F368175

General Info

Members Datasets Scaffolds Average Seq Length
258 141 257 392

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10001172|Ga0265320_1000117213
Length 411
Sequence MHQTPTNFLTMSKPAKPPFDTTRFIARHVAGLRRSGIRDFFELVAKTDGVISLGIGEPDFDTPQPIRDAVTTAMNTGKTHYTSNMGLPELRKEICRYAEGHFKISYRPDDEVLVTVGVSEGLDLTLRSLLNPGDKVMYHQPCYVSYAPSVDLVHAVGVPVATNAGDLFSLDAPALVAAWQPGCKLLLLNLPCNPTGGVCSRAQLERIARFAIEKDLIVVSDEIYSELVFEGTHTSIASLPGMRERTILLHGFSKAFAMTGFRLGYACGPAPLIEAMMKVHQYSMLCAPSISQEGALAALRLGDDATKFMRDRYRERRDLFVGRINAAGLACHLPRGSFYAFPSVTSTGLDEGEFARRLLTEQKVAVVPGTAFGDAGKGHVRACFTANEEKLTAACDRIERLLETLQPAKSA

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
87 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
100 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
101 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
102 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0.39
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000052 3300001977 Bacteria 11471
2 rootH2_10016362 3300003320 Bacteria 34626
3 rootH2_10017549 3300003320 Bacteria 13550
4 rootH2_10035238 3300003320 Bacteria 4913
5 rootL2_10145838 3300003322 Bacteria 2475
6 Ga0070658_10005700 3300005327 Bacteria 10101
7 Ga0070683_100000678 3300005329 Bacteria 24650
8 Ga0070683_100126679 3300005329 Bacteria 2414
9 Ga0070690_100000512 3300005330 Bacteria 19390
10 Ga0068869_100000104 3300005334 Bacteria 39890
11 Ga0068868_100044981 3300005338 Bacteria 3453
12 Ga0070661_100008323 3300005344 Bacteria 7166
13 Ga0070714_100005087 3300005435 Bacteria 10008
14 Ga0070711_100001928 3300005439 Bacteria 11616
15 Ga0070681_10044777 3300005458 Bacteria 4430
16 Ga0068867_100000046 3300005459 Bacteria 75834
17 Ga0070698_100049478 3300005471 Bacteria 4290
18 Ga0070679_100173445 3300005530 Bacteria 2129
19 Ga0070679_100362948 3300005530 Bacteria 1396
20 Ga0068853_100044273 3300005539 Bacteria 3810
21 Ga0068855_100015184 3300005563 Bacteria 9274
22 Ga0070664_100000038 3300005564 Bacteria 80276
23 Ga0068856_100000776 3300005614 Bacteria 34703
24 Ga0068856_100002854 3300005614 Bacteria 17673
25 Ga0068856_100031691 3300005614 Bacteria 5173
26 Ga0068856_100037264 3300005614 Bacteria 4771
27 Ga0068859_100021191 3300005617 Bacteria 6522
28 Ga0068859_100386579 3300005617 Bacteria 1495
29 Ga0081539_10000599 3300005985 Bacteria 73432
30 Ga0070717_10000084 3300006028 Bacteria 74786
31 Ga0097621_100000483 3300006237 Bacteria 27824
32 Ga0068871_100010076 3300006358 Bacteria 6875
33 Ga0097620_100021191 3300006931 Bacteria 6522
34 Ga0097620_100386501 3300006931 Bacteria 1495
35 Ga0105245_10214454 3300009098 Unclassified 1854
36 Ga0114129_10214611 3300009147 Bacteria 2599
37 Ga0105243_10000040 3300009148 Bacteria 160788
38 Ga0105238_10010510 3300009551 Bacteria 9291
39 Ga0157373_10000931 3300013100 Bacteria 22598
40 Ga0157370_10000042 3300013104 Bacteria 133711
41 Ga0163163_10183511 3300014325 Bacteria 2140
42 Ga0207645_10080892 3300025907 Bacteria 2083
43 Ga0207705_10004882 3300025909 Bacteria 10057
44 Ga0207663_10000914 3300025916 Bacteria 13474
45 Ga0207649_10004932 3300025920 Bacteria 7215
46 Ga0207652_10150462 3300025921 Bacteria 2084
47 Ga0207694_10042105 3300025924 Bacteria 3522
48 Ga0207694_10094750 3300025924 Bacteria 2359
49 Ga0207664_10005924 3300025929 Bacteria 8364
50 Ga0207709_10000075 3300025935 Bacteria 174404
51 Ga0207689_10000429 3300025942 Bacteria 39444
52 Ga0207661_10022566 3300025944 Bacteria 4743
53 Ga0207661_10046858 3300025944 Bacteria 3429
54 Ga0207679_10005024 3300025945 Bacteria 8263
55 Ga0207667_10123752 3300025949 Bacteria 2664
56 Ga0207677_10017198 3300026023 Bacteria 4305
57 Ga0207702_10001760 3300026078 Bacteria 21317
58 Ga0207702_10002511 3300026078 Bacteria 17303
59 Ga0207702_10370668 3300026078 Bacteria 1375
60 Ga0207648_10000208 3300026089 Bacteria 62964
61 Ga0207674_10157013 3300026116 Bacteria 2230
62 Ga0207698_10152301 3300026142 Bacteria 2009
63 Ga0265337_1000018 3300028556 Bacteria 76481
64 Ga0265337_1000283 3300028556 Bacteria 27564
65 Ga0265337_1001811 3300028556 Bacteria 10265
66 Ga0265337_1004581 3300028556 Bacteria 5699
67 Ga0265337_1017167 3300028556 Bacteria 2327
68 Ga0265326_10005705 3300028558 Bacteria 3915
69 Ga0265319_1000198 3300028563 Bacteria 45446
70 Ga0265319_1003000 3300028563 Bacteria 8967
71 Ga0265319_1003345 3300028563 Bacteria 8407
72 Ga0265319_1003728 3300028563 Bacteria 7828
73 Ga0265319_1025156 3300028563 Bacteria 2134
74 Ga0265334_10005160 3300028573 Bacteria 5724
75 Ga0265334_10006014 3300028573 Bacteria 5270
76 Ga0265334_10009707 3300028573 Bacteria 4068
77 Ga0265334_10018920 3300028573 Bacteria 2839
78 Ga0265318_10000216 3300028577 Bacteria 49980
79 Ga0265318_10000785 3300028577 Bacteria 21065
80 Ga0265318_10001964 3300028577 Bacteria 11439
81 Ga0265318_10010434 3300028577 Bacteria 4046
82 Ga0265318_10030245 3300028577 Bacteria 2107
83 Ga0265323_10000231 3300028653 Bacteria 32862
84 Ga0265323_10003024 3300028653 Bacteria 7492
85 Ga0265323_10009077 3300028653 Bacteria 4079
86 Ga0265323_10018013 3300028653 Bacteria 2738
87 Ga0265323_10022520 3300028653 Bacteria 2407
88 Ga0265323_10035916 3300028653 Bacteria 1824
89 Ga0265322_10001871 3300028654 Bacteria 6658
90 Ga0265336_10012959 3300028666 Bacteria 2791
91 Ga0265338_10000082 3300028800 Bacteria 176343
92 Ga0265338_10000556 3300028800 Bacteria 65347
93 Ga0265338_10001074 3300028800 Bacteria 45350
94 Ga0265338_10006899 3300028800 Bacteria 14286
95 Ga0265338_10015247 3300028800 Bacteria 8465
96 Ga0265338_10021501 3300028800 Bacteria 6724
97 Ga0265338_10035022 3300028800 Bacteria 4837
98 Ga0265338_10041929 3300028800 Bacteria 4272
99 Ga0265338_10060667 3300028800 Bacteria 3320
100 Ga0265338_10061802 3300028800 Bacteria 3280
101 Ga0265338_10134681 3300028800 Bacteria 1944
102 Ga0265338_10165747 3300028800 Bacteria 1701
103 Ga0265338_10261776 3300028800 Bacteria 1271
104 Ga0265324_10000332 3300029957 Bacteria 34791
105 Ga0265324_10004957 3300029957 Bacteria 5853
106 Ga0265324_10005630 3300029957 Bacteria 5363
107 Ga0265324_10012752 3300029957 Bacteria 3159
108 Ga0265324_10029530 3300029957 Bacteria 1927
109 Ga0265320_10000511 3300031240 Bacteria 30140
110 Ga0265320_10001172 3300031240 Bacteria 19308
111 Ga0265320_10002071 3300031240 Bacteria 14122
112 Ga0265320_10004048 3300031240 Bacteria 9640
113 Ga0265320_10005303 3300031240 Bacteria 8301
114 Ga0265320_10005970 3300031240 Bacteria 7741
115 Ga0265320_10008287 3300031240 Bacteria 6366
116 Ga0265320_10008810 3300031240 Bacteria 6138
117 Ga0265320_10068975 3300031240 Bacteria 1670
118 Ga0265325_10001452 3300031241 Bacteria 16651
119 Ga0265340_10005296 3300031247 Bacteria 7165
120 Ga0265340_10009008 3300031247 Bacteria 5372
121 Ga0265340_10018218 3300031247 Bacteria 3624
122 Ga0265331_10016407 3300031250 Bacteria 3889
123 Ga0265331_10021964 3300031250 Bacteria 3259
124 Ga0265327_10000088 3300031251 Bacteria 198019
125 Ga0265327_10001137 3300031251 Bacteria 36464
126 Ga0265327_10006329 3300031251 Bacteria 9507
127 Ga0265327_10011434 3300031251 Bacteria 6109
128 Ga0265327_10015544 3300031251 Bacteria 4903
129 Ga0265327_10024937 3300031251 Bacteria 3498
130 Ga0265327_10028656 3300031251 Bacteria 3180
131 Ga0265327_10054851 3300031251 Bacteria 2061
132 Ga0265316_10010741 3300031344 Bacteria 8318
133 Ga0265316_10012073 3300031344 Bacteria 7761
134 Ga0265316_10029176 3300031344 Bacteria 4540
135 Ga0265316_10042726 3300031344 Bacteria 3620
136 Ga0265316_10053217 3300031344 Bacteria 3173
137 Ga0307408_100000033 3300031548 Bacteria 212574
138 Ga0307408_100000036 3300031548 Bacteria 197635
139 Ga0307408_100012632 3300031548 Bacteria 5600
140 Ga0265313_10000337 3300031595 Bacteria 50974
141 Ga0265313_10000578 3300031595 Bacteria 38175
142 Ga0265313_10006399 3300031595 Bacteria 8348
143 Ga0265313_10006886 3300031595 Bacteria 7911
144 Ga0265313_10011826 3300031595 Bacteria 5395
145 Ga0265313_10017586 3300031595 Bacteria 4054
146 Ga0265313_10049558 3300031595 Bacteria 2020
147 Ga0307508_10000031 3300031616 Bacteria 163301
148 Ga0265314_10001896 3300031711 Bacteria 22389
149 Ga0265314_10002453 3300031711 Bacteria 18970
150 Ga0265314_10003110 3300031711 Bacteria 16330
151 Ga0265314_10018328 3300031711 Bacteria 5460
152 Ga0265314_10042083 3300031711 Bacteria 3262
153 Ga0265314_10080030 3300031711 Bacteria 2159
154 Ga0265314_10122376 3300031711 Bacteria 1636
155 Ga0265342_10016916 3300031712 Bacteria 4752
156 Ga0265342_10025908 3300031712 Bacteria 3681
157 Ga0265342_10049587 3300031712 Bacteria 2512
158 Ga0265342_10094268 3300031712 Bacteria 1713
159 Ga0316576_10001046 3300031727 Bacteria 14354
160 Ga0307413_10133470 3300031824 Bacteria 1703
161 Ga0307410_10000008 3300031852 Bacteria 93917
162 Ga0307406_10007301 3300031901 Bacteria 6121
163 Ga0307407_10000048 3300031903 Bacteria 58501
164 Ga0307407_10009611 3300031903 Bacteria 4514
165 Ga0307412_10000052 3300031911 Bacteria 150085
166 Ga0307412_10069634 3300031911 Bacteria 2395
167 Ga0307409_100000274 3300031995 Bacteria 20897
168 Ga0307409_100044947 3300031995 Bacteria 3330
169 Ga0307416_100000022 3300032002 Bacteria 188660
170 Ga0307416_100000093 3300032002 Bacteria 60283
171 Ga0307414_10000006 3300032004 Bacteria 451918
172 Ga0307414_10248931 3300032004 Bacteria 1476
173 Ga0307411_10068878 3300032005 Bacteria 2387
174 Ga0307411_10190280 3300032005 Bacteria 1566
175 Ga0373930_0000719 3300034816 Bacteria 4671
176 Ga0373950_0003660 3300034818 Bacteria 2211
177 Ga0373928_0001050 3300035084 Bacteria 5448
178 Ga0373929_0000169 3300035085 Bacteria 11499
179 Ga0373949_0001259 3300035090 Bacteria 7411
180 Ga0373932_0000001 3300035112 Bacteria 1459067
181 Ga0373945_0001939 3300035116 Bacteria 6422
182 Ga0373954_0028959 3300035118 Bacteria 2549
183 Ga0373954_0088475 3300035118 Bacteria 1485
184 Ga0373956_0040478 3300035119 Bacteria 2067
185 Ga0373955_0146045 3300035172 Bacteria 1390
186 Ga0373962_0007562 3300035242 Bacteria 2664
187 Ga0373931_0000002 3300035691 Bacteria 599830
188 Ga0373927_0061498 3300035695 Bacteria 2429
189 Ga0373925_0000552 3300037068 Bacteria 36801
190 Ga0373925_0034167 3300037068 Bacteria 3748
191 Ga0395905_0000015 3300037471 Bacteria 393880
192 Ga0400483_269473 3300039062 Bacteria 11569
193 Ga0439445_0004239 3300042004 Bacteria 3246
194 Ga0450888_002775 3300042126 Bacteria 1745
195 Ga0450890_000039 3300042127 Bacteria 29389
196 Ga0450892_000238 3300042130 Bacteria 6604
197 Ga0450893_0001825 3300042532 Bacteria 3279
198 Ga0450893_0003355 3300042532 Bacteria 2522
199 Ga0451577_0000012 3300042876 Bacteria 575467
200 Ga0451577_0001016 3300042876 Bacteria 40745
201 Ga0451577_0002463 3300042876 Bacteria 22008
202 Ga0451577_0222961 3300042876 Bacteria 1704
203 Ga0453683_0000631 3300044673 Bacteria 38394
204 Ga0466961_0078581 3300044693 Bacteria 2090
205 Ga0453684_0000001 3300044712 Bacteria 2623166
206 Ga0453684_0005778 3300044712 Bacteria 24142
207 Ga0453684_0275008 3300044712 Bacteria 1923
208 Ga0453684_0523118 3300044712 Bacteria 1310
209 Ga0451576_0000750 3300045051 Bacteria 64788
210 Ga0451576_0000939 3300045051 Bacteria 54953
211 Ga0451576_0058014 3300045051 Bacteria 4046
212 Ga0451576_0062785 3300045051 Bacteria 3872
213 Ga0451576_0248963 3300045051 Bacteria 1857
214 Ga0466967_0151801 3300045976 Bacteria 2166
215 Ga0495608_0197982 3300046511 Bacteria 1267
216 Ga0495618_0010507 3300046514 Bacteria 5600
217 Ga0495586_0027048 3300046535 Bacteria 3069
218 Ga0495622_0001645 3300046557 Bacteria 11036
219 Ga0495667_0088424 3300046559 Bacteria 2008
220 Ga0495634_0056795 3300046642 Bacteria 2614
221 Ga0495635_0045681 3300046663 Bacteria 3022
222 Ga0495613_0001993 3300046689 Bacteria 15501
223 Ga0495674_0035703 3300047319 Bacteria 4482
224 Ga0495680_0014638 3300047322 Bacteria 6786
225 Ga0495684_0116738 3300047471 Bacteria 2012
226 Ga0496115_0000873 3300048918 Bacteria 21909
227 Ga0501031_0026308 3300049568 Bacteria 3793
228 Ga0501032_0000259 3300049569 Bacteria 44300
229 Ga0501032_0000981 3300049569 Bacteria 23047
230 Ga0501033_0002906 3300049570 Bacteria 14334
231 Ga0501033_0061838 3300049570 Bacteria 2759
232 Ga0501034_0027755 3300049571 Bacteria 5756
233 Ga0501034_0050833 3300049571 Bacteria 4180
234 Ga0501036_0030662 3300049572 Bacteria 4541
235 Ga0501036_0046832 3300049572 Bacteria 3662
236 Ga0501037_0199199 3300049573 Bacteria 1415
237 Ga0501038_0006964 3300049574 Bacteria 10439
238 Ga0501042_0002122 3300049578 Bacteria 12024
239 Ga0501043_0058948 3300049579 Bacteria 3012
240 Ga0501046_0001271 3300049580 Bacteria 24428
241 Ga0501047_0043792 3300049581 Bacteria 4323
242 Ga0501047_0137370 3300049581 Bacteria 2324
243 Ga0501047_0178379 3300049581 Bacteria 1991
244 Ga0501048_0036787 3300049582 Bacteria 3517
245 Ga0501073_0091779 3300049589 Bacteria 2111
246 Ga0501227_001454 3300049665 Bacteria 5289
247 Ga0501243_001107 3300049675 Bacteria 3815
248 Ga0501080_0020585 3300049742 Bacteria 6109
249 Ga0501080_0122011 3300049742 Bacteria 2414
250 Ga0501035_0000441 3300049822 Bacteria 46562
251 Ga0501035_0018716 3300049822 Bacteria 6379
252 Ga0501044_0000358 3300049823 Bacteria 57147
253 Ga0501044_0008224 3300049823 Bacteria 11446
254 Ga0501044_0069163 3300049823 Bacteria 3595
255 Ga0500559_0004367 3300053136 Bacteria 6739
256 Ga0500568_0015415 3300053139 Bacteria 3423
257 Ga0500616_0015476 3300053153 Bacteria 4360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10214611 Ga0114129_102146113 337
2 3300047471 Ga0495684_0116738 Ga0495684_0116738_907_1998 359
3 3300053153 Ga0500616_0015476 Ga0500616_0015476_2208_3383 366
4 3300031727 Ga0316576_10001046 Ga0316576_100010466 367
5 3300049589 Ga0501073_0091779 Ga0501073_0091779_784_1974 367
6 3300035172 Ga0373955_0146045 Ga0373955_0146045_13_1155 376
7 3300039062 Ga0400483_269473 Ga0400483_269473_450_1646 377
8 3300005471 Ga0070698_100049478 Ga0070698_1000494784 383
9 3300005985 Ga0081539_10000599 Ga0081539_1000059913 383
10 iso_pu_bacteria 2786546940 2788434751 383
11 3300028556 Ga0265337_1000283 Ga0265337_100028327 385
12 3300028563 Ga0265319_1003000 Ga0265319_10030002 385
13 3300028573 Ga0265334_10006014 Ga0265334_100060144 385
14 3300028577 Ga0265318_10001964 Ga0265318_1000196413 385
15 3300028577 Ga0265318_10010434 Ga0265318_100104343 385
16 3300028577 Ga0265318_10030245 Ga0265318_100302452 385
17 3300028800 Ga0265338_10000082 Ga0265338_1000008247 385
18 3300029957 Ga0265324_10004957 Ga0265324_100049572 385
19 3300031240 Ga0265320_10004048 Ga0265320_100040487 385
20 3300031240 Ga0265320_10005303 Ga0265320_100053034 385
21 3300031240 Ga0265320_10008810 Ga0265320_100088105 385
22 3300031241 Ga0265325_10001452 Ga0265325_1000145216 385
23 3300031247 Ga0265340_10018218 Ga0265340_100182181 385
24 3300031344 Ga0265316_10029176 Ga0265316_100291763 385
25 3300031344 Ga0265316_10053217 Ga0265316_100532173 385
26 3300031595 Ga0265313_10000337 Ga0265313_1000033728 385
27 3300031595 Ga0265313_10000578 Ga0265313_1000057820 385
28 3300031711 Ga0265314_10080030 Ga0265314_100800302 385
29 3300025907 Ga0207645_10080892 Ga0207645_100808922 386
30 3300003320 rootH2_10016362 rootH2_100163629 387
31 3300003320 rootH2_10035238 rootH2_100352383 387
32 3300003322 rootL2_10145838 rootL2_101458381 387
33 3300005329 Ga0070683_100000678 Ga0070683_10000067820 387
34 3300005329 Ga0070683_100126679 Ga0070683_1001266791 387
35 3300005330 Ga0070690_100000512 Ga0070690_1000005122 387
36 3300005334 Ga0068869_100000104 Ga0068869_10000010414 387
37 3300005338 Ga0068868_100044981 Ga0068868_1000449812 387
38 3300005435 Ga0070714_100005087 Ga0070714_10000508710 387
39 3300005439 Ga0070711_100001928 Ga0070711_10000192810 387
40 3300005458 Ga0070681_10044777 Ga0070681_100447773 387
41 3300005530 Ga0070679_100173445 Ga0070679_1001734452 387
42 3300005530 Ga0070679_100362948 Ga0070679_1003629481 387
43 3300005539 Ga0068853_100044273 Ga0068853_1000442733 387
44 3300005563 Ga0068855_100015184 Ga0068855_1000151845 387
45 3300005614 Ga0068856_100000776 Ga0068856_10000077618 387
46 3300005614 Ga0068856_100002854 Ga0068856_1000028548 387
47 3300005614 Ga0068856_100031691 Ga0068856_1000316912 387
48 3300005614 Ga0068856_100037264 Ga0068856_1000372644 387
49 3300005617 Ga0068859_100021191 Ga0068859_1000211912 387
50 3300005617 Ga0068859_100386579 Ga0068859_1003865792 387
51 3300006028 Ga0070717_10000084 Ga0070717_1000008426 387
52 3300006237 Ga0097621_100000483 Ga0097621_10000048312 387
53 3300006358 Ga0068871_100010076 Ga0068871_1000100765 387
54 3300006931 Ga0097620_100021191 Ga0097620_1000211918 387
55 3300006931 Ga0097620_100386501 Ga0097620_1003865012 387
56 3300009098 Ga0105245_10214454 Ga0105245_102144541 387
57 3300009551 Ga0105238_10010510 Ga0105238_100105109 387
58 3300014325 Ga0163163_10183511 Ga0163163_101835112 387
59 3300025916 Ga0207663_10000914 Ga0207663_100009142 387
60 3300025921 Ga0207652_10150462 Ga0207652_101504621 387
61 3300025924 Ga0207694_10042105 Ga0207694_100421056 387
62 3300025924 Ga0207694_10094750 Ga0207694_100947502 387
63 3300025929 Ga0207664_10005924 Ga0207664_100059248 387
64 3300025942 Ga0207689_10000429 Ga0207689_1000042927 387
65 3300025944 Ga0207661_10022566 Ga0207661_100225662 387
66 3300025944 Ga0207661_10046858 Ga0207661_100468583 387
67 3300025949 Ga0207667_10123752 Ga0207667_101237522 387
68 3300026023 Ga0207677_10017198 Ga0207677_100171983 387
69 3300026078 Ga0207702_10001760 Ga0207702_1000176016 387
70 3300026078 Ga0207702_10002511 Ga0207702_100025113 387
71 3300026078 Ga0207702_10370668 Ga0207702_103706682 387
72 3300026116 Ga0207674_10157013 Ga0207674_101570132 387
73 3300028556 Ga0265337_1000018 Ga0265337_100001862 387
74 3300028556 Ga0265337_1001811 Ga0265337_10018113 387
75 3300028556 Ga0265337_1004581 Ga0265337_10045812 387
76 3300028556 Ga0265337_1017167 Ga0265337_10171672 387
77 3300028558 Ga0265326_10005705 Ga0265326_100057052 387
78 3300028563 Ga0265319_1000198 Ga0265319_100019832 387
79 3300028563 Ga0265319_1003345 Ga0265319_10033456 387
80 3300028563 Ga0265319_1003728 Ga0265319_10037283 387
81 3300028563 Ga0265319_1025156 Ga0265319_10251562 387
82 3300028573 Ga0265334_10005160 Ga0265334_100051602 387
83 3300028573 Ga0265334_10009707 Ga0265334_100097073 387
84 3300028573 Ga0265334_10018920 Ga0265334_100189204 387
85 3300028577 Ga0265318_10000216 Ga0265318_1000021640 387
86 3300028577 Ga0265318_10000785 Ga0265318_100007852 387
87 3300028653 Ga0265323_10000231 Ga0265323_1000023121 387
88 3300028653 Ga0265323_10003024 Ga0265323_100030242 387
89 3300028653 Ga0265323_10009077 Ga0265323_100090772 387
90 3300028653 Ga0265323_10018013 Ga0265323_100180131 387
91 3300028653 Ga0265323_10022520 Ga0265323_100225203 387
92 3300028653 Ga0265323_10035916 Ga0265323_100359162 387
93 3300028654 Ga0265322_10001871 Ga0265322_100018717 387
94 3300028666 Ga0265336_10012959 Ga0265336_100129592 387
95 3300028800 Ga0265338_10000556 Ga0265338_1000055612 387
96 3300028800 Ga0265338_10001074 Ga0265338_1000107419 387
97 3300028800 Ga0265338_10006899 Ga0265338_100068993 387
98 3300028800 Ga0265338_10015247 Ga0265338_100152474 387
99 3300028800 Ga0265338_10021501 Ga0265338_100215019 387
100 3300028800 Ga0265338_10035022 Ga0265338_100350223 387
101 3300028800 Ga0265338_10041929 Ga0265338_100419293 387
102 3300028800 Ga0265338_10060667 Ga0265338_100606673 387
103 3300028800 Ga0265338_10061802 Ga0265338_100618024 387
104 3300028800 Ga0265338_10134681 Ga0265338_101346811 387
105 3300028800 Ga0265338_10165747 Ga0265338_101657472 387
106 3300028800 Ga0265338_10261776 Ga0265338_102617761 387
107 3300029957 Ga0265324_10000332 Ga0265324_1000033228 387
108 3300029957 Ga0265324_10005630 Ga0265324_100056301 387
109 3300029957 Ga0265324_10012752 Ga0265324_100127522 387
110 3300029957 Ga0265324_10029530 Ga0265324_100295302 387
111 3300031240 Ga0265320_10000511 Ga0265320_100005115 387
112 3300031240 Ga0265320_10001172 Ga0265320_1000117213 387
113 3300031240 Ga0265320_10002071 Ga0265320_100020715 387
114 3300031240 Ga0265320_10005970 Ga0265320_100059703 387
115 3300031240 Ga0265320_10008287 Ga0265320_100082872 387
116 3300031240 Ga0265320_10068975 Ga0265320_100689752 387
117 3300031247 Ga0265340_10005296 Ga0265340_100052963 387
118 3300031247 Ga0265340_10009008 Ga0265340_100090083 387
119 3300031250 Ga0265331_10016407 Ga0265331_100164073 387
120 3300031250 Ga0265331_10021964 Ga0265331_100219643 387
121 3300031251 Ga0265327_10000088 Ga0265327_1000008896 387
122 3300031251 Ga0265327_10001137 Ga0265327_100011379 387
123 3300031251 Ga0265327_10006329 Ga0265327_100063296 387
124 3300031251 Ga0265327_10015544 Ga0265327_100155443 387
125 3300031251 Ga0265327_10024937 Ga0265327_100249374 387
126 3300031251 Ga0265327_10028656 Ga0265327_100286564 387
127 3300031251 Ga0265327_10054851 Ga0265327_100548512 387
128 3300031344 Ga0265316_10010741 Ga0265316_100107418 387
129 3300031344 Ga0265316_10012073 Ga0265316_100120738 387
130 3300031344 Ga0265316_10042726 Ga0265316_100427263 387
131 3300031548 Ga0307408_100000033 Ga0307408_100000033150 387
132 3300031595 Ga0265313_10006399 Ga0265313_100063995 387
133 3300031595 Ga0265313_10006886 Ga0265313_100068864 387
134 3300031595 Ga0265313_10011826 Ga0265313_100118263 387
135 3300031595 Ga0265313_10017586 Ga0265313_100175861 387
136 3300031595 Ga0265313_10049558 Ga0265313_100495583 387
137 3300031616 Ga0307508_10000031 Ga0307508_1000003197 387
138 3300031711 Ga0265314_10001896 Ga0265314_1000189617 387
139 3300031711 Ga0265314_10002453 Ga0265314_1000245312 387
140 3300031711 Ga0265314_10003110 Ga0265314_100031109 387
141 3300031711 Ga0265314_10018328 Ga0265314_100183285 387
142 3300031711 Ga0265314_10042083 Ga0265314_100420833 387
143 3300031711 Ga0265314_10122376 Ga0265314_101223761 387
144 3300031712 Ga0265342_10016916 Ga0265342_100169162 387
145 3300031712 Ga0265342_10025908 Ga0265342_100259083 387
146 3300031712 Ga0265342_10049587 Ga0265342_100495872 387
147 3300031712 Ga0265342_10094268 Ga0265342_100942681 387
148 3300031852 Ga0307410_10000008 Ga0307410_1000000825 387
149 3300031903 Ga0307407_10009611 Ga0307407_100096113 387
150 3300031911 Ga0307412_10069634 Ga0307412_100696342 387
151 3300031995 Ga0307409_100000274 Ga0307409_10000027414 387
152 3300032002 Ga0307416_100000022 Ga0307416_10000002254 387
153 3300032005 Ga0307411_10068878 Ga0307411_100688782 387
154 3300034816 Ga0373930_0000719 Ga0373930_0000719_1979_3154 387
155 3300034818 Ga0373950_0003660 Ga0373950_0003660_814_1989 387
156 3300035084 Ga0373928_0001050 Ga0373928_0001050_2701_3876 387
157 3300035085 Ga0373929_0000169 Ga0373929_0000169_1914_3089 387
158 3300035090 Ga0373949_0001259 Ga0373949_0001259_943_2118 387
159 3300035112 Ga0373932_0000001 Ga0373932_0000001_1135279_1136454 387
160 3300035116 Ga0373945_0001939 Ga0373945_0001939_3776_4951 387
161 3300035118 Ga0373954_0028959 Ga0373954_0028959_101_1276 387
162 3300035118 Ga0373954_0088475 Ga0373954_0088475_110_1285 387
163 3300035119 Ga0373956_0040478 Ga0373956_0040478_341_1534 387
164 3300035242 Ga0373962_0007562 Ga0373962_0007562_328_1503 387
165 3300035691 Ga0373931_0000002 Ga0373931_0000002_358944_360119 387
166 3300035695 Ga0373927_0061498 Ga0373927_0061498_1023_2198 387
167 3300037068 Ga0373925_0000552 Ga0373925_0000552_1757_2932 387
168 3300037068 Ga0373925_0034167 Ga0373925_0034167_101_1276 387
169 3300037471 Ga0395905_0000015 Ga0395905_0000015_138850_140031 387
170 3300042004 Ga0439445_0004239 Ga0439445_0004239_188_1375 387
171 3300042876 Ga0451577_0000012 Ga0451577_0000012_3084_4271 387
172 3300042876 Ga0451577_0001016 Ga0451577_0001016_1732_2901 387
173 3300042876 Ga0451577_0222961 Ga0451577_0222961_229_1434 387
174 3300044673 Ga0453683_0000631 Ga0453683_0000631_8089_9267 387
175 3300044693 Ga0466961_0078581 Ga0466961_0078581_161_1342 387
176 3300044712 Ga0453684_0000001 Ga0453684_0000001_2451335_2452519 387
177 3300044712 Ga0453684_0005778 Ga0453684_0005778_1048_2253 387
178 3300044712 Ga0453684_0275008 Ga0453684_0275008_12_1181 387
179 3300044712 Ga0453684_0523118 Ga0453684_0523118_74_1252 387
180 3300045051 Ga0451576_0000750 Ga0451576_0000750_56007_57173 387
181 3300045051 Ga0451576_0000939 Ga0451576_0000939_14895_16076 387
182 3300045051 Ga0451576_0058014 Ga0451576_0058014_996_2174 387
183 3300045051 Ga0451576_0062785 Ga0451576_0062785_1379_2566 387
184 3300045051 Ga0451576_0248963 Ga0451576_0248963_50_1237 387
185 3300045976 Ga0466967_0151801 Ga0466967_0151801_248_1423 387
186 3300046511 Ga0495608_0197982 Ga0495608_0197982_80_1255 387
187 3300046514 Ga0495618_0010507 Ga0495618_0010507_1417_2592 387
188 3300046535 Ga0495586_0027048 Ga0495586_0027048_1481_2656 387
189 3300046557 Ga0495622_0001645 Ga0495622_0001645_8291_9466 387
190 3300046559 Ga0495667_0088424 Ga0495667_0088424_21_1196 387
191 3300046642 Ga0495634_0056795 Ga0495634_0056795_1194_2369 387
192 3300046663 Ga0495635_0045681 Ga0495635_0045681_1299_2474 387
193 3300046689 Ga0495613_0001993 Ga0495613_0001993_11217_12392 387
194 3300047319 Ga0495674_0035703 Ga0495674_0035703_1640_2827 387
195 3300047322 Ga0495680_0014638 Ga0495680_0014638_5079_6254 387
196 3300048918 Ga0496115_0000873 Ga0496115_0000873_3509_4684 387
197 3300049568 Ga0501031_0026308 Ga0501031_0026308_1698_2885 387
198 3300049569 Ga0501032_0000259 Ga0501032_0000259_4239_5444 387
199 3300049569 Ga0501032_0000981 Ga0501032_0000981_8344_9531 387
200 3300049570 Ga0501033_0002906 Ga0501033_0002906_1585_2772 387
201 3300049570 Ga0501033_0061838 Ga0501033_0061838_138_1313 387
202 3300049571 Ga0501034_0027755 Ga0501034_0027755_3117_4304 387
203 3300049571 Ga0501034_0050833 Ga0501034_0050833_1584_2786 387
204 3300049572 Ga0501036_0030662 Ga0501036_0030662_1526_2713 387
205 3300049572 Ga0501036_0046832 Ga0501036_0046832_2219_3424 387
206 3300049573 Ga0501037_0199199 Ga0501037_0199199_181_1368 387
207 3300049574 Ga0501038_0006964 Ga0501038_0006964_8890_10077 387
208 3300049578 Ga0501042_0002122 Ga0501042_0002122_2918_4105 387
209 3300049579 Ga0501043_0058948 Ga0501043_0058948_492_1679 387
210 3300049580 Ga0501046_0001271 Ga0501046_0001271_20794_21978 387
211 3300049581 Ga0501047_0043792 Ga0501047_0043792_1611_2798 387
212 3300049581 Ga0501047_0137370 Ga0501047_0137370_153_1334 387
213 3300049581 Ga0501047_0178379 Ga0501047_0178379_252_1436 387
214 3300049582 Ga0501048_0036787 Ga0501048_0036787_2150_3337 387
215 3300049675 Ga0501243_001107 Ga0501243_001107_185_1366 387
216 3300049742 Ga0501080_0020585 Ga0501080_0020585_3169_4344 387
217 3300049822 Ga0501035_0000441 Ga0501035_0000441_31250_32455 387
218 3300049822 Ga0501035_0018716 Ga0501035_0018716_1270_2457 387
219 3300049823 Ga0501044_0000358 Ga0501044_0000358_47432_48637 387
220 3300049823 Ga0501044_0008224 Ga0501044_0008224_2742_3929 387
221 3300049823 Ga0501044_0069163 Ga0501044_0069163_987_2162 387
222 3300053139 Ga0500568_0015415 Ga0500568_0015415_50_1255 387
223 3300001977 JGI24746J21847_1000052 JGI24746J21847_100005210 388
224 3300003320 rootH2_10017549 rootH2_100175493 388
225 3300005327 Ga0070658_10005700 Ga0070658_100057004 388
226 3300005344 Ga0070661_100008323 Ga0070661_1000083234 388
227 3300005459 Ga0068867_100000046 Ga0068867_10000004658 388
228 3300005564 Ga0070664_100000038 Ga0070664_10000003866 388
229 3300009148 Ga0105243_10000040 Ga0105243_10000040101 388
230 3300013100 Ga0157373_10000931 Ga0157373_100009317 388
231 3300013104 Ga0157370_10000042 Ga0157370_1000004238 388
232 3300025909 Ga0207705_10004882 Ga0207705_100048827 388
233 3300025920 Ga0207649_10004932 Ga0207649_100049324 388
234 3300025935 Ga0207709_10000075 Ga0207709_10000075129 388
235 3300025945 Ga0207679_10005024 Ga0207679_1000502410 388
236 3300026089 Ga0207648_10000208 Ga0207648_1000020857 388
237 3300026142 Ga0207698_10152301 Ga0207698_101523012 388
238 3300031251 Ga0265327_10011434 Ga0265327_100114345 388
239 3300031548 Ga0307408_100000036 Ga0307408_100000036118 388
240 3300031548 Ga0307408_100012632 Ga0307408_1000126323 388
241 3300031824 Ga0307413_10133470 Ga0307413_101334702 388
242 3300031901 Ga0307406_10007301 Ga0307406_100073016 388
243 3300031903 Ga0307407_10000048 Ga0307407_1000004830 388
244 3300031911 Ga0307412_10000052 Ga0307412_1000005219 388
245 3300031995 Ga0307409_100044947 Ga0307409_1000449472 388
246 3300032002 Ga0307416_100000093 Ga0307416_1000000933 388
247 3300032004 Ga0307414_10000006 Ga0307414_10000006225 388
248 3300032004 Ga0307414_10248931 Ga0307414_102489312 388
249 3300032005 Ga0307411_10190280 Ga0307411_101902802 388
250 3300042126 Ga0450888_002775 Ga0450888_002775_509_1675 388
251 3300042127 Ga0450890_000039 Ga0450890_000039_4865_6031 388
252 3300042130 Ga0450892_000238 Ga0450892_000238_1780_2946 388
253 3300042532 Ga0450893_0001825 Ga0450893_0001825_46_1212 388
254 3300042532 Ga0450893_0003355 Ga0450893_0003355_867_2033 388
255 3300042876 Ga0451577_0002463 Ga0451577_0002463_810_1991 388
256 3300049665 Ga0501227_001454 Ga0501227_001454_939_2111 388
257 3300049742 Ga0501080_0122011 Ga0501080_0122011_1104_2294 388
258 3300053136 Ga0500559_0004367 Ga0500559_0004367_5130_6299 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

48

398

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gd9-assembly1.cif.gz_B crystall structure of pyrococcus protein-a1 0.9723 4 387
1j32-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9691 7 387
5wmk-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v 0.9682 7 388
5bj4-assembly1.cif.gz_A thermus thermophilus aspartate aminotransferase tetra mutant 2 0.9652 7 383
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.9637 7 386
ID Description Score Start End Superfamily
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9803 62 284 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.98 61 283 3.40.640.10
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.976 62 284 3.40.640.10
6f77C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9745 62 282 3.40.640.10
af_Q7XDA3_47_275_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9744 51 281 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A1V6E7S1-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9909 69 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A292SKD9-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9906 7 305 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A355S489-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9881 1 388 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1C6J0V3-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9878 7 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A5J5GJZ9-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9869 7 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map