F367810

General Info

Members Datasets Scaffolds Average Seq Length
258 153 516 295

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10001489|Ga0070658_1000148912
Length 321
Sequence MSRRLDGGEEAQAPASPGPGGKSGASPLEARGLGKRFRREWGLRDCTLELPRGAIVGLAGANAAGKSTLLALATGLLTPTEGTISVLGRDPLRDPAVLAEVGFVAQGAPLYRSFTVADSIEFARRTNTRSDSSIAAELLPSLGSRTKVGDLSAGDRARLALALALGKRPQLLLLDEPFAGLDPLAGREFLQLLMDGVAETSATVVIASHVIADIERVCDHIVLLAGGGVRLQGNVEALLDSHRLLMGPRRPLGSIRGVREIVRERHSGRQLTLLVTTDGPIVDPSWRVDHVALEELLLAYMAPERLPTPQPPERVPLRWHG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.14
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001489 3300005327 Bacteria 19888
2 Ga0070658_10164358 3300005327 Bacteria 1863
3 Ga0070683_100001888 3300005329 Bacteria 16370
4 Ga0070683_100015569 3300005329 Bacteria 6684
5 Ga0070683_100665305 3300005329 Bacteria 997
6 Ga0070680_100001349 3300005336 Bacteria 17750
7 Ga0070660_100001388 3300005339 Bacteria 16476
8 Ga0070660_100043548 3300005339 Bacteria 3431
9 Ga0070661_100138455 3300005344 Bacteria 1833
10 Ga0070661_100177163 3300005344 Bacteria 1621
11 Ga0070675_100040264 3300005354 Bacteria 3814
12 Ga0070688_100230317 3300005365 Bacteria 1310
13 Ga0070659_100152841 3300005366 Bacteria 1884
14 Ga0070667_100093455 3300005367 Bacteria 2590
15 Ga0070709_10099323 3300005434 Bacteria 1936
16 Ga0070714_100354772 3300005435 Bacteria 1378
17 Ga0070681_10001836 3300005458 Bacteria 19155
18 Ga0068867_100273579 3300005459 Bacteria 1382
19 Ga0070706_100215158 3300005467 Bacteria 1794
20 Ga0070699_100257232 3300005518 Bacteria 1561
21 Ga0070679_100003334 3300005530 Bacteria 14707
22 Ga0070684_100001285 3300005535 Bacteria 17978
23 Ga0070684_100193133 3300005535 Bacteria 1853
24 Ga0070684_100377633 3300005535 Bacteria 1305
25 Ga0068855_100013934 3300005563 Bacteria 9697
26 Ga0068855_100018268 3300005563 Bacteria 8421
27 Ga0068857_100056574 3300005577 Bacteria 3481
28 Ga0068852_100130581 3300005616 Bacteria 2313
29 Ga0081455_10007764 3300005937 Bacteria 11246
30 Ga0070717_10063417 3300006028 Bacteria 3067
31 Ga0070712_100031912 3300006175 Bacteria 3553
32 Ga0070712_100044452 3300006175 Bacteria 3063
33 Ga0070712_100372322 3300006175 Bacteria 1174
34 Ga0097621_100166673 3300006237 Bacteria 1897
35 Ga0075433_10141501 3300006852 Unclassified 2138
36 Ga0075433_10234229 3300006852 Bacteria 1630
37 Ga0075434_100000858 3300006871 Bacteria 24266
38 Ga0075434_100120493 3300006871 Bacteria 2639
39 Ga0068865_100058630 3300006881 Bacteria 2690
40 Ga0105240_10034965 3300009093 Bacteria 6479
41 Ga0105240_10185487 3300009093 Bacteria 2451
42 Ga0105240_10312968 3300009093 Bacteria 1792
43 Ga0105245_10014003 3300009098 Bacteria 6986
44 Ga0157370_10003344 3300013104 Bacteria 18884
45 Ga0157370_10112792 3300013104 Bacteria 2541
46 Ga0157369_10003269 3300013105 Bacteria 19304
47 Ga0157369_10138077 3300013105 Bacteria 2580
48 Ga0157374_10024099 3300013296 Bacteria 5451
49 Ga0157372_10090088 3300013307 Bacteria 3486
50 Ga0182008_10149762 3300014497 Bacteria 1170
51 Ga0157376_10010123 3300014969 Bacteria 6887
52 Ga0206353_10090456 3300020082 Bacteria 13485
53 Ga0206353_10553512 3300020082 Bacteria 3650
54 Ga0207705_10006738 3300025909 Bacteria 8491
55 Ga0207705_10067293 3300025909 Bacteria 2592
56 Ga0207684_10186895 3300025910 Bacteria 1786
57 Ga0207707_10009685 3300025912 Bacteria 8359
58 Ga0207695_10089420 3300025913 Bacteria 3097
59 Ga0207695_10315121 3300025913 Bacteria 1454
60 Ga0207693_10035875 3300025915 Bacteria 3908
61 Ga0207693_10366966 3300025915 Bacteria 1126
62 Ga0207660_10002630 3300025917 Bacteria 11785
63 Ga0207657_10010219 3300025919 Bacteria 9374
64 Ga0207649_10119133 3300025920 Bacteria 1777
65 Ga0207652_10049464 3300025921 Bacteria 3598
66 Ga0207659_10048962 3300025926 Bacteria 2996
67 Ga0207687_10047202 3300025927 Bacteria 2985
68 Ga0207664_10011192 3300025929 Bacteria 6362
69 Ga0207664_10066263 3300025929 Bacteria 2894
70 Ga0207690_10097057 3300025932 Bacteria 2097
71 Ga0207706_10148796 3300025933 Bacteria 2060
72 Ga0207669_10084115 3300025937 Bacteria 2049
73 Ga0207661_10019139 3300025944 Bacteria 5098
74 Ga0207667_10008607 3300025949 Bacteria 12105
75 Ga0207658_10002507 3300025986 Bacteria 13363
76 Ga0207702_10361118 3300026078 Bacteria 1392
77 Ga0207648_10321041 3300026089 Bacteria 1392
78 Ga0207674_10113148 3300026116 Bacteria 2687
79 Ga0265319_1000639 3300028563 Bacteria 23124
80 Ga0265319_1017170 3300028563 Bacteria 2757
81 Ga0265334_10002795 3300028573 Bacteria 8050
82 Ga0265318_10001858 3300028577 Bacteria 11908
83 Ga0265318_10002970 3300028577 Bacteria 8773
84 Ga0265318_10003331 3300028577 Bacteria 8134
85 Ga0265318_10077627 3300028577 Bacteria 1228
86 Ga0265322_10021235 3300028654 Bacteria 1860
87 Ga0265336_10009518 3300028666 Bacteria 3356
88 Ga0265338_10004923 3300028800 Bacteria 17749
89 Ga0265338_10029713 3300028800 Bacteria 5409
90 Ga0265338_10052212 3300028800 Bacteria 3672
91 Ga0265338_10110055 3300028800 Bacteria 2221
92 Ga0265338_10265817 3300028800 Bacteria 1259
93 Ga0265330_10065305 3300031235 Bacteria 1580
94 Ga0265320_10030564 3300031240 Bacteria 2776
95 Ga0265320_10031616 3300031240 Bacteria 2717
96 Ga0265320_10069686 3300031240 Bacteria 1659
97 Ga0265325_10001537 3300031241 Bacteria 16147
98 Ga0265325_10045757 3300031241 Bacteria 2272
99 Ga0265329_10006754 3300031242 Bacteria 4517
100 Ga0265339_10007119 3300031249 Bacteria 7263
101 Ga0265339_10013901 3300031249 Bacteria 4870
102 Ga0265339_10036623 3300031249 Bacteria 2745
103 Ga0265331_10009821 3300031250 Bacteria 5337
104 Ga0265331_10062394 3300031250 Bacteria 1758
105 Ga0265327_10024542 3300031251 Bacteria 3539
106 Ga0265327_10052407 3300031251 Bacteria 2125
107 Ga0265327_10071618 3300031251 Bacteria 1733
108 Ga0265316_10058830 3300031344 Bacteria 2992
109 Ga0265316_10075698 3300031344 Bacteria 2588
110 Ga0265313_10003675 3300031595 Bacteria 12254
111 Ga0265313_10067067 3300031595 Bacteria 1661
112 Ga0265314_10006579 3300031711 Bacteria 10240
113 Ga0265314_10016463 3300031711 Bacteria 5838
114 Ga0373945_0022450 3300035116 Bacteria 2173
115 Ga0373935_0023052 3300035692 Bacteria 3823
116 Ga0373933_0022204 3300035724 Bacteria 3612
117 Ga0373947_0000388 3300035725 Bacteria 24851
118 Ga0373937_0006316 3300036401 Bacteria 10218
119 Ga0373937_0561849 3300036401 Bacteria 1084
120 Ga0373925_0016114 3300037068 Bacteria 5412
121 Ga0395899_0005189 3300037312 Bacteria 10136
122 Ga0395899_0009336 3300037312 Bacteria 7533
123 Ga0395899_0009839 3300037312 Bacteria 7333
124 Ga0395899_0125354 3300037312 Bacteria 1837
125 Ga0395900_0011547 3300037418 Bacteria 9038
126 Ga0395900_0034466 3300037418 Bacteria 5213
127 Ga0395900_0052093 3300037418 Bacteria 4214
128 Ga0395900_0085916 3300037418 Bacteria 3233
129 Ga0395900_0092809 3300037418 Bacteria 3101
130 Ga0395900_0236893 3300037418 Bacteria 1833
131 Ga0395898_0002150 3300037466 Bacteria 24270
132 Ga0395898_0007430 3300037466 Bacteria 11630
133 Ga0395898_0030167 3300037466 Bacteria 5428
134 Ga0395898_0084184 3300037466 Bacteria 3065
135 Ga0395898_0132164 3300037466 Bacteria 2390
136 Ga0395898_0286291 3300037466 Bacteria 1572
137 Ga0395898_0300324 3300037466 Bacteria 1532
138 Ga0395905_0080259 3300037471 Bacteria 3057
139 Ga0395905_0125778 3300037471 Bacteria 2410
140 Ga0395905_0197045 3300037471 Bacteria 1889
141 Ga0395905_0389439 3300037471 Bacteria 1288
142 Ga0395905_0393506 3300037471 Bacteria 1280
143 Ga0395901_0006516 3300038443 Bacteria 11810
144 Ga0395901_0011472 3300038443 Bacteria 8980
145 Ga0395901_0018959 3300038443 Bacteria 7035
146 Ga0395901_0094259 3300038443 Bacteria 3136
147 Ga0395901_0119730 3300038443 Bacteria 2766
148 Ga0395901_0129186 3300038443 Bacteria 2655
149 Ga0395901_0241147 3300038443 Bacteria 1885
150 Ga0395901_0356761 3300038443 Bacteria 1508
151 Ga0436360_1117696 3300039438 Bacteria 4333
152 Ga0466961_0004282 3300044693 Bacteria 8936
153 Ga0466963_0089013 3300044694 Bacteria 2100
154 Ga0466971_0013020 3300044719 Bacteria 3649
155 Ga0466957_0006733 3300044842 Bacteria 6495
156 Ga0466959_0010606 3300045049 Bacteria 6596
157 Ga0466959_0047187 3300045049 Bacteria 3169
158 Ga0466958_0006655 3300045836 Bacteria 6303
159 Ga0466967_0053297 3300045976 Bacteria 3554
160 Ga0466967_0132231 3300045976 Unclassified 2317
161 Ga0466967_0191204 3300045976 Bacteria 1934
162 Ga0495592_0000207 3300046454 Bacteria 50220
163 Ga0495592_0000668 3300046454 Bacteria 23839
164 Ga0495592_0289898 3300046454 Bacteria 1067
165 Ga0495603_0041562 3300046455 Bacteria 2749
166 Ga0495629_0193139 3300046459 Bacteria 1409
167 Ga0495651_0000106 3300046462 Bacteria 61363
168 Ga0495653_0005592 3300046463 Bacteria 10249
169 Ga0495653_0164177 3300046463 Bacteria 1539
170 Ga0495653_0177185 3300046463 Bacteria 1466
171 Ga0495582_0105341 3300046473 Bacteria 1581
172 Ga0495662_0064880 3300046476 Bacteria 1765
173 Ga0495608_0000790 3300046511 Bacteria 22205
174 Ga0495618_0002764 3300046514 Bacteria 11159
175 Ga0495618_0057950 3300046514 Bacteria 2453
176 Ga0495628_0000185 3300046516 Bacteria 54717
177 Ga0495628_0006338 3300046516 Bacteria 10340
178 Ga0495630_0032112 3300046517 Bacteria 3910
179 Ga0495663_0056960 3300046525 Bacteria 1222
180 Ga0495652_0000466 3300046529 Bacteria 47387
181 Ga0495652_0090136 3300046529 Bacteria 2509
182 Ga0495587_0000537 3300046536 Bacteria 26275
183 Ga0495587_0048224 3300046536 Bacteria 2522
184 Ga0495645_0000115 3300046543 Bacteria 54956
185 Ga0495645_0105912 3300046543 Bacteria 1994
186 Ga0495667_0017801 3300046559 Bacteria 4800
187 Ga0495634_0025608 3300046642 Bacteria 4123
188 Ga0495635_0020134 3300046663 Bacteria 4650
189 Ga0495657_0023779 3300046675 Bacteria 4375
190 Ga0495657_0024799 3300046675 Bacteria 4266
191 Ga0495657_0034421 3300046675 Bacteria 3518
192 Ga0495599_0000135 3300046678 Bacteria 47515
193 Ga0495599_0001535 3300046678 Bacteria 13282
194 Ga0495623_0000350 3300046679 Bacteria 30436
195 Ga0495646_0003427 3300046680 Bacteria 9858
196 Ga0495646_0080234 3300046680 Bacteria 1903
197 Ga0495658_0129858 3300046683 Bacteria 1532
198 Ga0495624_0149940 3300046690 Bacteria 1427
199 Ga0495604_0000060 3300047317 Bacteria 95444
200 Ga0495674_0026530 3300047319 Bacteria 5301
201 Ga0495674_0038463 3300047319 Bacteria 4294
202 Ga0495676_0203517 3300047321 Bacteria 1374
203 Ga0495680_0022037 3300047322 Bacteria 5320
204 Ga0495680_0024386 3300047322 Bacteria 5018
205 Ga0495680_0065416 3300047322 Bacteria 2784
206 Ga0495680_0084835 3300047322 Bacteria 2386
207 Ga0495675_0000223 3300047444 Bacteria 41211
208 Ga0495684_0002647 3300047471 Bacteria 14220
209 Ga0495684_0070611 3300047471 Bacteria 2655
210 Ga0495602_0000197 3300048088 Bacteria 56557
211 Ga0495602_0016075 3300048088 Bacteria 7530
212 Ga0496100_0090646 3300048903 Bacteria 2085
213 Ga0496100_0098313 3300048903 Bacteria 2012
214 Ga0496102_0175959 3300048905 Bacteria 2015
215 Ga0496104_0013716 3300048907 Bacteria 7309
216 Ga0496104_0588253 3300048907 Bacteria 1023
217 Ga0496105_0005454 3300048908 Bacteria 9649
218 Ga0496106_0022965 3300048909 Bacteria 4633
219 Ga0496107_0262364 3300048910 Bacteria 1285
220 Ga0496108_0009397 3300048911 Bacteria 7916
221 Ga0496108_0091783 3300048911 Bacteria 2582
222 Ga0496109_0001075 3300048912 Bacteria 22665
223 Ga0496109_0106585 3300048912 Bacteria 2603
224 Ga0496109_0211965 3300048912 Bacteria 1822
225 Ga0496110_0158717 3300048913 Bacteria 2050
226 Ga0496110_0182663 3300048913 Bacteria 1905
227 Ga0496111_0023249 3300048914 Bacteria 4351
228 Ga0496112_0018672 3300048915 Bacteria 6535
229 Ga0496112_0083525 3300048915 Bacteria 3159
230 Ga0496114_0020564 3300048917 Bacteria 5357
231 Ga0496114_0179826 3300048917 Bacteria 1847
232 Ga0496115_0123292 3300048918 Bacteria 2133
233 Ga0501032_0256413 3300049569 Bacteria 1135
234 Ga0501043_0195846 3300049579 Bacteria 1570
235 Ga0501046_0108471 3300049580 Bacteria 2123
236 Ga0501069_0020460 3300049585 Bacteria 3586
237 Ga0501069_0023560 3300049585 Bacteria 3358
238 Ga0501070_0001951 3300049586 Bacteria 18195
239 Ga0501070_0236879 3300049586 Bacteria 1494
240 Ga0501074_0062602 3300049590 Bacteria 2680
241 Ga0501079_0125144 3300049741 Bacteria 2000
242 Ga0501080_0142054 3300049742 Bacteria 2219
243 Ga0501080_0146414 3300049742 Bacteria 2183
244 Ga0501080_0385004 3300049742 Bacteria 1263
245 Ga0501081_0134636 3300049743 Bacteria 1768
246 Ga0501044_0152326 3300049823 Bacteria 2294
247 Ga0501044_0504549 3300049823 Bacteria 1111
248 nmdc:mga05p37_216985_c2 3300050507 Bacteria 1929
249 nmdc:mga0n895_191752_c1 3300050512 Unclassified 2075
250 nmdc:mga0a205_170999_c1 3300050515 Unclassified 2069
251 Ga0495601_0000238 3300053077 Bacteria 29363
252 Ga0495601_0000805 3300053077 Bacteria 16955
253 Ga0495601_0052096 3300053077 Bacteria 2583
254 Ga0495612_0027982 3300053078 Bacteria 2268
255 Ga0495595_0063055 3300053084 Bacteria 1739
256 Ga0495595_0178494 3300053084 Bacteria 1052
257 Ga0495619_0000200 3300053085 Bacteria 43823
258 Ga0495619_0043062 3300053085 Bacteria 2958
259 Ga0070658_10001489
260 Ga0070658_10164358
261 Ga0070683_100001888
262 Ga0070683_100015569
263 Ga0070683_100665305
264 Ga0070680_100001349
265 Ga0070660_100001388
266 Ga0070660_100043548
267 Ga0070661_100138455
268 Ga0070661_100177163
269 Ga0070675_100040264
270 Ga0070688_100230317
271 Ga0070659_100152841
272 Ga0070667_100093455
273 Ga0070709_10099323
274 Ga0070714_100354772
275 Ga0070681_10001836
276 Ga0068867_100273579
277 Ga0070706_100215158
278 Ga0070699_100257232
279 Ga0070679_100003334
280 Ga0070684_100001285
281 Ga0070684_100193133
282 Ga0070684_100377633
283 Ga0068855_100013934
284 Ga0068855_100018268
285 Ga0068857_100056574
286 Ga0068852_100130581
287 Ga0081455_10007764
288 Ga0070717_10063417
289 Ga0070712_100031912
290 Ga0070712_100044452
291 Ga0070712_100372322
292 Ga0097621_100166673
293 Ga0075433_10141501
294 Ga0075433_10234229
295 Ga0075434_100000858
296 Ga0075434_100120493
297 Ga0068865_100058630
298 Ga0105240_10034965
299 Ga0105240_10185487
300 Ga0105240_10312968
301 Ga0105245_10014003
302 Ga0157370_10003344
303 Ga0157370_10112792
304 Ga0157369_10003269
305 Ga0157369_10138077
306 Ga0157374_10024099
307 Ga0157372_10090088
308 Ga0182008_10149762
309 Ga0157376_10010123
310 Ga0206353_10090456
311 Ga0206353_10553512
312 Ga0207705_10006738
313 Ga0207705_10067293
314 Ga0207684_10186895
315 Ga0207707_10009685
316 Ga0207695_10089420
317 Ga0207695_10315121
318 Ga0207693_10035875
319 Ga0207693_10366966
320 Ga0207660_10002630
321 Ga0207657_10010219
322 Ga0207649_10119133
323 Ga0207652_10049464
324 Ga0207659_10048962
325 Ga0207687_10047202
326 Ga0207664_10011192
327 Ga0207664_10066263
328 Ga0207690_10097057
329 Ga0207706_10148796
330 Ga0207669_10084115
331 Ga0207661_10019139
332 Ga0207667_10008607
333 Ga0207658_10002507
334 Ga0207702_10361118
335 Ga0207648_10321041
336 Ga0207674_10113148
337 Ga0265319_1000639
338 Ga0265319_1017170
339 Ga0265334_10002795
340 Ga0265318_10001858
341 Ga0265318_10002970
342 Ga0265318_10003331
343 Ga0265318_10077627
344 Ga0265322_10021235
345 Ga0265336_10009518
346 Ga0265338_10004923
347 Ga0265338_10029713
348 Ga0265338_10052212
349 Ga0265338_10110055
350 Ga0265338_10265817
351 Ga0265330_10065305
352 Ga0265320_10030564
353 Ga0265320_10031616
354 Ga0265320_10069686
355 Ga0265325_10001537
356 Ga0265325_10045757
357 Ga0265329_10006754
358 Ga0265339_10007119
359 Ga0265339_10013901
360 Ga0265339_10036623
361 Ga0265331_10009821
362 Ga0265331_10062394
363 Ga0265327_10024542
364 Ga0265327_10052407
365 Ga0265327_10071618
366 Ga0265316_10058830
367 Ga0265316_10075698
368 Ga0265313_10003675
369 Ga0265313_10067067
370 Ga0265314_10006579
371 Ga0265314_10016463
372 Ga0373945_0022450
373 Ga0373935_0023052
374 Ga0373933_0022204
375 Ga0373947_0000388
376 Ga0373937_0006316
377 Ga0373937_0561849
378 Ga0373925_0016114
379 Ga0395899_0005189
380 Ga0395899_0009336
381 Ga0395899_0009839
382 Ga0395899_0125354
383 Ga0395900_0011547
384 Ga0395900_0034466
385 Ga0395900_0052093
386 Ga0395900_0085916
387 Ga0395900_0092809
388 Ga0395900_0236893
389 Ga0395898_0002150
390 Ga0395898_0007430
391 Ga0395898_0030167
392 Ga0395898_0084184
393 Ga0395898_0132164
394 Ga0395898_0286291
395 Ga0395898_0300324
396 Ga0395905_0080259
397 Ga0395905_0125778
398 Ga0395905_0197045
399 Ga0395905_0389439
400 Ga0395905_0393506
401 Ga0395901_0006516
402 Ga0395901_0011472
403 Ga0395901_0018959
404 Ga0395901_0094259
405 Ga0395901_0119730
406 Ga0395901_0129186
407 Ga0395901_0241147
408 Ga0395901_0356761
409 Ga0436360_1117696
410 Ga0466961_0004282
411 Ga0466963_0089013
412 Ga0466971_0013020
413 Ga0466957_0006733
414 Ga0466959_0010606
415 Ga0466959_0047187
416 Ga0466958_0006655
417 Ga0466967_0053297
418 Ga0466967_0132231
419 Ga0466967_0191204
420 Ga0495592_0000207
421 Ga0495592_0000668
422 Ga0495592_0289898
423 Ga0495603_0041562
424 Ga0495629_0193139
425 Ga0495651_0000106
426 Ga0495653_0005592
427 Ga0495653_0164177
428 Ga0495653_0177185
429 Ga0495582_0105341
430 Ga0495662_0064880
431 Ga0495608_0000790
432 Ga0495618_0002764
433 Ga0495618_0057950
434 Ga0495628_0000185
435 Ga0495628_0006338
436 Ga0495630_0032112
437 Ga0495663_0056960
438 Ga0495652_0000466
439 Ga0495652_0090136
440 Ga0495587_0000537
441 Ga0495587_0048224
442 Ga0495645_0000115
443 Ga0495645_0105912
444 Ga0495667_0017801
445 Ga0495634_0025608
446 Ga0495635_0020134
447 Ga0495657_0023779
448 Ga0495657_0024799
449 Ga0495657_0034421
450 Ga0495599_0000135
451 Ga0495599_0001535
452 Ga0495623_0000350
453 Ga0495646_0003427
454 Ga0495646_0080234
455 Ga0495658_0129858
456 Ga0495624_0149940
457 Ga0495604_0000060
458 Ga0495674_0026530
459 Ga0495674_0038463
460 Ga0495676_0203517
461 Ga0495680_0022037
462 Ga0495680_0024386
463 Ga0495680_0065416
464 Ga0495680_0084835
465 Ga0495675_0000223
466 Ga0495684_0002647
467 Ga0495684_0070611
468 Ga0495602_0000197
469 Ga0495602_0016075
470 Ga0496100_0090646
471 Ga0496100_0098313
472 Ga0496102_0175959
473 Ga0496104_0013716
474 Ga0496104_0588253
475 Ga0496105_0005454
476 Ga0496106_0022965
477 Ga0496107_0262364
478 Ga0496108_0009397
479 Ga0496108_0091783
480 Ga0496109_0001075
481 Ga0496109_0106585
482 Ga0496109_0211965
483 Ga0496110_0158717
484 Ga0496110_0182663
485 Ga0496111_0023249
486 Ga0496112_0018672
487 Ga0496112_0083525
488 Ga0496114_0020564
489 Ga0496114_0179826
490 Ga0496115_0123292
491 Ga0501032_0256413
492 Ga0501043_0195846
493 Ga0501046_0108471
494 Ga0501069_0020460
495 Ga0501069_0023560
496 Ga0501070_0001951
497 Ga0501070_0236879
498 Ga0501074_0062602
499 Ga0501079_0125144
500 Ga0501080_0142054
501 Ga0501080_0146414
502 Ga0501080_0385004
503 Ga0501081_0134636
504 Ga0501044_0152326
505 Ga0501044_0504549
506 nmdc:mga05p37_216985_c2
507 nmdc:mga0n895_191752_c1
508 nmdc:mga0a205_170999_c1
509 Ga0495601_0000238
510 Ga0495601_0000805
511 Ga0495601_0052096
512 Ga0495612_0027982
513 Ga0495595_0063055
514 Ga0495595_0178494
515 Ga0495619_0000200
516 Ga0495619_0043062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

179

0.86

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

118

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.8964 25 238
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.8866 25 239
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8866 28 241
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8844 26 240
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.884 26 240
ID Description Score Start End Superfamily
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9141 26 240 3.40.50.300
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9129 24 238 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9121 22 238 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9098 41 240 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9069 25 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2G2M205-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9325 26 240 GO:0005524
GO:0016887
AF-A0A1Y6BR85-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9234 28 240 GO:0005524
GO:0016887
AF-A0A830FP66-F1-model_v4 Copper ABC transporter ATP-binding protein 0.9225 23 240 GO:0005524
GO:0016887
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.9203 27 238 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9175 26 240 GO:0005524
GO:0016887

Map