F368012

General Info

Members Datasets Scaffolds Average Seq Length
258 188 516 255

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100000910|Ga0075436_1000009105
Length 277
Sequence VRPFAAGRTLCAPTVAESRRMPHKTLLADERDGVVTVTLNRPEVHNAFNDELIAEAVELFDGLAKSSARAVVLRGSGANFCAGADLNWMSRMVSYTRDENVRDSAKLARMYAVINECPLPVVGRIHGAAIGGGVGLVAVCDVAVCAPESKFGLSEVKLGILPAVISPYVIAKIGETHARALFLTGERFDAERALRIGLVHRVAEDVDAAVNEVVAQLRTSGPEAVRECKKLIARVAHSELAEAVPYTIEAIAERRVSVEGQGGMGAFLKKEKPPWAQ

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
166 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
167 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
168 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
169 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
170 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
171 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
172 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
173 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
174 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
175 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
176 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
177 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
178 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
179 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
180 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
181 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
182 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
183 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
184 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
185 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
186 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
187 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
188 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.7
Metatranscriptomes 0
Isolates 9.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 1.55
Rhizoplane 1.16
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100000910 3300006914 Bacteria 19699
2 JGI24738J21930_10028420 3300002075 Bacteria 1144
3 Ga0055538_1000255 3300003751 Bacteria 28208
4 Ga0055539_1000288 3300003752 Bacteria 28208
5 Ga0055533_1000273 3300003756 Bacteria 28208
6 Ga0055525_1000389 3300003759 Bacteria 28208
7 Ga0055541_1000187 3300003841 Bacteria 28208
8 Ga0070676_10209765 3300005328 Bacteria 1281
9 Ga0070683_100001761 3300005329 Bacteria 16844
10 Ga0070670_100000630 3300005331 Bacteria 27576
11 Ga0070670_100009742 3300005331 Bacteria 8205
12 Ga0070682_100201600 3300005337 Bacteria 1404
13 Ga0068868_100000010 3300005338 Bacteria 117927
14 Ga0068868_100003489 3300005338 Bacteria 10943
15 Ga0068868_100166642 3300005338 Bacteria 1823
16 Ga0070687_100053735 3300005343 Unclassified 2096
17 Ga0070687_100464045 3300005343 Bacteria 845
18 Ga0070692_10020525 3300005345 Bacteria 3204
19 Ga0070692_10053215 3300005345 Bacteria 2110
20 Ga0070668_100008900 3300005347 Bacteria 7453
21 Ga0070668_100102197 3300005347 Bacteria 2272
22 Ga0070675_100000009 3300005354 Bacteria 245759
23 Ga0070688_100288002 3300005365 Bacteria 1183
24 Ga0070659_100082145 3300005366 Bacteria 2574
25 Ga0070703_10017052 3300005406 Bacteria 2091
26 Ga0070714_100056379 3300005435 Bacteria 3361
27 Ga0070701_10000582 3300005438 Bacteria 12712
28 Ga0070711_100019167 3300005439 Bacteria 4385
29 Ga0070705_100026485 3300005440 Unclassified 3156
30 Ga0070700_100048214 3300005441 Bacteria 2639
31 Ga0070700_100426625 3300005441 Bacteria 1003
32 Ga0070694_100136558 3300005444 Bacteria 1777
33 Ga0070662_100025712 3300005457 Bacteria 4068
34 Ga0070662_100061699 3300005457 Unclassified 2737
35 Ga0070706_100094668 3300005467 Bacteria 2771
36 Ga0070707_100002708 3300005468 Bacteria 16853
37 Ga0070707_100066992 3300005468 Bacteria 3453
38 Ga0070698_100103160 3300005471 Bacteria 2822
39 Ga0070698_100184139 3300005471 Bacteria 2026
40 Ga0070698_100359545 3300005471 Bacteria 1387
41 Ga0070699_100001793 3300005518 Bacteria 19543
42 Ga0070684_100000616 3300005535 Bacteria 24551
43 Ga0070672_100000691 3300005543 Bacteria 19925
44 Ga0070686_100020719 3300005544 Bacteria 3895
45 Ga0070695_100103916 3300005545 Unclassified 1917
46 Ga0070696_100017223 3300005546 Bacteria 4875
47 Ga0070693_100034642 3300005547 Bacteria 2794
48 Ga0070693_100133114 3300005547 Unclassified 1557
49 Ga0070704_100185958 3300005549 Bacteria 1666
50 Ga0068855_100000526 3300005563 Bacteria 46919
51 Ga0068855_100020536 3300005563 Bacteria 7920
52 Ga0068855_100107466 3300005563 Bacteria 3205
53 Ga0068855_100407824 3300005563 Bacteria 1488
54 Ga0068857_100011027 3300005577 Bacteria 7869
55 Ga0068854_100009827 3300005578 Bacteria 6187
56 Ga0068854_100066771 3300005578 Bacteria 2618
57 Ga0068854_100165634 3300005578 Bacteria 1716
58 Ga0068854_100267337 3300005578 Bacteria 1371
59 Ga0068856_100053899 3300005614 Bacteria 3966
60 Ga0070702_100042521 3300005615 Bacteria 2555
61 Ga0068864_100000040 3300005618 Bacteria 171863
62 Ga0068861_100005347 3300005719 Bacteria 8678
63 Ga0068858_100000027 3300005842 Bacteria 145577
64 Ga0081540_1002206 3300005983 Bacteria 16084
65 Ga0070717_10000116 3300006028 Bacteria 62656
66 Ga0075365_10430154 3300006038 Bacteria 932
67 Ga0070716_100151320 3300006173 Bacteria 1493
68 Ga0070712_100017242 3300006175 Bacteria 4673
69 Ga0070712_100325466 3300006175 Bacteria 1251
70 Ga0097621_100542975 3300006237 Bacteria 1057
71 Ga0075431_100003804 3300006847 Bacteria 14674
72 Ga0075433_10340369 3300006852 Bacteria 1326
73 Ga0075434_100504498 3300006871 Bacteria 1231
74 Ga0075429_100115835 3300006880 Bacteria 2343
75 Ga0079104_1006639 3300006946 Bacteria 4334
76 Ga0075435_100004637 3300007076 Bacteria 9469
77 Ga0105244_10040823 3300009036 Bacteria 2407
78 Ga0105250_10122603 3300009092 Bacteria 1069
79 Ga0105240_10022186 3300009093 Bacteria 8422
80 Ga0105240_10353532 3300009093 Bacteria 1666
81 Ga0105240_10731844 3300009093 Bacteria 1077
82 Ga0111539_10000045 3300009094 Bacteria 121986
83 Ga0111539_10263478 3300009094 Bacteria 2006
84 Ga0105245_10000616 3300009098 Bacteria 32258
85 Ga0105245_10081167 3300009098 Bacteria 2964
86 Ga0105245_10096837 3300009098 Unclassified 2724
87 Ga0114129_10057686 3300009147 Bacteria 5432
88 Ga0114129_10368242 3300009147 Bacteria 1900
89 Ga0114129_10621558 3300009147 Bacteria 1397
90 Ga0105243_10038893 3300009148 Bacteria 3707
91 Ga0105242_10003475 3300009176 Bacteria 12249
92 Ga0105242_10074582 3300009176 Bacteria 2823
93 Ga0105248_10432181 3300009177 Bacteria 1483
94 Ga0105238_10000018 3300009551 Bacteria 223340
95 Ga0105249_10036463 3300009553 Bacteria 4461
96 Ga0105249_10102581 3300009553 Bacteria 2693
97 Ga0105239_10035421 3300010375 Bacteria 5482
98 Ga0105239_10064135 3300010375 Bacteria 4033
99 Ga0157369_10000778 3300013105 Bacteria 41158
100 Ga0157369_10889106 3300013105 Bacteria 914
101 Ga0157374_10000005 3300013296 Bacteria 646767
102 Ga0157378_10000595 3300013297 Bacteria 33901
103 Ga0157378_10000607 3300013297 Bacteria 33656
104 Ga0157378_10189441 3300013297 Unclassified 1939
105 Ga0157378_10348157 3300013297 Bacteria 1447
106 Ga0157372_10130946 3300013307 Unclassified 2886
107 Ga0157375_10000035 3300013308 Bacteria 179166
108 Ga0157375_10000658 3300013308 Bacteria 30513
109 Ga0157375_10128598 3300013308 Bacteria 2651
110 Ga0157375_10153484 3300013308 Bacteria 2440
111 Ga0157380_10101521 3300014326 Bacteria 2397
112 Ga0182008_10031559 3300014497 Bacteria 2666
113 Ga0157377_10000001 3300014745 Bacteria 623098
114 Ga0157377_10000269 3300014745 Bacteria 25290
115 Ga0157376_10000021 3300014969 Bacteria 240083
116 Ga0182006_1011418 3300015261 Bacteria 3909
117 Ga0182007_10019593 3300015262 Bacteria 2431
118 Ga0213873_10000002 3300021358 Bacteria 1164195
119 Ga0213873_10000590 3300021358 Bacteria 5907
120 Ga0213872_10003903 3300021361 Bacteria 8093
121 Ga0213874_10079166 3300021377 Bacteria 1062
122 Ga0213876_10000001 3300021384 Bacteria 1186326
123 Ga0213876_10001812 3300021384 Bacteria 12918
124 Ga0213876_10107000 3300021384 Bacteria 1484
125 Ga0209784_100281 3300025224 Bacteria 28775
126 Ga0209566_100473 3300025225 Bacteria 28775
127 Ga0209674_100330 3300025226 Bacteria 28775
128 Ga0209563_100218 3300025230 Bacteria 28775
129 Ga0209437_100080 3300025233 Bacteria 275402
130 Ga0209677_100350 3300025253 Bacteria 28775
131 Ga0207655_1055582 3300025728 Bacteria 1566
132 Ga0207653_10014349 3300025885 Bacteria 2486
133 Ga0207680_10111708 3300025903 Unclassified 1773
134 Ga0207684_10073643 3300025910 Bacteria 2901
135 Ga0207684_10114036 3300025910 Bacteria 2314
136 Ga0207684_10152327 3300025910 Bacteria 1989
137 Ga0207695_10008108 3300025913 Bacteria 13205
138 Ga0207671_10008313 3300025914 Bacteria 8823
139 Ga0207693_10079434 3300025915 Bacteria 2567
140 Ga0207663_10014237 3300025916 Bacteria 4348
141 Ga0207662_10019352 3300025918 Bacteria 3873
142 Ga0207657_10127675 3300025919 Unclassified 2087
143 Ga0207646_10013395 3300025922 Bacteria 7845
144 Ga0207646_10315885 3300025922 Bacteria 1412
145 Ga0207681_10018104 3300025923 Bacteria 4435
146 Ga0207694_10000001 3300025924 Bacteria 4078485
147 Ga0207694_10000103 3300025924 Bacteria 92553
148 Ga0207650_10000123 3300025925 Bacteria 98317
149 Ga0207650_10032071 3300025925 Bacteria 3799
150 Ga0207659_10000007 3300025926 Bacteria 322984
151 Ga0207687_10001176 3300025927 Bacteria 17877
152 Ga0207644_10186740 3300025931 Bacteria 1628
153 Ga0207706_10010184 3300025933 Bacteria 8603
154 Ga0207706_10022429 3300025933 Bacteria 5666
155 Ga0207709_10244511 3300025935 Bacteria 1307
156 Ga0207670_10202520 3300025936 Bacteria 1509
157 Ga0207670_10723105 3300025936 Bacteria 825
158 Ga0207665_10060533 3300025939 Bacteria 2564
159 Ga0207691_10001991 3300025940 Bacteria 19982
160 Ga0207689_10067464 3300025942 Bacteria 2940
161 Ga0207661_10000004 3300025944 Bacteria 606391
162 Ga0207661_10409778 3300025944 Bacteria 1230
163 Ga0207667_10000073 3300025949 Bacteria 174391
164 Ga0207667_10000076 3300025949 Bacteria 166704
165 Ga0207667_10000147 3300025949 Bacteria 106918
166 Ga0207667_10038005 3300025949 Bacteria 5144
167 Ga0207712_10208220 3300025961 Bacteria 1556
168 Ga0207668_10120154 3300025972 Bacteria 1988
169 Ga0207640_10001053 3300025981 Bacteria 15244
170 Ga0207640_10022235 3300025981 Bacteria 3792
171 Ga0207640_10255639 3300025981 Bacteria 1362
172 Ga0207677_10000022 3300026023 Bacteria 131515
173 Ga0207677_10000057 3300026023 Bacteria 97301
174 Ga0207703_10000400 3300026035 Bacteria 46582
175 Ga0207708_10013305 3300026075 Bacteria 6145
176 Ga0207648_10021873 3300026089 Bacteria 5745
177 Ga0207648_10046733 3300026089 Bacteria 3795
178 Ga0207676_10000098 3300026095 Bacteria 78113
179 Ga0207675_100002763 3300026118 Bacteria 17252
180 Ga0207683_10284514 3300026121 Bacteria 1511
181 Ga0207428_10000010 3300027907 Bacteria 397329
182 Ga0268265_10517817 3300028380 Bacteria 1127
183 Ga0268264_10412510 3300028381 Bacteria 1301
184 Ga0268264_10544944 3300028381 Bacteria 1137
185 Ga0265338_10000953 3300028800 Bacteria 48730
186 Ga0307511_10019903 3300030521 Bacteria 6371
187 Ga0307408_100049947 3300031548 Bacteria 3006
188 Ga0307409_100152928 3300031995 Bacteria 2006
189 Ga0373932_0001609 3300035112 Bacteria 6217
190 Ga0373943_0042284 3300035170 Bacteria 2208
191 Ga0395899_0001548 3300037312 Bacteria 19416
192 Ga0395899_0012558 3300037312 Bacteria 6493
193 Ga0395900_0010335 3300037418 Bacteria 9550
194 Ga0395900_0023304 3300037418 Bacteria 6336
195 Ga0395900_0118670 3300037418 Bacteria 2715
196 Ga0395898_0007585 3300037466 Bacteria 11518
197 Ga0395898_0018071 3300037466 Bacteria 7193
198 Ga0395905_0007801 3300037471 Bacteria 10615
199 Ga0395905_0051288 3300037471 Bacteria 3864
200 Ga0395905_0437119 3300037471 Bacteria 1205
201 Ga0395901_0024279 3300038443 Bacteria 6220
202 Ga0395901_0067087 3300038443 Bacteria 3736
203 Ga0395901_0086175 3300038443 Bacteria 3284
204 Ga0436365_0557745 3300039437 Bacteria 2082
205 Ga0436365_0774883 3300039437 Bacteria 390569
206 Ga0436365_1042279 3300039437 Bacteria 224225
207 Ga0436361_0020529 3300039447 Bacteria 8870
208 Ga0436363_1508416 3300039450 Bacteria 1085
209 Ga0436362_0660519 3300039453 Bacteria 832172
210 Ga0436362_1017244 3300039453 Bacteria 16007
211 Ga0451577_0002903 3300042876 Bacteria 19665
212 Ga0451577_0020138 3300042876 Bacteria 6126
213 Ga0453683_0171389 3300044673 Bacteria 1375
214 Ga0453684_0000949 3300044712 Bacteria 95680
215 Ga0495584_0072721 3300046491 Bacteria 1728
216 Ga0495620_0010624 3300046515 Bacteria 4848
217 Ga0495656_0048653 3300046615 Bacteria 1803
218 Ga0495611_0071093 3300046648 Bacteria 1591
219 Ga0495625_0008064 3300046660 Bacteria 9031
220 Ga0496103_0071748 3300048906 Unclassified 2168
221 Ga0496107_0068785 3300048910 Bacteria 2570
222 Ga0496109_0499634 3300048912 Bacteria 1148
223 Ga0501034_0691857 3300049571 Unclassified 919
224 nmdc:mga05p37_582248_c1 3300050507 Bacteria 1267
225 nmdc:mga06r32_2151_c1 3300050510 Bacteria 17620
226 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
227 nmdc:mga08y16_406635_c1 3300050511 Bacteria 1392
228 nmdc:mga0n895_557019_c1 3300050512 Bacteria 1152
229 nmdc:mga0rr50_70_c1 3300050513 Bacteria 59929
230 nmdc:mga08x19_519_c1 3300050514 Bacteria 25643
231 Ga0495655_0000330 3300053083 Bacteria 8357
232 Ga0500618_001401 3300053125 Bacteria 10832
233 Ga0500618_004063 3300053125 Bacteria 4797
234 Ga0500616_0000025 3300053153 Bacteria 454567
235 2511384185 2511231026 Bacteria 5225445
236 2521558952 2521172590 Bacteria 5047645
237 2550697188 2548876994 Bacteria 4904866
238 2553003760 2551306416 Bacteria 6152985
239 2765568804 2765235838 Bacteria 5445269
240 2808984331 2808606386 Bacteria 4471946
241 2809130684 2808606415 Bacteria 4576710
242 2809149838 2808606419 Bacteria 4576925
243 2819615474 2818991449 Bacteria 5518009
244 2839096312 2839094727 Bacteria 5534556
245 2852620020 2852618963 Bacteria 4577824
246 2884812335 2884811622 Bacteria 5552861
247 2884837141 2884836552 Bacteria 5219991
248 2884853433 2884852848 Bacteria 5221161
249 2896155450 2896154374 Bacteria 5221518
250 2904444607 2904439833 Bacteria 5931679
251 2904534738 2904530477 Bacteria 5876334
252 2904584627 2904584206 Bacteria 6028872
253 2904591094 2904589729 Bacteria 6113573
254 2904605278 2904601388 Bacteria 5884906
255 2919048445 2919046199 Bacteria 5567169
256 2919081033 2919079590 Bacteria 5946433
257 2923512613 2923510766 Bacteria 5926163
258 2928132645 2928130867 Bacteria 5467269
259 Ga0075436_100000910
260 JGI24738J21930_10028420
261 Ga0055538_1000255
262 Ga0055539_1000288
263 Ga0055533_1000273
264 Ga0055525_1000389
265 Ga0055541_1000187
266 Ga0070676_10209765
267 Ga0070683_100001761
268 Ga0070670_100000630
269 Ga0070670_100009742
270 Ga0070682_100201600
271 Ga0068868_100000010
272 Ga0068868_100003489
273 Ga0068868_100166642
274 Ga0070687_100053735
275 Ga0070687_100464045
276 Ga0070692_10020525
277 Ga0070692_10053215
278 Ga0070668_100008900
279 Ga0070668_100102197
280 Ga0070675_100000009
281 Ga0070688_100288002
282 Ga0070659_100082145
283 Ga0070703_10017052
284 Ga0070714_100056379
285 Ga0070701_10000582
286 Ga0070711_100019167
287 Ga0070705_100026485
288 Ga0070700_100048214
289 Ga0070700_100426625
290 Ga0070694_100136558
291 Ga0070662_100025712
292 Ga0070662_100061699
293 Ga0070706_100094668
294 Ga0070707_100002708
295 Ga0070707_100066992
296 Ga0070698_100103160
297 Ga0070698_100184139
298 Ga0070698_100359545
299 Ga0070699_100001793
300 Ga0070684_100000616
301 Ga0070672_100000691
302 Ga0070686_100020719
303 Ga0070695_100103916
304 Ga0070696_100017223
305 Ga0070693_100034642
306 Ga0070693_100133114
307 Ga0070704_100185958
308 Ga0068855_100000526
309 Ga0068855_100020536
310 Ga0068855_100107466
311 Ga0068855_100407824
312 Ga0068857_100011027
313 Ga0068854_100009827
314 Ga0068854_100066771
315 Ga0068854_100165634
316 Ga0068854_100267337
317 Ga0068856_100053899
318 Ga0070702_100042521
319 Ga0068864_100000040
320 Ga0068861_100005347
321 Ga0068858_100000027
322 Ga0081540_1002206
323 Ga0070717_10000116
324 Ga0075365_10430154
325 Ga0070716_100151320
326 Ga0070712_100017242
327 Ga0070712_100325466
328 Ga0097621_100542975
329 Ga0075431_100003804
330 Ga0075433_10340369
331 Ga0075434_100504498
332 Ga0075429_100115835
333 Ga0079104_1006639
334 Ga0075435_100004637
335 Ga0105244_10040823
336 Ga0105250_10122603
337 Ga0105240_10022186
338 Ga0105240_10353532
339 Ga0105240_10731844
340 Ga0111539_10000045
341 Ga0111539_10263478
342 Ga0105245_10000616
343 Ga0105245_10081167
344 Ga0105245_10096837
345 Ga0114129_10057686
346 Ga0114129_10368242
347 Ga0114129_10621558
348 Ga0105243_10038893
349 Ga0105242_10003475
350 Ga0105242_10074582
351 Ga0105248_10432181
352 Ga0105238_10000018
353 Ga0105249_10036463
354 Ga0105249_10102581
355 Ga0105239_10035421
356 Ga0105239_10064135
357 Ga0157369_10000778
358 Ga0157369_10889106
359 Ga0157374_10000005
360 Ga0157378_10000595
361 Ga0157378_10000607
362 Ga0157378_10189441
363 Ga0157378_10348157
364 Ga0157372_10130946
365 Ga0157375_10000035
366 Ga0157375_10000658
367 Ga0157375_10128598
368 Ga0157375_10153484
369 Ga0157380_10101521
370 Ga0182008_10031559
371 Ga0157377_10000001
372 Ga0157377_10000269
373 Ga0157376_10000021
374 Ga0182006_1011418
375 Ga0182007_10019593
376 Ga0213873_10000002
377 Ga0213873_10000590
378 Ga0213872_10003903
379 Ga0213874_10079166
380 Ga0213876_10000001
381 Ga0213876_10001812
382 Ga0213876_10107000
383 Ga0209784_100281
384 Ga0209566_100473
385 Ga0209674_100330
386 Ga0209563_100218
387 Ga0209437_100080
388 Ga0209677_100350
389 Ga0207655_1055582
390 Ga0207653_10014349
391 Ga0207680_10111708
392 Ga0207684_10073643
393 Ga0207684_10114036
394 Ga0207684_10152327
395 Ga0207695_10008108
396 Ga0207671_10008313
397 Ga0207693_10079434
398 Ga0207663_10014237
399 Ga0207662_10019352
400 Ga0207657_10127675
401 Ga0207646_10013395
402 Ga0207646_10315885
403 Ga0207681_10018104
404 Ga0207694_10000001
405 Ga0207694_10000103
406 Ga0207650_10000123
407 Ga0207650_10032071
408 Ga0207659_10000007
409 Ga0207687_10001176
410 Ga0207644_10186740
411 Ga0207706_10010184
412 Ga0207706_10022429
413 Ga0207709_10244511
414 Ga0207670_10202520
415 Ga0207670_10723105
416 Ga0207665_10060533
417 Ga0207691_10001991
418 Ga0207689_10067464
419 Ga0207661_10000004
420 Ga0207661_10409778
421 Ga0207667_10000073
422 Ga0207667_10000076
423 Ga0207667_10000147
424 Ga0207667_10038005
425 Ga0207712_10208220
426 Ga0207668_10120154
427 Ga0207640_10001053
428 Ga0207640_10022235
429 Ga0207640_10255639
430 Ga0207677_10000022
431 Ga0207677_10000057
432 Ga0207703_10000400
433 Ga0207708_10013305
434 Ga0207648_10021873
435 Ga0207648_10046733
436 Ga0207676_10000098
437 Ga0207675_100002763
438 Ga0207683_10284514
439 Ga0207428_10000010
440 Ga0268265_10517817
441 Ga0268264_10412510
442 Ga0268264_10544944
443 Ga0265338_10000953
444 Ga0307511_10019903
445 Ga0307408_100049947
446 Ga0307409_100152928
447 Ga0373932_0001609
448 Ga0373943_0042284
449 Ga0395899_0001548
450 Ga0395899_0012558
451 Ga0395900_0010335
452 Ga0395900_0023304
453 Ga0395900_0118670
454 Ga0395898_0007585
455 Ga0395898_0018071
456 Ga0395905_0007801
457 Ga0395905_0051288
458 Ga0395905_0437119
459 Ga0395901_0024279
460 Ga0395901_0067087
461 Ga0395901_0086175
462 Ga0436365_0557745
463 Ga0436365_0774883
464 Ga0436365_1042279
465 Ga0436361_0020529
466 Ga0436363_1508416
467 Ga0436362_0660519
468 Ga0436362_1017244
469 Ga0451577_0002903
470 Ga0451577_0020138
471 Ga0453683_0171389
472 Ga0453684_0000949
473 Ga0495584_0072721
474 Ga0495620_0010624
475 Ga0495656_0048653
476 Ga0495611_0071093
477 Ga0495625_0008064
478 Ga0496103_0071748
479 Ga0496107_0068785
480 Ga0496109_0499634
481 Ga0501034_0691857
482 nmdc:mga05p37_582248_c1
483 nmdc:mga06r32_2151_c1
484 nmdc:mga08y16_15_c1
485 nmdc:mga08y16_406635_c1
486 nmdc:mga0n895_557019_c1
487 nmdc:mga0rr50_70_c1
488 nmdc:mga08x19_519_c1
489 Ga0495655_0000330
490 Ga0500618_001401
491 Ga0500618_004063
492 Ga0500616_0000025
493 2511384185
494 2521558952
495 2550697188
496 2553003760
497 2765568804
498 2808984331
499 2809130684
500 2809149838
501 2819615474
502 2839096312
503 2852620020
504 2884812335
505 2884837141
506 2884853433
507 2896155450
508 2904444607
509 2904534738
510 2904584627
511 2904591094
512 2904605278
513 2919048445
514 2919081033
515 2923512613
516 2928132645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

29

277

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

34

260

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zu2-assembly1.cif.gz_C pseudomonas aeruginosa atue 0.9548 2 247
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9358 3 247
4kpk-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from shewanella pealeana atcc 700345 0.9328 3 245
4zu2-assembly1.cif.gz_C pseudomonas aeruginosa atue 0.9327 2 247
3g64-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2) 0.9258 3 245
ID Description Score Start End Superfamily
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9476 3 193 3.90.226.10
af_O50402_25_213_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9417 1 171 3.90.226.10
4mi2A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9252 3 193 3.90.226.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9196 1 55 3.30.300.220
3g64C01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9156 1 193 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7V8YVR6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9917 1 190 GO:0016853
AF-A0A536F7R9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9891 1 207
AF-A0A538I9K8-F1-model_v4 Enoyl-CoA hydratase 0.9887 1 245
AF-A0A657AUU4-F1-model_v4 Gamma-carboxygeranoyl-CoA hydratase 0.9869 2 175 GO:0008300
AF-A0A4Q3BW58-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein (EC 4.2.1.17) 0.9863 4 147 GO:0004300
GO:0008300
GO:0016853

Map