F368037

General Info

Members Datasets Scaffolds Average Seq Length
258 156 516 148

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10011913|Ga0111539_100119132
Length 179
Sequence MRSIISEVRRFPRDQVESPCTVARRSGTLIAMSGRFSGSAVIDRPIGEVFAYLAEGTNDPKFSPRVLSIRKEPDGPSHAGTVFVSQVKDAGMKTDRRIELTEVQEPTKIRWAERSKNLVTATDGGYDLEDLGDSKTRVTIFNELEGHGFGKLLAGLAVRAARKDADAFAQRIKTAVEAS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
155 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
156 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 6.59
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10011913 3300009094 Bacteria 10903
2 JGI25407J50210_10000956 3300003373 Bacteria 6236
3 JGI25407J50210_10015039 3300003373 Bacteria 1998
4 JGI25407J50210_10026353 3300003373 Bacteria 1508
5 JGI25405J52794_10012060 3300003911 Bacteria 1659
6 Ga0070670_100234266 3300005331 Bacteria 1598
7 Ga0070666_10415045 3300005335 Bacteria 969
8 Ga0070660_100190581 3300005339 Bacteria 1661
9 Ga0070691_10017318 3300005341 Bacteria 3315
10 Ga0070692_10181527 3300005345 Bacteria 1220
11 Ga0070692_10380925 3300005345 Bacteria 885
12 Ga0070668_100007832 3300005347 Bacteria 7934
13 Ga0070669_100410213 3300005353 Bacteria 1110
14 Ga0070675_102258464 3300005354 Bacteria 501
15 Ga0070671_100274218 3300005355 Bacteria 1434
16 Ga0070671_101015424 3300005355 Bacteria 727
17 Ga0070713_101023350 3300005436 Unclassified 797
18 Ga0070701_10205693 3300005438 Bacteria 1166
19 Ga0070705_101519172 3300005440 Bacteria 561
20 Ga0070700_100013199 3300005441 Bacteria 4636
21 Ga0070700_100562144 3300005441 Unclassified 888
22 Ga0070694_100380396 3300005444 Bacteria 1101
23 Ga0070694_101293858 3300005444 Bacteria 613
24 Ga0070708_101411708 3300005445 Bacteria 649
25 Ga0070663_100715468 3300005455 Bacteria 852
26 Ga0070662_100007511 3300005457 Bacteria 7070
27 Ga0070662_100536856 3300005457 Unclassified 979
28 Ga0068867_100359601 3300005459 Bacteria 1217
29 Ga0068853_101585806 3300005539 Bacteria 634
30 Ga0070696_100010772 3300005546 Bacteria 6125
31 Ga0070665_100568719 3300005548 Bacteria 1146
32 Ga0070665_101771893 3300005548 Bacteria 624
33 Ga0070704_100173049 3300005549 Unclassified 1719
34 Ga0068854_100168272 3300005578 Bacteria 1703
35 Ga0068856_100015470 3300005614 Bacteria 7371
36 Ga0068852_100008427 3300005616 Bacteria 7600
37 Ga0068861_100080239 3300005719 Bacteria 2552
38 Ga0068870_10127682 3300005840 Bacteria 1473
39 Ga0068858_101092249 3300005842 Bacteria 783
40 Ga0068860_100096080 3300005843 Bacteria 2825
41 Ga0081455_10000397 3300005937 Bacteria 57358
42 Ga0081455_10007880 3300005937 Bacteria 11151
43 Ga0081455_10055034 3300005937 Bacteria 3387
44 Ga0081455_10506391 3300005937 Bacteria 809
45 Ga0081455_10579126 3300005937 Bacteria 736
46 Ga0081538_10000036 3300005981 Bacteria 119944
47 Ga0081538_10000265 3300005981 Bacteria 59857
48 Ga0081538_10002293 3300005981 Bacteria 18902
49 Ga0081538_10013144 3300005981 Bacteria 6573
50 Ga0081538_10024043 3300005981 Bacteria 4354
51 Ga0081538_10043400 3300005981 Bacteria 2823
52 Ga0081538_10052200 3300005981 Bacteria 2446
53 Ga0081538_10128383 3300005981 Unclassified 1198
54 Ga0081538_10173364 3300005981 Bacteria 937
55 Ga0075363_100101045 3300006048 Bacteria 1596
56 Ga0075428_100000373 3300006844 Bacteria 44416
57 Ga0075428_100158314 3300006844 Bacteria 2459
58 Ga0075428_100192816 3300006844 Bacteria 2204
59 Ga0075428_100278125 3300006844 Bacteria 1801
60 Ga0075428_100646019 3300006844 Bacteria 1128
61 Ga0075430_100008295 3300006846 Bacteria 8774
62 Ga0075430_100050870 3300006846 Bacteria 3493
63 Ga0075430_100116776 3300006846 Bacteria 2224
64 Ga0075431_100025370 3300006847 Bacteria 6076
65 Ga0075431_100028005 3300006847 Bacteria 5784
66 Ga0075431_100035548 3300006847 Bacteria 5129
67 Ga0075431_100971703 3300006847 Bacteria 817
68 Ga0075431_101532768 3300006847 Bacteria 625
69 Ga0075433_10156571 3300006852 Bacteria 2027
70 Ga0075433_10200798 3300006852 Bacteria 1773
71 Ga0075434_100100229 3300006871 Bacteria 2902
72 Ga0075429_100010138 3300006880 Bacteria 8164
73 Ga0075429_100053727 3300006880 Bacteria 3505
74 Ga0075429_100404046 3300006880 Bacteria 1196
75 Ga0075429_100600008 3300006880 Bacteria 965
76 Ga0068865_100990541 3300006881 Bacteria 736
77 Ga0075436_100065221 3300006914 Bacteria 2517
78 Ga0075436_100804143 3300006914 Unclassified 700
79 Ga0075435_100035627 3300007076 Bacteria 3950
80 Ga0111539_10008017 3300009094 Bacteria 13471
81 Ga0111539_10172800 3300009094 Bacteria 2524
82 Ga0111539_10230948 3300009094 Bacteria 2154
83 Ga0111539_10287958 3300009094 Bacteria 1912
84 Ga0111539_10878422 3300009094 Bacteria 1043
85 Ga0111539_11945724 3300009094 Bacteria 682
86 Ga0105245_10001579 3300009098 Bacteria 20694
87 Ga0105245_10020457 3300009098 Bacteria 5805
88 Ga0105245_11175896 3300009098 Bacteria 814
89 Ga0114129_10074654 3300009147 Bacteria 4724
90 Ga0114129_10081653 3300009147 Bacteria 4493
91 Ga0114129_10139221 3300009147 Bacteria 3328
92 Ga0114129_10507961 3300009147 Unclassified 1573
93 Ga0114129_10631169 3300009147 Bacteria 1385
94 Ga0114129_10752380 3300009147 Bacteria 1247
95 Ga0114129_11523871 3300009147 Bacteria 821
96 Ga0114129_11608835 3300009147 Bacteria 795
97 Ga0105243_10266443 3300009148 Bacteria 1536
98 Ga0105243_11374760 3300009148 Bacteria 726
99 Ga0105241_10125196 3300009174 Bacteria 2074
100 Ga0105241_10329875 3300009174 Bacteria 1318
101 Ga0105248_12703427 3300009177 Bacteria 566
102 Ga0105237_10089295 3300009545 Bacteria 3071
103 Ga0105238_11292739 3300009551 Unclassified 755
104 Ga0105249_10214486 3300009553 Bacteria 1891
105 Ga0105239_10245615 3300010375 Bacteria 2010
106 Ga0105246_10226292 3300011119 Bacteria 1470
107 Ga0105246_10350426 3300011119 Unclassified 1210
108 Ga0157369_10189305 3300013105 Bacteria 2162
109 Ga0157378_10014226 3300013297 Bacteria 6964
110 Ga0157375_13402430 3300013308 Bacteria 530
111 Ga0157377_10344725 3300014745 Unclassified 997
112 Ga0157379_10003299 3300014968 Bacteria 13654
113 Ga0163161_10126414 3300017792 Bacteria 1925
114 Ga0207688_10057417 3300025901 Bacteria 2188
115 Ga0207654_10078991 3300025911 Bacteria 1975
116 Ga0207662_10263762 3300025918 Bacteria 1135
117 Ga0207657_10034160 3300025919 Bacteria 4576
118 Ga0207687_10018232 3300025927 Unclassified 4630
119 Ga0207700_10137385 3300025928 Bacteria 2004
120 Ga0207664_10795584 3300025929 Unclassified 851
121 Ga0207644_11050785 3300025931 Bacteria 684
122 Ga0207690_10298870 3300025932 Bacteria 1259
123 Ga0207706_10006550 3300025933 Bacteria 10788
124 Ga0207706_10744313 3300025933 Bacteria 835
125 Ga0207670_10049507 3300025936 Bacteria 2811
126 Ga0207669_10471237 3300025937 Bacteria 999
127 Ga0207669_11039440 3300025937 Bacteria 690
128 Ga0207704_10546359 3300025938 Unclassified 941
129 Ga0207704_11184434 3300025938 Bacteria 651
130 Ga0207712_10049284 3300025961 Bacteria 2933
131 Ga0207668_10103154 3300025972 Bacteria 2123
132 Ga0207668_10437047 3300025972 Bacteria 1114
133 Ga0207678_10804950 3300026067 Bacteria 830
134 Ga0207708_10008459 3300026075 Bacteria 7618
135 Ga0207708_10638248 3300026075 Unclassified 905
136 Ga0207708_10676695 3300026075 Bacteria 880
137 Ga0207708_11570573 3300026075 Bacteria 578
138 Ga0207702_10131755 3300026078 Unclassified 2251
139 Ga0207702_10958127 3300026078 Bacteria 848
140 Ga0207641_10269617 3300026088 Bacteria 1597
141 Ga0207648_10600549 3300026089 Bacteria 1014
142 Ga0207674_11294880 3300026116 Bacteria 698
143 Ga0207675_100022654 3300026118 Bacteria 5846
144 Ga0207698_10005872 3300026142 Bacteria 7627
145 Ga0207428_10006712 3300027907 Bacteria 10566
146 Ga0207428_10108838 3300027907 Bacteria 2134
147 Ga0207428_10288933 3300027907 Bacteria 1215
148 Ga0268266_10152839 3300028379 Bacteria 2082
149 Ga0268266_10507148 3300028379 Bacteria 1152
150 Ga0268264_10137785 3300028381 Bacteria 2172
151 Ga0307511_10063210 3300030521 Bacteria 2799
152 Ga0307408_100640296 3300031548 Bacteria 949
153 Ga0307405_10125873 3300031731 Bacteria 1762
154 Ga0307405_10517716 3300031731 Bacteria 959
155 Ga0307413_10169573 3300031824 Bacteria 1543
156 Ga0307413_10693989 3300031824 Bacteria 845
157 Ga0307413_10805011 3300031824 Archaea 790
158 Ga0307410_10056893 3300031852 Bacteria 2661
159 Ga0307410_10072266 3300031852 Bacteria 2395
160 Ga0307410_11139015 3300031852 Bacteria 678
161 Ga0307406_10020224 3300031901 Bacteria 3917
162 Ga0307406_10154110 3300031901 Bacteria 1643
163 Ga0307406_10193536 3300031901 Bacteria 1491
164 Ga0307406_10871052 3300031901 Bacteria 765
165 Ga0307407_10224285 3300031903 Bacteria 1273
166 Ga0307409_100050497 3300031995 Bacteria 3177
167 Ga0307409_100091163 3300031995 Bacteria 2497
168 Ga0307409_100252141 3300031995 Bacteria 1614
169 Ga0307409_100773400 3300031995 Bacteria 966
170 Ga0307416_100113800 3300032002 Bacteria 2392
171 Ga0307416_100188729 3300032002 Bacteria 1941
172 Ga0307411_10336472 3300032005 Bacteria 1225
173 Ga0307411_10389493 3300032005 Unclassified 1149
174 Ga0307411_11264859 3300032005 Bacteria 671
175 Ga0307415_100031999 3300032126 Bacteria 3397
176 Ga0307415_100462918 3300032126 Archaea 1099
177 Ga0307510_10017785 3300033180 Bacteria 8375
178 Ga0373927_0029253 3300035695 Bacteria 3590
179 Ga0395901_0940384 3300038443 Bacteria 844
180 Ga0451795_1208960 3300041456 Bacteria 747
181 Ga0466967_0153439 3300045976 Bacteria 2155
182 Ga0495629_0701140 3300046459 Bacteria 672
183 Ga0495584_0058406 3300046491 Bacteria 1941
184 Ga0495584_0375972 3300046491 Bacteria 722
185 Ga0495585_0172632 3300046492 Bacteria 1116
186 Ga0495596_0055886 3300046500 Bacteria 1542
187 Ga0495618_0175226 3300046514 Bacteria 1364
188 Ga0495630_0397951 3300046517 Bacteria 1055
189 Ga0495663_0084890 3300046525 Bacteria 1025
190 Ga0495665_0150377 3300046531 Bacteria 1215
191 Ga0495667_0350016 3300046559 Bacteria 933
192 Ga0495656_0158990 3300046615 Bacteria 1097
193 Ga0495656_0719388 3300046615 Bacteria 538
194 Ga0495668_0145380 3300046616 Bacteria 1298
195 Ga0495588_0070265 3300046674 Bacteria 1820
196 Ga0495581_0046834 3300047315 Bacteria 2499
197 Ga0495672_0172268 3300047320 Bacteria 1103
198 Ga0495680_0099831 3300047322 Bacteria 2164
199 Ga0496101_0891735 3300048904 Bacteria 700
200 Ga0496104_0180548 3300048907 Bacteria 2021
201 Ga0496105_0113386 3300048908 Bacteria 2237
202 Ga0496107_0234634 3300048910 Bacteria 1365
203 Ga0496107_0933438 3300048910 Unclassified 632
204 Ga0496108_0038865 3300048911 Bacteria 3966
205 Ga0496109_0358536 3300048912 Unclassified 1378
206 Ga0496109_0442726 3300048912 Unclassified 1227
207 Ga0496109_0600449 3300048912 Bacteria 1037
208 Ga0496110_0126434 3300048913 Bacteria 2306
209 Ga0496110_1259534 3300048913 Bacteria 649
210 Ga0496111_0052934 3300048914 Bacteria 2932
211 Ga0496111_0185761 3300048914 Bacteria 1545
212 Ga0496112_0113862 3300048915 Bacteria 2676
213 Ga0496113_0129236 3300048916 Bacteria 1981
214 Ga0496114_0462851 3300048917 Bacteria 1123
215 Ga0496121_0205976 3300048924 Bacteria 1397
216 Ga0501036_0065501 3300049572 Bacteria 3075
217 Ga0501041_0061848 3300049577 Bacteria 2292
218 Ga0501042_0250398 3300049578 Bacteria 1278
219 Ga0501047_0864937 3300049581 Bacteria 718
220 Ga0501048_1008495 3300049582 Bacteria 599
221 Ga0501069_0781464 3300049585 Bacteria 578
222 Ga0501074_0066925 3300049590 Bacteria 2584
223 Ga0501076_0108627 3300049592 Bacteria 2241
224 Ga0501080_0461560 3300049742 Bacteria 1138
225 Ga0501081_0431394 3300049743 Bacteria 978
226 Ga0501045_0114856 3300049824 Bacteria 1997
227 nmdc:mga07m45_527565_c1 3300050496 Unclassified 683
228 nmdc:mga05p37_13995_c1 3300050507 Bacteria 9621
229 nmdc:mga05p37_2000118_c1 3300050507 Bacteria 548
230 nmdc:mga05p37_465313_c1 3300050507 Unclassified 1460
231 nmdc:mga05p37_635671_c1 3300050507 Bacteria 1198
232 nmdc:mga05p37_935001_c1 3300050507 Bacteria 930
233 nmdc:mga09592_275012_c1 3300050508 Bacteria 1461
234 nmdc:mga09592_82_c1 3300050508 Bacteria 55790
235 nmdc:mga0qj67_208580_c1 3300050509 Bacteria 1587
236 nmdc:mga0qj67_26525_c1 3300050509 Bacteria 4486
237 nmdc:mga0qj67_43708_c1 3300050509 Bacteria 3529
238 nmdc:mga06r32_1041503_c1 3300050510 Bacteria 769
239 nmdc:mga06r32_2375_c1 3300050510 Bacteria 16861
240 nmdc:mga06r32_24459_c1 3300050510 Bacteria 5607
241 nmdc:mga06r32_24874_c1 3300050510 Bacteria 5565
242 nmdc:mga06r32_937095_c1 3300050510 Bacteria 821
243 nmdc:mga08y16_2057_c1 3300050511 Bacteria 20602
244 nmdc:mga08y16_3104_c1 3300050511 Bacteria 17193
245 nmdc:mga08y16_359218_c1 3300050511 Bacteria 1495
246 nmdc:mga08y16_843361_c1 3300050511 Bacteria 906
247 nmdc:mga0n895_44800_c1 3300050512 Bacteria 4315
248 nmdc:mga0rr50_386516_c1 3300050513 Bacteria 1181
249 nmdc:mga08x19_181466_c1 3300050514 Bacteria 1437
250 nmdc:mga08x19_305563_c1 3300050514 Bacteria 1105
251 nmdc:mga0a205_21262_c1 3300050515 Bacteria 6137
252 nmdc:mga0a205_50456_c1 3300050515 Bacteria 4017
253 Ga0495601_0162496 3300053077 Bacteria 1460
254 Ga0500616_0264949 3300053153 Bacteria 728
255 Ga0501084_0081142 3300054114 Bacteria 2720
256 2739205888 2738543005 Bacteria 5278128
257 2744958107 2744054611 Bacteria 5611514
258 2990092622 2990088156 Bacteria 6657676
259 Ga0111539_10011913
260 JGI25407J50210_10000956
261 JGI25407J50210_10015039
262 JGI25407J50210_10026353
263 JGI25405J52794_10012060
264 Ga0070670_100234266
265 Ga0070666_10415045
266 Ga0070660_100190581
267 Ga0070691_10017318
268 Ga0070692_10181527
269 Ga0070692_10380925
270 Ga0070668_100007832
271 Ga0070669_100410213
272 Ga0070675_102258464
273 Ga0070671_100274218
274 Ga0070671_101015424
275 Ga0070713_101023350
276 Ga0070701_10205693
277 Ga0070705_101519172
278 Ga0070700_100013199
279 Ga0070700_100562144
280 Ga0070694_100380396
281 Ga0070694_101293858
282 Ga0070708_101411708
283 Ga0070663_100715468
284 Ga0070662_100007511
285 Ga0070662_100536856
286 Ga0068867_100359601
287 Ga0068853_101585806
288 Ga0070696_100010772
289 Ga0070665_100568719
290 Ga0070665_101771893
291 Ga0070704_100173049
292 Ga0068854_100168272
293 Ga0068856_100015470
294 Ga0068852_100008427
295 Ga0068861_100080239
296 Ga0068870_10127682
297 Ga0068858_101092249
298 Ga0068860_100096080
299 Ga0081455_10000397
300 Ga0081455_10007880
301 Ga0081455_10055034
302 Ga0081455_10506391
303 Ga0081455_10579126
304 Ga0081538_10000036
305 Ga0081538_10000265
306 Ga0081538_10002293
307 Ga0081538_10013144
308 Ga0081538_10024043
309 Ga0081538_10043400
310 Ga0081538_10052200
311 Ga0081538_10128383
312 Ga0081538_10173364
313 Ga0075363_100101045
314 Ga0075428_100000373
315 Ga0075428_100158314
316 Ga0075428_100192816
317 Ga0075428_100278125
318 Ga0075428_100646019
319 Ga0075430_100008295
320 Ga0075430_100050870
321 Ga0075430_100116776
322 Ga0075431_100025370
323 Ga0075431_100028005
324 Ga0075431_100035548
325 Ga0075431_100971703
326 Ga0075431_101532768
327 Ga0075433_10156571
328 Ga0075433_10200798
329 Ga0075434_100100229
330 Ga0075429_100010138
331 Ga0075429_100053727
332 Ga0075429_100404046
333 Ga0075429_100600008
334 Ga0068865_100990541
335 Ga0075436_100065221
336 Ga0075436_100804143
337 Ga0075435_100035627
338 Ga0111539_10008017
339 Ga0111539_10172800
340 Ga0111539_10230948
341 Ga0111539_10287958
342 Ga0111539_10878422
343 Ga0111539_11945724
344 Ga0105245_10001579
345 Ga0105245_10020457
346 Ga0105245_11175896
347 Ga0114129_10074654
348 Ga0114129_10081653
349 Ga0114129_10139221
350 Ga0114129_10507961
351 Ga0114129_10631169
352 Ga0114129_10752380
353 Ga0114129_11523871
354 Ga0114129_11608835
355 Ga0105243_10266443
356 Ga0105243_11374760
357 Ga0105241_10125196
358 Ga0105241_10329875
359 Ga0105248_12703427
360 Ga0105237_10089295
361 Ga0105238_11292739
362 Ga0105249_10214486
363 Ga0105239_10245615
364 Ga0105246_10226292
365 Ga0105246_10350426
366 Ga0157369_10189305
367 Ga0157378_10014226
368 Ga0157375_13402430
369 Ga0157377_10344725
370 Ga0157379_10003299
371 Ga0163161_10126414
372 Ga0207688_10057417
373 Ga0207654_10078991
374 Ga0207662_10263762
375 Ga0207657_10034160
376 Ga0207687_10018232
377 Ga0207700_10137385
378 Ga0207664_10795584
379 Ga0207644_11050785
380 Ga0207690_10298870
381 Ga0207706_10006550
382 Ga0207706_10744313
383 Ga0207670_10049507
384 Ga0207669_10471237
385 Ga0207669_11039440
386 Ga0207704_10546359
387 Ga0207704_11184434
388 Ga0207712_10049284
389 Ga0207668_10103154
390 Ga0207668_10437047
391 Ga0207678_10804950
392 Ga0207708_10008459
393 Ga0207708_10638248
394 Ga0207708_10676695
395 Ga0207708_11570573
396 Ga0207702_10131755
397 Ga0207702_10958127
398 Ga0207641_10269617
399 Ga0207648_10600549
400 Ga0207674_11294880
401 Ga0207675_100022654
402 Ga0207698_10005872
403 Ga0207428_10006712
404 Ga0207428_10108838
405 Ga0207428_10288933
406 Ga0268266_10152839
407 Ga0268266_10507148
408 Ga0268264_10137785
409 Ga0307511_10063210
410 Ga0307408_100640296
411 Ga0307405_10125873
412 Ga0307405_10517716
413 Ga0307413_10169573
414 Ga0307413_10693989
415 Ga0307413_10805011
416 Ga0307410_10056893
417 Ga0307410_10072266
418 Ga0307410_11139015
419 Ga0307406_10020224
420 Ga0307406_10154110
421 Ga0307406_10193536
422 Ga0307406_10871052
423 Ga0307407_10224285
424 Ga0307409_100050497
425 Ga0307409_100091163
426 Ga0307409_100252141
427 Ga0307409_100773400
428 Ga0307416_100113800
429 Ga0307416_100188729
430 Ga0307411_10336472
431 Ga0307411_10389493
432 Ga0307411_11264859
433 Ga0307415_100031999
434 Ga0307415_100462918
435 Ga0307510_10017785
436 Ga0373927_0029253
437 Ga0395901_0940384
438 Ga0451795_1208960
439 Ga0466967_0153439
440 Ga0495629_0701140
441 Ga0495584_0058406
442 Ga0495584_0375972
443 Ga0495585_0172632
444 Ga0495596_0055886
445 Ga0495618_0175226
446 Ga0495630_0397951
447 Ga0495663_0084890
448 Ga0495665_0150377
449 Ga0495667_0350016
450 Ga0495656_0158990
451 Ga0495656_0719388
452 Ga0495668_0145380
453 Ga0495588_0070265
454 Ga0495581_0046834
455 Ga0495672_0172268
456 Ga0495680_0099831
457 Ga0496101_0891735
458 Ga0496104_0180548
459 Ga0496105_0113386
460 Ga0496107_0234634
461 Ga0496107_0933438
462 Ga0496108_0038865
463 Ga0496109_0358536
464 Ga0496109_0442726
465 Ga0496109_0600449
466 Ga0496110_0126434
467 Ga0496110_1259534
468 Ga0496111_0052934
469 Ga0496111_0185761
470 Ga0496112_0113862
471 Ga0496113_0129236
472 Ga0496114_0462851
473 Ga0496121_0205976
474 Ga0501036_0065501
475 Ga0501041_0061848
476 Ga0501042_0250398
477 Ga0501047_0864937
478 Ga0501048_1008495
479 Ga0501069_0781464
480 Ga0501074_0066925
481 Ga0501076_0108627
482 Ga0501080_0461560
483 Ga0501081_0431394
484 Ga0501045_0114856
485 nmdc:mga07m45_527565_c1
486 nmdc:mga05p37_13995_c1
487 nmdc:mga05p37_2000118_c1
488 nmdc:mga05p37_465313_c1
489 nmdc:mga05p37_635671_c1
490 nmdc:mga05p37_935001_c1
491 nmdc:mga09592_275012_c1
492 nmdc:mga09592_82_c1
493 nmdc:mga0qj67_208580_c1
494 nmdc:mga0qj67_26525_c1
495 nmdc:mga0qj67_43708_c1
496 nmdc:mga06r32_1041503_c1
497 nmdc:mga06r32_2375_c1
498 nmdc:mga06r32_24459_c1
499 nmdc:mga06r32_24874_c1
500 nmdc:mga06r32_937095_c1
501 nmdc:mga08y16_2057_c1
502 nmdc:mga08y16_3104_c1
503 nmdc:mga08y16_359218_c1
504 nmdc:mga08y16_843361_c1
505 nmdc:mga0n895_44800_c1
506 nmdc:mga0rr50_386516_c1
507 nmdc:mga08x19_181466_c1
508 nmdc:mga08x19_305563_c1
509 nmdc:mga0a205_21262_c1
510 nmdc:mga0a205_50456_c1
511 Ga0495601_0162496
512 Ga0500616_0264949
513 Ga0501084_0081142
514 2739205888
515 2744958107
516 2990092622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

33

177

0.87

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

42

173

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8302 1 145
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8198 1 145
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.8118 1 145
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.8019 1 145
3tl1-assembly2.cif.gz_B crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase 0.796 1 145
ID Description Score Start End Superfamily
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8302 1 145 3.30.530.20
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8198 1 145 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8095 3 141 3.30.530.20
af_Q9USM9_11_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8056 3 145 3.30.530.20
af_A0A1D8PLT3_1_151_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7948 3 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V2QQR7-F1-model_v4 deleted 0.9978 4 146
AF-A0A7Y6HE91-F1-model_v4 Polyketide cyclase 0.9955 1 146
AF-A0A7Z6TFR1-F1-model_v4 Cyclase/dehydrase 0.9891 1 145
AF-A0A7Y6HE91-F1-model_v4 Polyketide cyclase 0.9887 1 146
AF-A0A1I1YM84-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.9852 1 145

Map