Ga0070712_100218273
307 Ga0075428_100006205
308 Ga0075431_100033888
309 Ga0075431_100063840
310 Ga0075433_10037441
311 Ga0075433_10103551
312 Ga0075434_100009601
313 Ga0075434_100014577
314 Ga0075434_100022089
315 Ga0075434_100085680
316 Ga0075434_100149523
317 Ga0075429_100028235
318 Ga0075436_100030110
319 Ga0075436_100053438
320 Ga0097620_100085007
321 Ga0075435_100030928
322 Ga0075435_100072718
323 Ga0075435_100168154
324 Ga0099794_10007852
325 Ga0111539_10001660
326 Ga0111539_10002352
327 Ga0111539_10024045
328 Ga0114129_10089162
329 Ga0114129_10216111
330 Ga0114129_10221978
331 Ga0114129_10722633
332 Ga0105248_10050304
333 Ga0105248_10150412
334 Ga0105239_10138346
335 Ga0157374_10186580
336 Ga0163162_10171445
337 Ga0157375_10176207
338 Ga0163163_10025563
339 Ga0157379_10163838
340 Ga0213875_10000860
341 Ga0213875_10001761
342 Ga0213875_10002311
343 Ga0213875_10013457
344 Ga0207653_10006219
345 Ga0207692_10031824
346 Ga0207692_10067151
347 Ga0207699_10073858
348 Ga0207699_10094370
349 Ga0207699_10109122
350 Ga0207684_10001099
351 Ga0207684_10018270
352 Ga0207684_10020683
353 Ga0207684_10098173
354 Ga0207684_10099341
355 Ga0207684_10140103
356 Ga0207707_10217114
357 Ga0207707_10247245
358 Ga0207707_10264790
359 Ga0207693_10006385
360 Ga0207663_10043819
361 Ga0207646_10011048
362 Ga0207646_10029150
363 Ga0207646_10047002
364 Ga0207646_10126071
365 Ga0207681_10060965
366 Ga0207700_10221078
367 Ga0207664_10031122
368 Ga0207664_10187437
369 Ga0207644_10035620
370 Ga0207704_10114666
371 Ga0207665_10005809
372 Ga0207665_10055705
373 Ga0207711_10053472
374 Ga0207703_10060725
375 Ga0207703_10115677
376 Ga0207708_10054782
377 Ga0207708_10071340
378 Ga0207702_10118006
379 Ga0207648_10109007
380 Ga0209983_1009657
381 Ga0207428_10000013
382 Ga0207428_10004620
383 Ga0268266_10018526
384 Ga0265338_10165970
385 Ga0373953_0066065
386 Ga0373954_0028595
387 Ga0373957_0011846
388 Ga0373957_0059217
389 Ga0373931_0057778
390 Ga0373931_0079356
391 Ga0373935_0082730
392 Ga0373935_0093309
393 Ga0373927_0029571
394 Ga0373927_0043846
395 Ga0373933_0008143
396 Ga0373933_0016454
397 Ga0373933_0041966
398 Ga0373937_0001071
399 Ga0373937_0005356
400 Ga0373937_0075648
401 Ga0373937_0082730
402 Ga0373937_0206035
403 Ga0373937_0283289
404 Ga0373937_0287759
405 Ga0373925_0013423
406 Ga0373925_0188192
407 Ga0436364_0354566
408 Ga0436364_0457918
409 Ga0436364_0497143
410 Ga0436364_0517016
411 Ga0436364_0755832
412 Ga0436364_1171513
413 Ga0436365_0002647
414 Ga0436365_0025929
415 Ga0436360_0299780
416 Ga0436360_0564861
417 Ga0436360_0577150
418 Ga0436363_1620111
419 Ga0436362_0613308
420 Ga0436362_0881313
421 Ga0439441_003895
422 Ga0453683_0051795
423 Ga0451576_0022999
424 Ga0451576_0117175
425 Ga0466967_0252180
426 Ga0495592_0035708
427 Ga0495629_0157143
428 Ga0495651_0010306
429 Ga0495580_0002686
430 Ga0495662_0010262
431 Ga0495662_0093583
432 Ga0495608_0006521
433 Ga0495628_0133457
434 Ga0495652_0055403
435 Ga0495640_0012157
436 Ga0495586_0117137
437 Ga0495587_0001398
438 Ga0495645_0001188
439 Ga0495667_0004767
440 Ga0495667_0082036
441 Ga0495635_0016455
442 Ga0495657_0016801
443 Ga0495599_0008092
444 Ga0495600_0014802
445 Ga0495600_0021028
446 Ga0495600_0114481
447 Ga0495604_0003907
448 Ga0495674_0004585
449 Ga0495674_0116981
450 Ga0495680_0115567
451 Ga0495675_0001602
452 Ga0495684_0025674
453 Ga0495602_0000230
454 Ga0496102_0038133
455 Ga0496112_0039697
456 Ga0496112_0332927
457 Ga0501032_0000001
458 Ga0501033_0000546
459 Ga0501034_0000023
460 Ga0501036_0000634
461 Ga0501037_0000065
462 Ga0501038_0000043
463 Ga0501039_0000022
464 Ga0501040_0033613
465 Ga0501040_0050504
466 Ga0501041_0003797
467 Ga0501041_0067476
468 Ga0501042_0105285
469 Ga0501043_0000093
470 Ga0501070_0088250
471 Ga0501072_0036051
472 Ga0501076_0006907
473 Ga0501076_0243654
474 Ga0501077_0003646
475 Ga0501079_0013952
476 Ga0501080_0178233
477 Ga0501081_0005245
478 Ga0501035_0000234
479 Ga0501044_0017535
480 Ga0501044_0207878
481 Ga0501045_0048280
482 nmdc:mga05p37_136931_c1
483 nmdc:mga05p37_168305_c1
484 nmdc:mga05p37_182923_c1
485 nmdc:mga09592_9651_c1
486 nmdc:mga06r32_95133_c1
487 nmdc:mga08y16_1298_c1
488 nmdc:mga08y16_29457_c1
489 nmdc:mga08y16_361205_c1
490 nmdc:mga08y16_70948_c1
491 nmdc:mga0n895_106586_c1
492 nmdc:mga0n895_14271_c1
493 nmdc:mga0n895_17031_c1
494 nmdc:mga0n895_400276_c1
495 nmdc:mga0rr50_148877_c1
496 nmdc:mga08x19_30961_c1
497 nmdc:mga08x19_31193_c1
498 nmdc:mga08x19_64465_c1
499 nmdc:mga0a205_127314_c1
500 nmdc:mga0a205_147606_c1
501 nmdc:mga0a205_36309_c1
502 Ga0495601_0001753
503 Ga0495601_0004144
504 Ga0495601_0013392
505 Ga0495595_0014478
506 Ga0495595_0026561
507 Ga0495619_0021893
508 Ga0501084_0019054
509 Ga0501082_0006752
510 Ga0501082_0135973
511 Ga0530510_0005759
512 Ga0530510_0015179
513 Ga0530510_0024035
514 Ga0530510_0056691
515 2841916048
516 2841921572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

63

389

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8246 1 387
1luc-assembly1.cif.gz_A bacterial luciferase 0.8239 1 388
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8175 1 387
1luc-assembly1.cif.gz_A bacterial luciferase 0.8121 1 388
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.808 1 381
ID Description Score Start End Superfamily
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8127 1 389 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8062 1 389 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7997 1 390 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7866 1 392 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.786 44 389 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A537SQA7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9418 1 390 GO:0004497
GO:0005829
GO:0016705
AF-A0A382RG77-F1-model_v4 Luciferase-like domain-containing protein 0.9147 1 281 GO:0005829
GO:0016705
AF-A0A6J7G7U4-F1-model_v4 Unannotated protein 0.9125 2 390 GO:0005829
GO:0016705
AF-A0A3C0TSD8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9098 1 247 GO:0005829
GO:0016705
AF-A0A7C3NTJ8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9054 1 225 GO:0004497
GO:0005829
GO:0016705

Map