F367977

General Info

Members Datasets Scaffolds Average Seq Length
258 174 516 222

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10006375|Ga0081539_100063757
Length 251
Sequence MDSVPGTAGIFEVFIFAGITAAATGVGAVPFIFVKDLTRRWLGASNAIAAGLMLAASFGLVYEGVNYGLWRTLGGAATGLVFIVLARRALQQDEHPAVFAGMSNMDARKALLIVGVMTVHSFTEGVGVGVSFGGGVDLXXFITLAIAVHNIPEGLAISLVLVPRGVGWSRAAFWSVFSSLPQPLMAVPAFIFVETFRPLLPFGLGFAAGAMIWMVFSELMPDALEDASSNLVAIIVTLSILAMLAFQVLIR

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0.39
Rhizoplane 10.08
Rhizosphere 87.6
Stem 0
Stem Tuber 0
Unclassified 15.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10006375 3300005985 Bacteria 11354
2 Ga0065712_10230841 3300005290 Bacteria 1012
3 Ga0070683_100010173 3300005329 Bacteria 8074
4 Ga0070683_100192809 3300005329 Bacteria 1935
5 Ga0070683_100327420 3300005329 Bacteria 1458
6 Ga0070670_100004212 3300005331 Bacteria 12043
7 Ga0068869_100640874 3300005334 Unclassified 901
8 Ga0070680_100085262 3300005336 Bacteria 2610
9 Ga0068868_100121598 3300005338 Unclassified 2130
10 Ga0070660_100662864 3300005339 Bacteria 874
11 Ga0070689_100029832 3300005340 Bacteria 4134
12 Ga0070675_100014583 3300005354 Bacteria 6198
13 Ga0070673_100431534 3300005364 Bacteria 1183
14 Ga0070688_100002035 3300005365 Bacteria 10197
15 Ga0070678_100821446 3300005456 Bacteria 845
16 Ga0070681_10038886 3300005458 Bacteria 4770
17 Ga0070685_10017213 3300005466 Bacteria 3866
18 Ga0070698_100028635 3300005471 Bacteria 5784
19 Ga0070699_100026311 3300005518 Bacteria 5019
20 Ga0070679_100234880 3300005530 Bacteria 1792
21 Ga0070684_100032200 3300005535 Bacteria 4467
22 Ga0070672_100548198 3300005543 Bacteria 1004
23 Ga0070686_100358081 3300005544 Unclassified 1098
24 Ga0070664_100072740 3300005564 Bacteria 2949
25 Ga0070664_100717592 3300005564 Bacteria 932
26 Ga0068857_100304975 3300005577 Bacteria 1468
27 Ga0068857_100633147 3300005577 Bacteria 1013
28 Ga0070702_100123048 3300005615 Unclassified 1627
29 Ga0068870_10136197 3300005840 Unclassified 1432
30 Ga0068860_100184915 3300005843 Bacteria 2015
31 Ga0081538_10003168 3300005981 Bacteria 15644
32 Ga0081538_10050964 3300005981 Archaea 2492
33 Ga0075365_10186047 3300006038 Bacteria 1453
34 Ga0075428_100034872 3300006844 Bacteria 5548
35 Ga0075428_100185299 3300006844 Unclassified 2252
36 Ga0075428_100587540 3300006844 Bacteria 1190
37 Ga0075430_100009668 3300006846 Bacteria 8146
38 Ga0075430_100059263 3300006846 Unclassified 3218
39 Ga0075430_100059861 3300006846 Bacteria 3201
40 Ga0075430_100336715 3300006846 Bacteria 1247
41 Ga0075431_100180682 3300006847 Unclassified 2165
42 Ga0075431_100424853 3300006847 Bacteria 1328
43 Ga0075433_10142756 3300006852 Unclassified 2128
44 Ga0075434_100042263 3300006871 Unclassified 4519
45 Ga0075434_100063546 3300006871 Bacteria 3674
46 Ga0075429_100002082 3300006880 Bacteria 16690
47 Ga0075429_100087237 3300006880 Bacteria 2719
48 Ga0068865_100363522 3300006881 Archaea 1176
49 Ga0068865_100363894 3300006881 Bacteria 1175
50 Ga0068865_100445122 3300006881 Unclassified 1070
51 Ga0075435_100448948 3300007076 Bacteria 1112
52 Ga0111539_10011238 3300009094 Bacteria 11247
53 Ga0111539_10032678 3300009094 Bacteria 6318
54 Ga0111539_10083501 3300009094 Bacteria 3756
55 Ga0111539_10115270 3300009094 Bacteria 3151
56 Ga0105245_10110654 3300009098 Bacteria 2554
57 Ga0114129_10011389 3300009147 Bacteria 12671
58 Ga0114129_10132169 3300009147 Unclassified 3427
59 Ga0105243_10155643 3300009148 Unclassified 1965
60 Ga0105243_10314908 3300009148 Unclassified 1423
61 Ga0105242_10030116 3300009176 Unclassified 4333
62 Ga0105242_10673804 3300009176 Bacteria 1009
63 Ga0105248_10047731 3300009177 Bacteria 4802
64 Ga0105249_10229638 3300009553 Unclassified 1830
65 Ga0105239_10717053 3300010375 Bacteria 1144
66 Ga0105246_10038832 3300011119 Bacteria 3203
67 Ga0105246_10584920 3300011119 Unclassified 962
68 Ga0157374_10242187 3300013296 Bacteria 1774
69 Ga0157372_10340953 3300013307 Bacteria 1746
70 Ga0163163_10027063 3300014325 Bacteria 5487
71 Ga0163163_10305971 3300014325 Unclassified 1642
72 Ga0157380_10140675 3300014326 Bacteria 2073
73 Ga0157377_10003962 3300014745 Bacteria 6751
74 Ga0157379_10054049 3300014968 Archaea 3588
75 Ga0157376_10252086 3300014969 Bacteria 1649
76 Ga0157376_10719971 3300014969 Bacteria 1005
77 Ga0157376_10797354 3300014969 Bacteria 957
78 Ga0163161_10505200 3300017792 Unclassified 985
79 Ga0207688_10145337 3300025901 Unclassified 1398
80 Ga0207643_10132086 3300025908 Unclassified 1486
81 Ga0207707_10007044 3300025912 Bacteria 9803
82 Ga0207660_10059421 3300025917 Bacteria 2745
83 Ga0207649_10152558 3300025920 Bacteria 1593
84 Ga0207652_10040605 3300025921 Bacteria 3951
85 Ga0207659_10034405 3300025926 Bacteria 3494
86 Ga0207659_10653092 3300025926 Bacteria 899
87 Ga0207709_10015864 3300025935 Bacteria 4182
88 Ga0207670_10007936 3300025936 Bacteria 5960
89 Ga0207669_10421865 3300025937 Unclassified 1050
90 Ga0207704_10326995 3300025938 Bacteria 1185
91 Ga0207704_10489097 3300025938 Unclassified 989
92 Ga0207691_10017755 3300025940 Bacteria 6746
93 Ga0207661_10081147 3300025944 Bacteria 2678
94 Ga0207661_10421257 3300025944 Bacteria 1213
95 Ga0207661_10754331 3300025944 Bacteria 896
96 Ga0207679_10091572 3300025945 Bacteria 2353
97 Ga0207703_10138973 3300026035 Bacteria 2106
98 Ga0207708_10073094 3300026075 Bacteria 2628
99 Ga0207674_10390409 3300026116 Bacteria 1345
100 Ga0207674_10401177 3300026116 Bacteria 1325
101 Ga0207683_10337139 3300026121 Bacteria 1382
102 Ga0207683_10368861 3300026121 Bacteria 1319
103 Ga0207428_10019303 3300027907 Bacteria 5813
104 Ga0268266_10046771 3300028379 Bacteria 3705
105 Ga0268264_10120247 3300028381 Bacteria 2314
106 Ga0265338_10023378 3300028800 Bacteria 6357
107 Ga0316579_10052768 3300031691 Bacteria 1904
108 Ga0316578_10032600 3300031728 Bacteria 2978
109 Ga0307410_10355100 3300031852 Bacteria 1172
110 Ga0307406_10849685 3300031901 Bacteria 774
111 Ga0307407_10319646 3300031903 Bacteria 1089
112 Ga0307409_101073851 3300031995 Bacteria 825
113 Ga0307416_100576479 3300032002 Bacteria 1202
114 Ga0307416_100589888 3300032002 Bacteria 1190
115 Ga0307415_100097037 3300032126 Bacteria 2150
116 Ga0307415_100469887 3300032126 Bacteria 1092
117 Ga0373926_0133476 3300035083 Unclassified 941
118 Ga0373945_0069226 3300035116 Bacteria 1332
119 Ga0373954_0114036 3300035118 Unclassified 1309
120 Ga0373960_0152759 3300035121 Bacteria 790
121 Ga0373955_0549232 3300035172 Bacteria 707
122 Ga0373924_0123863 3300035410 Bacteria 1123
123 Ga0373933_0149616 3300035724 Bacteria 1478
124 Ga0373947_0013498 3300035725 Unclassified 4679
125 Ga0373937_0196423 3300036401 Bacteria 1896
126 Ga0373937_0822304 3300036401 Bacteria 877
127 Ga0373925_0149429 3300037068 Bacteria 1833
128 Ga0395900_0034640 3300037418 Bacteria 5200
129 Ga0395900_0357795 3300037418 Bacteria 1432
130 Ga0395898_0044547 3300037466 Bacteria 4366
131 Ga0395905_0248846 3300037471 Bacteria 1660
132 Ga0395905_0817843 3300037471 Bacteria 835
133 Ga0395901_0054278 3300038443 Bacteria 4164
134 Ga0395901_0282669 3300038443 Bacteria 1724
135 Ga0395901_0874300 3300038443 Unclassified 882
136 Ga0400483_103543 3300039062 Bacteria 4006
137 Ga0400483_220411 3300039062 Bacteria 2882
138 Ga0439460_0099237 3300042461 Unclassified 934
139 Ga0466967_0050996 3300045976 Bacteria 3625
140 Ga0495592_0017185 3300046454 Bacteria 5493
141 Ga0495603_0006884 3300046455 Bacteria 6823
142 Ga0495651_0269000 3300046462 Bacteria 1156
143 Ga0495653_0020511 3300046463 Bacteria 5358
144 Ga0495653_0040217 3300046463 Bacteria 3656
145 Ga0495653_0043790 3300046463 Bacteria 3477
146 Ga0495582_0041714 3300046473 Bacteria 2529
147 Ga0495582_0234285 3300046473 Bacteria 1051
148 Ga0495662_0237628 3300046476 Bacteria 898
149 Ga0495594_0148287 3300046499 Bacteria 1331
150 Ga0495596_0063760 3300046500 Bacteria 1434
151 Ga0495596_0117445 3300046500 Bacteria 1033
152 Ga0495608_0062603 3300046511 Bacteria 2444
153 Ga0495618_0103024 3300046514 Bacteria 1827
154 Ga0495628_0017463 3300046516 Bacteria 5973
155 Ga0495630_0059077 3300046517 Bacteria 2876
156 Ga0495630_0545649 3300046517 Bacteria 889
157 Ga0495652_0014118 3300046529 Bacteria 7174
158 Ga0495652_0334328 3300046529 Bacteria 1090
159 Ga0495640_0081416 3300046533 Bacteria 2152
160 Ga0495598_0112623 3300046537 Bacteria 914
161 Ga0495645_0050302 3300046543 Bacteria 3034
162 Ga0495634_0080618 3300046642 Bacteria 2130
163 Ga0495634_0106216 3300046642 Bacteria 1809
164 Ga0495635_0122784 3300046663 Bacteria 1771
165 Ga0495635_0134420 3300046663 Bacteria 1686
166 Ga0495588_0163841 3300046674 Bacteria 1175
167 Ga0495588_0172326 3300046674 Bacteria 1144
168 Ga0495588_0181675 3300046674 Unclassified 1111
169 Ga0495657_0007183 3300046675 Bacteria 8638
170 Ga0495657_0080222 3300046675 Bacteria 2112
171 Ga0495657_0196719 3300046675 Bacteria 1230
172 Ga0495657_0297352 3300046675 Bacteria 963
173 Ga0495599_0203859 3300046678 Bacteria 1214
174 Ga0495646_0194254 3300046680 Bacteria 1108
175 Ga0495647_0002235 3300046681 Bacteria 6066
176 Ga0495658_0032706 3300046683 Plasmid 2842
177 Ga0495613_0072963 3300046689 Bacteria 2502
178 Ga0495624_0093039 3300046690 Bacteria 1859
179 Ga0495600_0224752 3300046809 Bacteria 1200
180 Ga0495604_0148496 3300047317 Bacteria 1668
181 Ga0495676_0016960 3300047321 Bacteria 6449
182 Ga0495676_0531359 3300047321 Unclassified 770
183 Ga0495680_0185568 3300047322 Bacteria 1499
184 Ga0495684_0008241 3300047471 Bacteria 8067
185 Ga0495684_0120095 3300047471 Bacteria 1980
186 Ga0495602_0327870 3300048088 Unclassified 1111
187 Ga0496101_0141757 3300048904 Bacteria 1832
188 Ga0496101_0491051 3300048904 Bacteria 970
189 Ga0496104_0077431 3300048907 Bacteria 3169
190 Ga0496104_0091219 3300048907 Bacteria 2912
191 Ga0496104_0319879 3300048907 Bacteria 1464
192 Ga0496105_0008945 3300048908 Bacteria 7809
193 Ga0496108_0003537 3300048911 Bacteria 12530
194 Ga0496108_0008034 3300048911 Bacteria 8566
195 Ga0496108_0085007 3300048911 Bacteria 2685
196 Ga0496108_0281178 3300048911 Bacteria 1449
197 Ga0496109_0058178 3300048912 Bacteria 3531
198 Ga0496109_0096329 3300048912 Bacteria 2741
199 Ga0496109_0140116 3300048912 Bacteria 2261
200 Ga0496109_0200293 3300048912 Unclassified 1877
201 Ga0496109_0568457 3300048912 Bacteria 1069
202 Ga0496110_0010948 3300048913 Bacteria 7398
203 Ga0496110_0681087 3300048913 Bacteria 929
204 Ga0496111_0010216 3300048914 Bacteria 6290
205 Ga0496112_0319014 3300048915 Bacteria 1498
206 Ga0496112_0358426 3300048915 Bacteria 1400
207 Ga0496113_0045443 3300048916 Bacteria 3257
208 Ga0496113_0116115 3300048916 Bacteria 2088
209 Ga0496113_0635862 3300048916 Bacteria 854
210 Ga0496114_0264648 3300048917 Bacteria 1515
211 Ga0496114_0839002 3300048917 Bacteria 799
212 Ga0496115_0169036 3300048918 Bacteria 1808
213 Ga0501038_0574063 3300049574 Bacteria 856
214 Ga0501040_0428425 3300049576 Bacteria 951
215 Ga0501048_0026877 3300049582 Bacteria 4188
216 Ga0501067_0003862 3300049583 Bacteria 8272
217 Ga0501069_0004839 3300049585 Bacteria 6973
218 Ga0501070_0105476 3300049586 Bacteria 2330
219 Ga0501071_0439976 3300049587 Bacteria 997
220 Ga0501072_0369018 3300049588 Bacteria 1139
221 Ga0501073_0031869 3300049589 Bacteria 3761
222 Ga0501075_0154741 3300049591 Bacteria 1748
223 Ga0501076_0144238 3300049592 Bacteria 1935
224 Ga0501079_0099649 3300049741 Bacteria 2252
225 Ga0501080_0107348 3300049742 Bacteria 2588
226 Ga0501080_0453601 3300049742 Bacteria 1149
227 Ga0501081_0099416 3300049743 Bacteria 2055
228 Ga0501083_0144972 3300049744 Bacteria 1554
229 nmdc:mga00v17_254409_c1 3300050491 Bacteria 1139
230 nmdc:mga0yw44_236687_c1 3300050492 Bacteria 1213
231 nmdc:mga05p37_132758_c1 3300050507 Bacteria 3054
232 nmdc:mga05p37_36377_c1 3300050507 Bacteria 6040
233 nmdc:mga05p37_585088_c1 3300050507 Unclassified 1263
234 nmdc:mga09592_66890_c1 3300050508 Bacteria 3047
235 nmdc:mga09592_81771_c1 3300050508 Unclassified 2753
236 nmdc:mga0qj67_53077_c1 3300050509 Bacteria 3208
237 nmdc:mga0qj67_7061_c1 3300050509 Bacteria 8285
238 nmdc:mga0qj67_8436_c1 3300050509 Bacteria 7645
239 nmdc:mga06r32_50030_c1 3300050510 Unclassified 3998
240 nmdc:mga06r32_509478_c1 3300050510 Bacteria 1180
241 nmdc:mga08y16_285676_c1 3300050511 Unclassified 1701
242 nmdc:mga08y16_33302_c1 3300050511 Bacteria 5412
243 nmdc:mga08y16_561522_c1 3300050511 Unclassified 1154
244 nmdc:mga08y16_72212_c1 3300050511 Bacteria 3596
245 nmdc:mga0n895_54443_c1 3300050512 Unclassified 3935
246 nmdc:mga0a205_278635_c1 3300050515 Unclassified 1548
247 Ga0495601_0239176 3300053077 Bacteria 1185
248 Ga0495601_0260693 3300053077 Bacteria 1131
249 Ga0495595_0005712 3300053084 Bacteria 5039
250 Ga0495595_0012313 3300053084 Bacteria 3592
251 Ga0495595_0078819 3300053084 Bacteria 1566
252 Ga0495619_0036393 3300053085 Bacteria 3205
253 Ga0495619_0186330 3300053085 Bacteria 1436
254 Ga0501084_0004973 3300054114 Bacteria 10870
255 Ga0590075_008969 3300059424 Bacteria 2394
256 Ga0590075_009857 3300059424 Bacteria 2294
257 Ga0501082_0528427 3300060353 Bacteria 1031
258 2818239917 2816332527 Bacteria 8933356
259 Ga0081539_10006375
260 Ga0065712_10230841
261 Ga0070683_100010173
262 Ga0070683_100192809
263 Ga0070683_100327420
264 Ga0070670_100004212
265 Ga0068869_100640874
266 Ga0070680_100085262
267 Ga0068868_100121598
268 Ga0070660_100662864
269 Ga0070689_100029832
270 Ga0070675_100014583
271 Ga0070673_100431534
272 Ga0070688_100002035
273 Ga0070678_100821446
274 Ga0070681_10038886
275 Ga0070685_10017213
276 Ga0070698_100028635
277 Ga0070699_100026311
278 Ga0070679_100234880
279 Ga0070684_100032200
280 Ga0070672_100548198
281 Ga0070686_100358081
282 Ga0070664_100072740
283 Ga0070664_100717592
284 Ga0068857_100304975
285 Ga0068857_100633147
286 Ga0070702_100123048
287 Ga0068870_10136197
288 Ga0068860_100184915
289 Ga0081538_10003168
290 Ga0081538_10050964
291 Ga0075365_10186047
292 Ga0075428_100034872
293 Ga0075428_100185299
294 Ga0075428_100587540
295 Ga0075430_100009668
296 Ga0075430_100059263
297 Ga0075430_100059861
298 Ga0075430_100336715
299 Ga0075431_100180682
300 Ga0075431_100424853
301 Ga0075433_10142756
302 Ga0075434_100042263
303 Ga0075434_100063546
304 Ga0075429_100002082
305 Ga0075429_100087237
306 Ga0068865_100363522
307 Ga0068865_100363894
308 Ga0068865_100445122
309 Ga0075435_100448948
310 Ga0111539_10011238
311 Ga0111539_10032678
312 Ga0111539_10083501
313 Ga0111539_10115270
314 Ga0105245_10110654
315 Ga0114129_10011389
316 Ga0114129_10132169
317 Ga0105243_10155643
318 Ga0105243_10314908
319 Ga0105242_10030116
320 Ga0105242_10673804
321 Ga0105248_10047731
322 Ga0105249_10229638
323 Ga0105239_10717053
324 Ga0105246_10038832
325 Ga0105246_10584920
326 Ga0157374_10242187
327 Ga0157372_10340953
328 Ga0163163_10027063
329 Ga0163163_10305971
330 Ga0157380_10140675
331 Ga0157377_10003962
332 Ga0157379_10054049
333 Ga0157376_10252086
334 Ga0157376_10719971
335 Ga0157376_10797354
336 Ga0163161_10505200
337 Ga0207688_10145337
338 Ga0207643_10132086
339 Ga0207707_10007044
340 Ga0207660_10059421
341 Ga0207649_10152558
342 Ga0207652_10040605
343 Ga0207659_10034405
344 Ga0207659_10653092
345 Ga0207709_10015864
346 Ga0207670_10007936
347 Ga0207669_10421865
348 Ga0207704_10326995
349 Ga0207704_10489097
350 Ga0207691_10017755
351 Ga0207661_10081147
352 Ga0207661_10421257
353 Ga0207661_10754331
354 Ga0207679_10091572
355 Ga0207703_10138973
356 Ga0207708_10073094
357 Ga0207674_10390409
358 Ga0207674_10401177
359 Ga0207683_10337139
360 Ga0207683_10368861
361 Ga0207428_10019303
362 Ga0268266_10046771
363 Ga0268264_10120247
364 Ga0265338_10023378
365 Ga0316579_10052768
366 Ga0316578_10032600
367 Ga0307410_10355100
368 Ga0307406_10849685
369 Ga0307407_10319646
370 Ga0307409_101073851
371 Ga0307416_100576479
372 Ga0307416_100589888
373 Ga0307415_100097037
374 Ga0307415_100469887
375 Ga0373926_0133476
376 Ga0373945_0069226
377 Ga0373954_0114036
378 Ga0373960_0152759
379 Ga0373955_0549232
380 Ga0373924_0123863
381 Ga0373933_0149616
382 Ga0373947_0013498
383 Ga0373937_0196423
384 Ga0373937_0822304
385 Ga0373925_0149429
386 Ga0395900_0034640
387 Ga0395900_0357795
388 Ga0395898_0044547
389 Ga0395905_0248846
390 Ga0395905_0817843
391 Ga0395901_0054278
392 Ga0395901_0282669
393 Ga0395901_0874300
394 Ga0400483_103543
395 Ga0400483_220411
396 Ga0439460_0099237
397 Ga0466967_0050996
398 Ga0495592_0017185
399 Ga0495603_0006884
400 Ga0495651_0269000
401 Ga0495653_0020511
402 Ga0495653_0040217
403 Ga0495653_0043790
404 Ga0495582_0041714
405 Ga0495582_0234285
406 Ga0495662_0237628
407 Ga0495594_0148287
408 Ga0495596_0063760
409 Ga0495596_0117445
410 Ga0495608_0062603
411 Ga0495618_0103024
412 Ga0495628_0017463
413 Ga0495630_0059077
414 Ga0495630_0545649
415 Ga0495652_0014118
416 Ga0495652_0334328
417 Ga0495640_0081416
418 Ga0495598_0112623
419 Ga0495645_0050302
420 Ga0495634_0080618
421 Ga0495634_0106216
422 Ga0495635_0122784
423 Ga0495635_0134420
424 Ga0495588_0163841
425 Ga0495588_0172326
426 Ga0495588_0181675
427 Ga0495657_0007183
428 Ga0495657_0080222
429 Ga0495657_0196719
430 Ga0495657_0297352
431 Ga0495599_0203859
432 Ga0495646_0194254
433 Ga0495647_0002235
434 Ga0495658_0032706
435 Ga0495613_0072963
436 Ga0495624_0093039
437 Ga0495600_0224752
438 Ga0495604_0148496
439 Ga0495676_0016960
440 Ga0495676_0531359
441 Ga0495680_0185568
442 Ga0495684_0008241
443 Ga0495684_0120095
444 Ga0495602_0327870
445 Ga0496101_0141757
446 Ga0496101_0491051
447 Ga0496104_0077431
448 Ga0496104_0091219
449 Ga0496104_0319879
450 Ga0496105_0008945
451 Ga0496108_0003537
452 Ga0496108_0008034
453 Ga0496108_0085007
454 Ga0496108_0281178
455 Ga0496109_0058178
456 Ga0496109_0096329
457 Ga0496109_0140116
458 Ga0496109_0200293
459 Ga0496109_0568457
460 Ga0496110_0010948
461 Ga0496110_0681087
462 Ga0496111_0010216
463 Ga0496112_0319014
464 Ga0496112_0358426
465 Ga0496113_0045443
466 Ga0496113_0116115
467 Ga0496113_0635862
468 Ga0496114_0264648
469 Ga0496114_0839002
470 Ga0496115_0169036
471 Ga0501038_0574063
472 Ga0501040_0428425
473 Ga0501048_0026877
474 Ga0501067_0003862
475 Ga0501069_0004839
476 Ga0501070_0105476
477 Ga0501071_0439976
478 Ga0501072_0369018
479 Ga0501073_0031869
480 Ga0501075_0154741
481 Ga0501076_0144238
482 Ga0501079_0099649
483 Ga0501080_0107348
484 Ga0501080_0453601
485 Ga0501081_0099416
486 Ga0501083_0144972
487 nmdc:mga00v17_254409_c1
488 nmdc:mga0yw44_236687_c1
489 nmdc:mga05p37_132758_c1
490 nmdc:mga05p37_36377_c1
491 nmdc:mga05p37_585088_c1
492 nmdc:mga09592_66890_c1
493 nmdc:mga09592_81771_c1
494 nmdc:mga0qj67_53077_c1
495 nmdc:mga0qj67_7061_c1
496 nmdc:mga0qj67_8436_c1
497 nmdc:mga06r32_50030_c1
498 nmdc:mga06r32_509478_c1
499 nmdc:mga08y16_285676_c1
500 nmdc:mga08y16_33302_c1
501 nmdc:mga08y16_561522_c1
502 nmdc:mga08y16_72212_c1
503 nmdc:mga0n895_54443_c1
504 nmdc:mga0a205_278635_c1
505 Ga0495601_0239176
506 Ga0495601_0260693
507 Ga0495595_0005712
508 Ga0495595_0012313
509 Ga0495595_0078819
510 Ga0495619_0036393
511 Ga0495619_0186330
512 Ga0501084_0004973
513 Ga0590075_008969
514 Ga0590075_009857
515 Ga0501082_0528427
516 2818239917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02535

Zip

ZIP Zinc transporter

88

245

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.6853 3 215
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.6772 3 215
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.662 6 207
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.6451 9 215
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.6449 3 215
ID Description Score Start End Superfamily
af_Q2G1R0_213_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4938 35 214 1.20.1250.20
af_Q8I292_492_703_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4397 22 214 1.20.1250.20
af_I1KNR1_88_323_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4274 35 214 1.20.1250.20
af_Q1ZXJ4_16_271_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4234 36 209 1.20.1250.20
af_Q2G1R0_213_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3957 35 214 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7S3UBR7-F1-model_v4 Zinc transporter 0.8786 17 212 GO:0005385
GO:0012505
GO:0016020
AF-A0A7S0IAW2-F1-model_v4 Zinc permease family 0.8763 4 212 GO:0005385
GO:0016020
AF-A8J232-F1-model_v4 deleted 0.8752 2 213
AF-A0A7S2BBY2-F1-model_v4 Uncharacterized protein 0.8748 2 210 GO:0005385
GO:0016020
AF-A0A250XL40-F1-model_v4 Uncharacterized protein 0.8747 4 213 GO:0005385
GO:0016020

Map