F367805

General Info

Members Datasets Scaffolds Average Seq Length
258 149 258 164

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10059479|Ga0065707_100594791
Length 187
Sequence VALHVSRFMSVEYQLMTETTLTPSRLWKRMSSDQRQRAALAFWADPEATDDQVQAAFLIAQQKKFRPKTVIGLDLDRKAKHLATVAGVPDQIAARALVTYHLAEQRPMMGAFLDALGIAHENGLIQEENVKPDTARMKGAVEKISAEFPAEDVQIYLNTLLCQDPETWGGLEETVKTFEESGLGARG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 5.43
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10120900 3300005289 Bacteria 1775
2 Ga0065707_10059479 3300005295 Bacteria 697
3 Ga0065707_10172228 3300005295 Bacteria 1476
4 Ga0070670_100211667 3300005331 Unclassified 1686
5 Ga0070670_100623366 3300005331 Bacteria 966
6 Ga0070670_100694837 3300005331 Bacteria 914
7 Ga0070666_10163769 3300005335 Bacteria 1555
8 Ga0070680_100226937 3300005336 Bacteria 1577
9 Ga0068868_100016003 3300005338 Bacteria 5562
10 Ga0070689_100046429 3300005340 Bacteria 3347
11 Ga0070689_100469369 3300005340 Bacteria 1073
12 Ga0070687_100171682 3300005343 Bacteria 1291
13 Ga0070668_100365913 3300005347 Bacteria 1224
14 Ga0070669_100180548 3300005353 Bacteria 1651
15 Ga0070675_100632812 3300005354 Bacteria 972
16 Ga0070675_101193378 3300005354 Bacteria 701
17 Ga0070671_100008670 3300005355 Bacteria 8157
18 Ga0070671_100144692 3300005355 Bacteria 2006
19 Ga0070673_100085137 3300005364 Bacteria 2573
20 Ga0070673_100864767 3300005364 Unclassified 837
21 Ga0070688_100429520 3300005365 Bacteria 983
22 Ga0070659_101169893 3300005366 Bacteria 679
23 Ga0070667_100025944 3300005367 Bacteria 4874
24 Ga0070667_100502880 3300005367 Bacteria 1111
25 Ga0070709_10016431 3300005434 Bacteria 4225
26 Ga0070709_10227081 3300005434 Bacteria 1334
27 Ga0070713_100088413 3300005436 Bacteria 2659
28 Ga0070713_100153260 3300005436 Bacteria 2052
29 Ga0070713_101341992 3300005436 Unclassified 693
30 Ga0070701_10209242 3300005438 Bacteria 1157
31 Ga0070705_100019049 3300005440 Bacteria 3607
32 Ga0070705_100158275 3300005440 Unclassified 1511
33 Ga0070694_100003652 3300005444 Bacteria 9181
34 Ga0070708_100018010 3300005445 Bacteria 5906
35 Ga0070708_100044930 3300005445 Bacteria 3889
36 Ga0070681_10033755 3300005458 Bacteria 5137
37 Ga0070681_10137419 3300005458 Bacteria 2374
38 Ga0070685_10282475 3300005466 Bacteria 1112
39 Ga0070706_101093054 3300005467 Bacteria 734
40 Ga0070707_100734462 3300005468 Unclassified 950
41 Ga0070698_100099386 3300005471 Bacteria 2883
42 Ga0070698_100117016 3300005471 Bacteria 2628
43 Ga0070698_100307881 3300005471 Bacteria 1515
44 Ga0070699_100018755 3300005518 Bacteria 5942
45 Ga0070699_100509278 3300005518 Bacteria 1094
46 Ga0070699_100545210 3300005518 Bacteria 1055
47 Ga0070679_100082745 3300005530 Bacteria 3199
48 Ga0070672_100008648 3300005543 Bacteria 6977
49 Ga0070686_100651728 3300005544 Bacteria 835
50 Ga0070686_100758065 3300005544 Bacteria 779
51 Ga0070695_100013654 3300005545 Bacteria 4882
52 Ga0070696_100034335 3300005546 Bacteria 3489
53 Ga0070696_100081492 3300005546 Bacteria 2293
54 Ga0070665_100084939 3300005548 Unclassified 3170
55 Ga0070704_100051968 3300005549 Bacteria 2889
56 Ga0070704_100425589 3300005549 Unclassified 1138
57 Ga0068859_100295685 3300005617 Bacteria 1712
58 Ga0068859_100794957 3300005617 Bacteria 1034
59 Ga0068859_101505912 3300005617 Bacteria 743
60 Ga0068866_10095940 3300005718 Bacteria 1625
61 Ga0068866_10209308 3300005718 Bacteria 1170
62 Ga0068861_100296397 3300005719 Bacteria 1399
63 Ga0068861_100587654 3300005719 Bacteria 1020
64 Ga0068863_100004492 3300005841 Bacteria 13762
65 Ga0068863_100472284 3300005841 Bacteria 1233
66 Ga0068858_100171626 3300005842 Unclassified 2045
67 Ga0068858_101100802 3300005842 Bacteria 780
68 Ga0068860_100058408 3300005843 Unclassified 3667
69 Ga0068860_100350189 3300005843 Bacteria 1453
70 Ga0068860_101056929 3300005843 Unclassified 831
71 Ga0068860_101194079 3300005843 Bacteria 781
72 Ga0068862_100004877 3300005844 Bacteria 11296
73 Ga0081455_10087453 3300005937 Bacteria 2535
74 Ga0081455_10114921 3300005937 Bacteria 2131
75 Ga0081539_10007146 3300005985 Bacteria 10302
76 Ga0075432_10065282 3300006058 Bacteria 1301
77 Ga0070712_100314412 3300006175 Unclassified 1272
78 Ga0075367_10067912 3300006178 Bacteria 2138
79 Ga0075366_10037241 3300006195 Bacteria 2871
80 Ga0097621_100003790 3300006237 Bacteria 10468
81 Ga0097621_100206553 3300006237 Bacteria 1707
82 Ga0068871_100000268 3300006358 Bacteria 35785
83 Ga0068871_100105106 3300006358 Unclassified 2369
84 Ga0068871_100111937 3300006358 Bacteria 2297
85 Ga0068871_100116588 3300006358 Bacteria 2252
86 Ga0068871_100465483 3300006358 Bacteria 1135
87 Ga0075428_100021428 3300006844 Bacteria 7153
88 Ga0075428_100056298 3300006844 Bacteria 4307
89 Ga0075431_100110040 3300006847 Bacteria 2843
90 Ga0075433_10028551 3300006852 Bacteria 4744
91 Ga0075433_10036668 3300006852 Bacteria 4226
92 Ga0075433_10177420 3300006852 Bacteria 1896
93 Ga0075434_100160829 3300006871 Bacteria 2265
94 Ga0075434_100411677 3300006871 Bacteria 1373
95 Ga0075434_100880220 3300006871 Bacteria 911
96 Ga0075429_100017657 3300006880 Bacteria 6170
97 Ga0068865_100034553 3300006881 Unclassified 3392
98 Ga0068865_100492522 3300006881 Bacteria 1020
99 Ga0075436_100662069 3300006914 Bacteria 772
100 Ga0097620_100295706 3300006931 Bacteria 1712
101 Ga0097620_100795028 3300006931 Bacteria 1034
102 Ga0097620_101505748 3300006931 Bacteria 743
103 Ga0075435_100005531 3300007076 Bacteria 8834
104 Ga0075435_100378527 3300007076 Bacteria 1216
105 Ga0099795_10197036 3300007788 Bacteria 848
106 Ga0105240_10344252 3300009093 Bacteria 1693
107 Ga0111539_10009026 3300009094 Bacteria 12619
108 Ga0105245_10852422 3300009098 Unclassified 951
109 Ga0105245_11604540 3300009098 Unclassified 702
110 Ga0105247_10192201 3300009101 Bacteria 1367
111 Ga0114129_10012455 3300009147 Bacteria 12109
112 Ga0114129_10034394 3300009147 Bacteria 7158
113 Ga0114129_10101456 3300009147 Bacteria 3981
114 Ga0114129_10102942 3300009147 Bacteria 3948
115 Ga0114129_10128011 3300009147 Bacteria 3490
116 Ga0114129_10135645 3300009147 Bacteria 3377
117 Ga0105243_11027496 3300009148 Bacteria 828
118 Ga0105242_10024730 3300009176 Bacteria 4745
119 Ga0105242_10848162 3300009176 Bacteria 909
120 Ga0105248_10039033 3300009177 Bacteria 5316
121 Ga0105248_10329741 3300009177 Bacteria 1719
122 Ga0105248_10348954 3300009177 Unclassified 1666
123 Ga0105248_10514431 3300009177 Bacteria 1350
124 Ga0105248_10654189 3300009177 Unclassified 1186
125 Ga0105248_10894707 3300009177 Bacteria 1002
126 Ga0105249_11807397 3300009553 Bacteria 684
127 Ga0163162_10862045 3300013306 Bacteria 1020
128 Ga0163162_11169686 3300013306 Bacteria 872
129 Ga0157375_10223071 3300013308 Bacteria 2044
130 Ga0157375_10472253 3300013308 Bacteria 1419
131 Ga0157375_11814180 3300013308 Bacteria 723
132 Ga0157380_10703128 3300014326 Bacteria 1016
133 Ga0157379_10006336 3300014968 Bacteria 10190
134 Ga0157376_10031147 3300014969 Bacteria 4267
135 Ga0157376_10589281 3300014969 Bacteria 1105
136 Ga0157376_10941152 3300014969 Bacteria 884
137 Ga0157376_11258291 3300014969 Bacteria 769
138 Ga0207697_10115594 3300025315 Bacteria 1152
139 Ga0207710_10009537 3300025900 Bacteria 4082
140 Ga0207710_10288317 3300025900 Bacteria 827
141 Ga0207688_10098767 3300025901 Bacteria 1684
142 Ga0207688_10297095 3300025901 Unclassified 987
143 Ga0207680_10175069 3300025903 Bacteria 1447
144 Ga0207699_10013570 3300025906 Bacteria 4175
145 Ga0207699_10333631 3300025906 Bacteria 1067
146 Ga0207645_10472309 3300025907 Unclassified 848
147 Ga0207707_10251454 3300025912 Bacteria 1535
148 Ga0207671_10212302 3300025914 Bacteria 1514
149 Ga0207660_10662486 3300025917 Bacteria 851
150 Ga0207662_10126100 3300025918 Bacteria 1610
151 Ga0207687_10060377 3300025927 Bacteria 2674
152 Ga0207687_10197447 3300025927 Bacteria 1570
153 Ga0207690_11128070 3300025932 Bacteria 654
154 Ga0207706_10144396 3300025933 Bacteria 2094
155 Ga0207686_10031122 3300025934 Unclassified 3166
156 Ga0207709_11423366 3300025935 Bacteria 574
157 Ga0207670_10058223 3300025936 Bacteria 2624
158 Ga0207669_10515419 3300025937 Bacteria 959
159 Ga0207669_10919511 3300025937 Bacteria 732
160 Ga0207704_10096852 3300025938 Bacteria 1955
161 Ga0207704_10099031 3300025938 Bacteria 1938
162 Ga0207704_10169819 3300025938 Bacteria 1563
163 Ga0207665_10585692 3300025939 Unclassified 870
164 Ga0207665_10777397 3300025939 Bacteria 756
165 Ga0207665_11244013 3300025939 Bacteria 594
166 Ga0207691_10010163 3300025940 Bacteria 9030
167 Ga0207711_10010953 3300025941 Bacteria 7535
168 Ga0207711_10018229 3300025941 Bacteria 5835
169 Ga0207711_10161730 3300025941 Bacteria 2027
170 Ga0207711_10291923 3300025941 Unclassified 1503
171 Ga0207711_10587985 3300025941 Bacteria 1038
172 Ga0207711_10796555 3300025941 Bacteria 880
173 Ga0207689_10772713 3300025942 Bacteria 811
174 Ga0207651_10057920 3300025960 Bacteria 2675
175 Ga0207658_10020576 3300025986 Bacteria 4569
176 Ga0207703_10009261 3300026035 Bacteria 7743
177 Ga0207703_10368954 3300026035 Unclassified 1325
178 Ga0207641_10021930 3300026088 Bacteria 5250
179 Ga0207641_10045599 3300026088 Bacteria 3692
180 Ga0207641_11130343 3300026088 Bacteria 782
181 Ga0207676_10028443 3300026095 Bacteria 4175
182 Ga0207675_100317396 3300026118 Bacteria 1521
183 Ga0207428_10063672 3300027907 Bacteria 2913
184 Ga0207428_10220321 3300027907 Bacteria 1422
185 Ga0268265_10200096 3300028380 Bacteria 1732
186 Ga0268265_10916869 3300028380 Bacteria 861
187 Ga0268264_10148083 3300028381 Bacteria 2101
188 Ga0268264_11199349 3300028381 Bacteria 768
189 Ga0265314_10033193 3300031711 Bacteria 3789
190 Ga0307412_10641447 3300031911 Bacteria 905
191 Ga0373938_0040316 3300034957 Bacteria 1036
192 Ga0373932_0059733 3300035112 Bacteria 1155
193 Ga0373956_0257192 3300035119 Bacteria 830
194 Ga0373960_0106325 3300035121 Bacteria 916
195 Ga0373962_0306430 3300035242 Bacteria 565
196 Ga0373931_0248328 3300035691 Bacteria 1081
197 Ga0373937_0144345 3300036401 Bacteria 2228
198 Ga0373937_0721937 3300036401 Bacteria 943
199 Ga0436365_1646641 3300039437 Unclassified 1362
200 Ga0466967_0510556 3300045976 Bacteria 1180
201 Ga0495629_0217112 3300046459 Bacteria 1320
202 Ga0495580_0212178 3300046472 Bacteria 1332
203 Ga0495580_0341931 3300046472 Bacteria 1015
204 Ga0495639_0172834 3300046475 Bacteria 1049
205 Ga0495630_0096183 3300046517 Bacteria 2239
206 Ga0495598_0002694 3300046537 Bacteria 3682
207 Ga0495659_0116483 3300046664 Bacteria 1048
208 Ga0495647_0067605 3300046681 Bacteria 1424
209 Ga0495669_0295831 3300046684 Bacteria 780
210 Ga0495624_0707614 3300046690 Unclassified 598
211 Ga0496101_0299337 3300048904 Bacteria 1260
212 Ga0496102_0152811 3300048905 Bacteria 2169
213 Ga0496104_0041694 3300048907 Bacteria 4305
214 Ga0496106_0076311 3300048909 Bacteria 2569
215 Ga0496108_0008240 3300048911 Bacteria 8458
216 Ga0496108_0218988 3300048911 Bacteria 1654
217 Ga0496109_0117863 3300048912 Bacteria 2472
218 Ga0496109_0212097 3300048912 Bacteria 1821
219 Ga0496112_0000346 3300048915 Bacteria 30207
220 Ga0496112_0105207 3300048915 Bacteria 2792
221 Ga0496113_0046881 3300048916 Bacteria 3210
222 Ga0496114_0038580 3300048917 Bacteria 3953
223 Ga0496114_0064195 3300048917 Unclassified 3075
224 Ga0496114_1624725 3300048917 Unclassified 534
225 Ga0501291_128524 3300049514 Bacteria 556
226 Ga0501076_0950785 3300049592 Bacteria 708
227 Ga0501081_0646364 3300049743 Bacteria 793
228 nmdc:mga00v17_69262_c1 3300050491 Bacteria 2183
229 nmdc:mga0k408_183784_c1 3300050493 Bacteria 1247
230 nmdc:mga07m45_239255_c1 3300050496 Bacteria 1056
231 nmdc:mga05p37_190332_c1 3300050507 Bacteria 2492
232 nmdc:mga05p37_2733_c1 3300050507 Bacteria 20505
233 nmdc:mga05p37_453896_c1 3300050507 Bacteria 1483
234 nmdc:mga05p37_45488_c1 3300050507 Bacteria 5398
235 nmdc:mga05p37_9449_c1 3300050507 Bacteria 11545
236 nmdc:mga05p37_982003_c1 3300050507 Bacteria 900
237 nmdc:mga09592_108770_c1 3300050508 Bacteria 2378
238 nmdc:mga09592_182768_c1 3300050508 Bacteria 1814
239 nmdc:mga08y16_12669_c1 3300050511 Bacteria 8870
240 nmdc:mga08y16_96659_c1 3300050511 Bacteria 3076
241 nmdc:mga0n895_22526_c1 3300050512 Bacteria 5909
242 nmdc:mga0n895_28604_c1 3300050512 Bacteria 5303
243 nmdc:mga0n895_538363_c1 3300050512 Bacteria 1174
244 nmdc:mga0n895_545794_c1 3300050512 Bacteria 1165
245 nmdc:mga0n895_56219_c1 3300050512 Bacteria 3876
246 nmdc:mga0rr50_3951_c1 3300050513 Bacteria 8624
247 nmdc:mga0rr50_545560_c1 3300050513 Bacteria 987
248 nmdc:mga0rr50_772881_c1 3300050513 Bacteria 820
249 nmdc:mga08x19_100151_c1 3300050514 Bacteria 1922
250 nmdc:mga0a205_115617_c1 3300050515 Bacteria 2581
251 nmdc:mga0a205_13264_c1 3300050515 Bacteria 7663
252 nmdc:mga0a205_23584_c1 3300050515 Bacteria 5836
253 nmdc:mga0a205_384614_c1 3300050515 Bacteria 1268
254 nmdc:mga0a205_48979_c1 3300050515 Bacteria 4078
255 nmdc:mga0a205_765584_c1 3300050515 Bacteria 814
256 nmdc:mga0a205_99809_c1 3300050515 Bacteria 2802
257 Ga0500566_0462275 3300053094 Bacteria 553
258 Ga0500658_0229935 3300053134 Bacteria 851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10641447 Ga0307412_106414471 145
2 3300006914 Ga0075436_100662069 Ga0075436_1006620692 148
3 3300031711 Ga0265314_10033193 Ga0265314_100331932 149
4 3300035119 Ga0373956_0257192 Ga0373956_0257192_206_712 149
5 3300036401 Ga0373937_0144345 Ga0373937_0144345_1534_2040 149
6 3300046459 Ga0495629_0217112 Ga0495629_0217112_396_902 149
7 3300046517 Ga0495630_0096183 Ga0495630_0096183_1570_2076 149
8 3300005338 Ga0068868_100016003 Ga0068868_1000160032 150
9 3300005367 Ga0070667_100502880 Ga0070667_1005028802 150
10 3300005434 Ga0070709_10227081 Ga0070709_102270812 150
11 3300005436 Ga0070713_101341992 Ga0070713_1013419921 150
12 3300005440 Ga0070705_100019049 Ga0070705_1000190494 150
13 3300005468 Ga0070707_100734462 Ga0070707_1007344622 150
14 3300005471 Ga0070698_100307881 Ga0070698_1003078812 150
15 3300005518 Ga0070699_100545210 Ga0070699_1005452101 150
16 3300005544 Ga0070686_100758065 Ga0070686_1007580651 150
17 3300005546 Ga0070696_100081492 Ga0070696_1000814923 150
18 3300005718 Ga0068866_10095940 Ga0068866_100959402 150
19 3300005719 Ga0068861_100587654 Ga0068861_1005876542 150
20 3300005843 Ga0068860_100058408 Ga0068860_1000584082 150
21 3300014326 Ga0157380_10703128 Ga0157380_107031282 150
22 3300025906 Ga0207699_10333631 Ga0207699_103336311 150
23 3300025935 Ga0207709_11423366 Ga0207709_114233661 150
24 3300025939 Ga0207665_10777397 Ga0207665_107773971 150
25 3300005295 Ga0065707_10172228 Ga0065707_101722282 152
26 3300005354 Ga0070675_101193378 Ga0070675_1011933781 152
27 3300005434 Ga0070709_10016431 Ga0070709_100164312 152
28 3300005436 Ga0070713_100088413 Ga0070713_1000884134 152
29 3300005440 Ga0070705_100158275 Ga0070705_1001582752 152
30 3300005458 Ga0070681_10137419 Ga0070681_101374193 152
31 3300005549 Ga0070704_100425589 Ga0070704_1004255892 152
32 3300005841 Ga0068863_100004492 Ga0068863_1000044926 152
33 3300005937 Ga0081455_10114921 Ga0081455_101149212 152
34 3300006358 Ga0068871_100116588 Ga0068871_1001165882 152
35 3300006844 Ga0075428_100021428 Ga0075428_1000214288 152
36 3300006847 Ga0075431_100110040 Ga0075431_1001100404 152
37 3300006852 Ga0075433_10028551 Ga0075433_100285512 152
38 3300006852 Ga0075433_10036668 Ga0075433_100366683 152
39 3300006871 Ga0075434_100880220 Ga0075434_1008802202 152
40 3300006880 Ga0075429_100017657 Ga0075429_1000176579 152
41 3300007076 Ga0075435_100378527 Ga0075435_1003785272 152
42 3300009094 Ga0111539_10009026 Ga0111539_100090266 152
43 3300025901 Ga0207688_10297095 Ga0207688_102970953 152
44 3300025906 Ga0207699_10013570 Ga0207699_100135706 152
45 3300025937 Ga0207669_10919511 Ga0207669_109195112 152
46 3300025939 Ga0207665_10585692 Ga0207665_105856922 152
47 3300026088 Ga0207641_10021930 Ga0207641_100219302 152
48 3300027907 Ga0207428_10063672 Ga0207428_100636722 152
49 3300035242 Ga0373962_0306430 Ga0373962_0306430_14_490 152
50 3300048917 Ga0496114_1624725 Ga0496114_1624725_51_512 152
51 3300049743 Ga0501081_0646364 Ga0501081_0646364_15_482 152
52 3300050511 nmdc:mga08y16_12669_c1 nmdc:mga08y16_12669_c1_6782_7246 152
53 3300050512 nmdc:mga0n895_538363_c1 nmdc:mga0n895_538363_c1_408_872 152
54 3300050512 nmdc:mga0n895_545794_c1 nmdc:mga0n895_545794_c1_335_802 152
55 3300050513 nmdc:mga0rr50_545560_c1 nmdc:mga0rr50_545560_c1_291_767 152
56 3300050515 nmdc:mga0a205_765584_c1 nmdc:mga0a205_765584_c1_207_683 152
57 3300005843 Ga0068860_101056929 Ga0068860_1010569291 153
58 3300049592 Ga0501076_0950785 Ga0501076_0950785_197_694 153
59 3300005444 Ga0070694_100003652 Ga0070694_1000036522 160
60 3300005545 Ga0070695_100013654 Ga0070695_1000136544 160
61 3300005546 Ga0070696_100034335 Ga0070696_1000343354 160
62 3300005549 Ga0070704_100051968 Ga0070704_1000519684 160
63 3300006058 Ga0075432_10065282 Ga0075432_100652821 160
64 3300007076 Ga0075435_100005531 Ga0075435_1000055313 160
65 3300009147 Ga0114129_10101456 Ga0114129_101014563 160
66 3300027907 Ga0207428_10220321 Ga0207428_102203211 160
67 3300050507 nmdc:mga05p37_982003_c1 nmdc:mga05p37_982003_c1_331_816 160
68 3300050512 nmdc:mga0n895_22526_c1 nmdc:mga0n895_22526_c1_1865_2350 160
69 3300050513 nmdc:mga0rr50_3951_c1 nmdc:mga0rr50_3951_c1_4868_5353 160
70 3300050515 nmdc:mga0a205_99809_c1 nmdc:mga0a205_99809_c1_73_558 160
71 3300005467 Ga0070706_101093054 Ga0070706_1010930541 161
72 3300005985 Ga0081539_10007146 Ga0081539_100071466 161
73 3300050507 nmdc:mga05p37_453896_c1 nmdc:mga05p37_453896_c1_203_688 161
74 3300005331 Ga0070670_100211667 Ga0070670_1002116672 162
75 3300005336 Ga0070680_100226937 Ga0070680_1002269372 162
76 3300005364 Ga0070673_100864767 Ga0070673_1008647672 162
77 3300005366 Ga0070659_101169893 Ga0070659_1011698931 162
78 3300005458 Ga0070681_10033755 Ga0070681_100337552 162
79 3300005530 Ga0070679_100082745 Ga0070679_1000827454 162
80 3300005544 Ga0070686_100651728 Ga0070686_1006517282 162
81 3300005548 Ga0070665_100084939 Ga0070665_1000849392 162
82 3300005842 Ga0068858_100171626 Ga0068858_1001716262 162
83 3300006237 Ga0097621_100206553 Ga0097621_1002065532 162
84 3300006358 Ga0068871_100105106 Ga0068871_1001051062 162
85 3300006881 Ga0068865_100034553 Ga0068865_1000345531 162
86 3300009098 Ga0105245_10852422 Ga0105245_108524222 162
87 3300009098 Ga0105245_11604540 Ga0105245_116045401 162
88 3300009148 Ga0105243_11027496 Ga0105243_110274962 162
89 3300009176 Ga0105242_10024730 Ga0105242_100247302 162
90 3300009177 Ga0105248_10039033 Ga0105248_100390332 162
91 3300009177 Ga0105248_10514431 Ga0105248_105144312 162
92 3300013306 Ga0163162_10862045 Ga0163162_108620452 162
93 3300013308 Ga0157375_10472253 Ga0157375_104722532 162
94 3300013308 Ga0157375_11814180 Ga0157375_118141801 162
95 3300014969 Ga0157376_10589281 Ga0157376_105892812 162
96 3300014969 Ga0157376_10941152 Ga0157376_109411522 162
97 3300025912 Ga0207707_10251454 Ga0207707_102514542 162
98 3300025917 Ga0207660_10662486 Ga0207660_106624861 162
99 3300025927 Ga0207687_10197447 Ga0207687_101974472 162
100 3300025932 Ga0207690_11128070 Ga0207690_111280702 162
101 3300025934 Ga0207686_10031122 Ga0207686_100311223 162
102 3300025937 Ga0207669_10515419 Ga0207669_105154192 162
103 3300025938 Ga0207704_10096852 Ga0207704_100968522 162
104 3300025938 Ga0207704_10099031 Ga0207704_100990312 162
105 3300025941 Ga0207711_10018229 Ga0207711_100182295 162
106 3300026035 Ga0207703_10368954 Ga0207703_103689542 162
107 3300026088 Ga0207641_11130343 Ga0207641_111303432 162
108 3300046681 Ga0495647_0067605 Ga0495647_0067605_342_830 162
109 3300046690 Ga0495624_0707614 Ga0495624_0707614_90_578 162
110 3300048905 Ga0496102_0152811 Ga0496102_0152811_1119_1607 162
111 3300048909 Ga0496106_0076311 Ga0496106_0076311_918_1406 162
112 3300048911 Ga0496108_0218988 Ga0496108_0218988_74_562 162
113 3300048912 Ga0496109_0117863 Ga0496109_0117863_1504_1992 162
114 3300048915 Ga0496112_0105207 Ga0496112_0105207_1241_1729 162
115 3300048917 Ga0496114_0064195 Ga0496114_0064195_307_795 162
116 3300050496 nmdc:mga07m45_239255_c1 nmdc:mga07m45_239255_c1_502_990 162
117 3300053094 Ga0500566_0462275 Ga0500566_0462275_36_524 162
118 3300053134 Ga0500658_0229935 Ga0500658_0229935_337_825 162
119 3300005331 Ga0070670_100623366 Ga0070670_1006233662 163
120 3300005331 Ga0070670_100694837 Ga0070670_1006948372 163
121 3300005354 Ga0070675_100632812 Ga0070675_1006328121 163
122 3300005445 Ga0070708_100044930 Ga0070708_1000449303 163
123 3300005617 Ga0068859_101505912 Ga0068859_1015059121 163
124 3300005719 Ga0068861_100296397 Ga0068861_1002963972 163
125 3300005843 Ga0068860_101194079 Ga0068860_1011940792 163
126 3300006931 Ga0097620_101505748 Ga0097620_1015057481 163
127 3300025900 Ga0207710_10009537 Ga0207710_100095373 163
128 3300025939 Ga0207665_11244013 Ga0207665_112440131 163
129 3300025941 Ga0207711_10010953 Ga0207711_100109535 163
130 3300025942 Ga0207689_10772713 Ga0207689_107727132 163
131 3300026035 Ga0207703_10009261 Ga0207703_100092617 163
132 3300026088 Ga0207641_10045599 Ga0207641_100455993 163
133 3300026095 Ga0207676_10028443 Ga0207676_100284433 163
134 3300026118 Ga0207675_100317396 Ga0207675_1003173962 163
135 3300028381 Ga0268264_11199349 Ga0268264_111993492 163
136 3300048907 Ga0496104_0041694 Ga0496104_0041694_2431_2922 163
137 3300048911 Ga0496108_0008240 Ga0496108_0008240_7398_7889 163
138 3300048915 Ga0496112_0000346 Ga0496112_0000346_18960_19451 163
139 3300048916 Ga0496113_0046881 Ga0496113_0046881_317_808 163
140 3300048917 Ga0496114_0038580 Ga0496114_0038580_2374_2865 163
141 3300005347 Ga0070668_100365913 Ga0070668_1003659131 164
142 3300005471 Ga0070698_100099386 Ga0070698_1000993862 164
143 3300005471 Ga0070698_100117016 Ga0070698_1001170162 164
144 3300005518 Ga0070699_100018755 Ga0070699_1000187552 164
145 3300005617 Ga0068859_100794957 Ga0068859_1007949572 164
146 3300006871 Ga0075434_100411677 Ga0075434_1004116773 164
147 3300006931 Ga0097620_100795028 Ga0097620_1007950282 164
148 3300009147 Ga0114129_10034394 Ga0114129_100343946 164
149 3300009176 Ga0105242_10848162 Ga0105242_108481621 164
150 3300009177 Ga0105248_10348954 Ga0105248_103489543 164
151 3300009177 Ga0105248_10654189 Ga0105248_106541891 164
152 3300009177 Ga0105248_10894707 Ga0105248_108947072 164
153 3300025907 Ga0207645_10472309 Ga0207645_104723092 164
154 3300025941 Ga0207711_10291923 Ga0207711_102919232 164
155 3300025941 Ga0207711_10796555 Ga0207711_107965551 164
156 3300028380 Ga0268265_10916869 Ga0268265_109168691 164
157 3300039437 Ga0436365_1646641 Ga0436365_1646641_672_1172 164
158 3300045976 Ga0466967_0510556 Ga0466967_0510556_561_1055 164
159 3300050507 nmdc:mga05p37_2733_c1 nmdc:mga05p37_2733_c1_6091_6594 164
160 3300050512 nmdc:mga0n895_28604_c1 nmdc:mga0n895_28604_c1_1158_1652 164
161 3300050514 nmdc:mga08x19_100151_c1 nmdc:mga08x19_100151_c1_368_862 164
162 3300050515 nmdc:mga0a205_115617_c1 nmdc:mga0a205_115617_c1_328_831 164
163 3300049514 Ga0501291_128524 Ga0501291_128524_22_525 165
164 3300005295 Ga0065707_10059479 Ga0065707_100594791 166
165 3300005335 Ga0070666_10163769 Ga0070666_101637692 166
166 3300005340 Ga0070689_100046429 Ga0070689_1000464293 166
167 3300005340 Ga0070689_100469369 Ga0070689_1004693692 166
168 3300005343 Ga0070687_100171682 Ga0070687_1001716822 166
169 3300005353 Ga0070669_100180548 Ga0070669_1001805482 166
170 3300005355 Ga0070671_100008670 Ga0070671_1000086701 166
171 3300005364 Ga0070673_100085137 Ga0070673_1000851372 166
172 3300005365 Ga0070688_100429520 Ga0070688_1004295202 166
173 3300005367 Ga0070667_100025944 Ga0070667_1000259443 166
174 3300005436 Ga0070713_100153260 Ga0070713_1001532602 166
175 3300005438 Ga0070701_10209242 Ga0070701_102092422 166
176 3300005445 Ga0070708_100018010 Ga0070708_1000180102 166
177 3300005466 Ga0070685_10282475 Ga0070685_102824751 166
178 3300005518 Ga0070699_100509278 Ga0070699_1005092782 166
179 3300005543 Ga0070672_100008648 Ga0070672_1000086486 166
180 3300005617 Ga0068859_100295685 Ga0068859_1002956851 166
181 3300005718 Ga0068866_10209308 Ga0068866_102093082 166
182 3300005842 Ga0068858_101100802 Ga0068858_1011008022 166
183 3300005843 Ga0068860_100350189 Ga0068860_1003501892 166
184 3300005844 Ga0068862_100004877 Ga0068862_1000048776 166
185 3300005937 Ga0081455_10087453 Ga0081455_100874533 166
186 3300006175 Ga0070712_100314412 Ga0070712_1003144122 166
187 3300006237 Ga0097621_100003790 Ga0097621_10000379013 166
188 3300006358 Ga0068871_100000268 Ga0068871_10000026813 166
189 3300006358 Ga0068871_100111937 Ga0068871_1001119372 166
190 3300006844 Ga0075428_100056298 Ga0075428_1000562983 166
191 3300006852 Ga0075433_10177420 Ga0075433_101774202 166
192 3300006871 Ga0075434_100160829 Ga0075434_1001608292 166
193 3300006881 Ga0068865_100492522 Ga0068865_1004925222 166
194 3300006931 Ga0097620_100295706 Ga0097620_1002957063 166
195 3300007788 Ga0099795_10197036 Ga0099795_101970362 166
196 3300009093 Ga0105240_10344252 Ga0105240_103442522 166
197 3300009101 Ga0105247_10192201 Ga0105247_101922012 166
198 3300009147 Ga0114129_10012455 Ga0114129_100124555 166
199 3300009147 Ga0114129_10102942 Ga0114129_101029424 166
200 3300009147 Ga0114129_10128011 Ga0114129_101280112 166
201 3300009147 Ga0114129_10135645 Ga0114129_101356453 166
202 3300009177 Ga0105248_10329741 Ga0105248_103297412 166
203 3300009553 Ga0105249_11807397 Ga0105249_118073971 166
204 3300013306 Ga0163162_11169686 Ga0163162_111696861 166
205 3300013308 Ga0157375_10223071 Ga0157375_102230713 166
206 3300014968 Ga0157379_10006336 Ga0157379_1000633610 166
207 3300014969 Ga0157376_11258291 Ga0157376_112582911 166
208 3300025315 Ga0207697_10115594 Ga0207697_101155941 166
209 3300025900 Ga0207710_10288317 Ga0207710_102883172 166
210 3300025901 Ga0207688_10098767 Ga0207688_100987672 166
211 3300025903 Ga0207680_10175069 Ga0207680_101750692 166
212 3300025914 Ga0207671_10212302 Ga0207671_102123022 166
213 3300025918 Ga0207662_10126100 Ga0207662_101261003 166
214 3300025927 Ga0207687_10060377 Ga0207687_100603772 166
215 3300025933 Ga0207706_10144396 Ga0207706_101443962 166
216 3300025936 Ga0207670_10058223 Ga0207670_100582233 166
217 3300025938 Ga0207704_10169819 Ga0207704_101698192 166
218 3300025940 Ga0207691_10010163 Ga0207691_100101638 166
219 3300025941 Ga0207711_10161730 Ga0207711_101617302 166
220 3300025941 Ga0207711_10587985 Ga0207711_105879851 166
221 3300025960 Ga0207651_10057920 Ga0207651_100579202 166
222 3300025986 Ga0207658_10020576 Ga0207658_100205763 166
223 3300028380 Ga0268265_10200096 Ga0268265_102000962 166
224 3300028381 Ga0268264_10148083 Ga0268264_101480832 166
225 3300034957 Ga0373938_0040316 Ga0373938_0040316_433_951 166
226 3300035112 Ga0373932_0059733 Ga0373932_0059733_27_554 166
227 3300035121 Ga0373960_0106325 Ga0373960_0106325_198_716 166
228 3300035691 Ga0373931_0248328 Ga0373931_0248328_268_795 166
229 3300036401 Ga0373937_0721937 Ga0373937_0721937_276_803 166
230 3300046472 Ga0495580_0341931 Ga0495580_0341931_11_529 166
231 3300046664 Ga0495659_0116483 Ga0495659_0116483_78_593 166
232 3300046684 Ga0495669_0295831 Ga0495669_0295831_21_539 166
233 3300048904 Ga0496101_0299337 Ga0496101_0299337_164_682 166
234 3300048912 Ga0496109_0212097 Ga0496109_0212097_1128_1646 166
235 3300050507 nmdc:mga05p37_190332_c1 nmdc:mga05p37_190332_c1_1180_1695 166
236 3300050507 nmdc:mga05p37_45488_c1 nmdc:mga05p37_45488_c1_3911_4429 166
237 3300050507 nmdc:mga05p37_9449_c1 nmdc:mga05p37_9449_c1_7813_8319 166
238 3300050508 nmdc:mga09592_182768_c1 nmdc:mga09592_182768_c1_936_1454 166
239 3300050511 nmdc:mga08y16_96659_c1 nmdc:mga08y16_96659_c1_2417_2935 166
240 3300050512 nmdc:mga0n895_56219_c1 nmdc:mga0n895_56219_c1_254_772 166
241 3300050513 nmdc:mga0rr50_772881_c1 nmdc:mga0rr50_772881_c1_58_576 166
242 3300050515 nmdc:mga0a205_13264_c1 nmdc:mga0a205_13264_c1_5970_6488 166
243 3300050515 nmdc:mga0a205_23584_c1 nmdc:mga0a205_23584_c1_4842_5357 166
244 3300050515 nmdc:mga0a205_384614_c1 nmdc:mga0a205_384614_c1_34_552 166
245 3300050515 nmdc:mga0a205_48979_c1 nmdc:mga0a205_48979_c1_1296_1802 166
246 3300006178 Ga0075367_10067912 Ga0075367_100679122 167
247 3300006195 Ga0075366_10037241 Ga0075366_100372412 167
248 3300050491 nmdc:mga00v17_69262_c1 nmdc:mga00v17_69262_c1_643_1287 167
249 3300050493 nmdc:mga0k408_183784_c1 nmdc:mga0k408_183784_c1_213_737 167
250 3300006358 Ga0068871_100465483 Ga0068871_1004654832 170
251 3300014969 Ga0157376_10031147 Ga0157376_100311474 170
252 3300046472 Ga0495580_0212178 Ga0495580_0212178_80_607 170
253 3300046475 Ga0495639_0172834 Ga0495639_0172834_384_911 170
254 3300005289 Ga0065704_10120900 Ga0065704_101209002 171
255 3300005355 Ga0070671_100144692 Ga0070671_1001446922 171
256 3300005841 Ga0068863_100472284 Ga0068863_1004722842 171
257 3300046537 Ga0495598_0002694 Ga0495598_0002694_1340_1864 171
258 3300050508 nmdc:mga09592_108770_c1 nmdc:mga09592_108770_c1_1849_2364 171

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bdd-assembly1.cif.gz_A crystal structure of fe(ii) unliganded h-nox protein from k. algicida 0.3487 95 161
3nav-assembly1.cif.gz_B crystal structure of an alpha subunit of tryptophan synthase from vibrio cholerae o1 biovar el tor str. n16961 0.3284 95 157
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.2699 13 171
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.2588 13 171
7a0g-assembly1.cif.gz_GGG structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.2519 23 149
ID Description Score Start End Superfamily
af_Q8INF0_1_188_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.4147 85 164 3.90.1520.10
af_A0A2R8Q077_776_1057_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3161 61 158 1.25.10.10
af_K7KEV4_655_834_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2938 56 171 1.25.40.10
af_A0A1D6L3Q1_393_597_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2679 66 160 1.25.40.10
af_O88575_48_624_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.266 61 165 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A521TC89-F1-model_v4 Uncharacterized protein 0.9571 8 166
AF-A0A1F2U2G6-F1-model_v4 Uncharacterized protein 0.948 19 166
AF-A0A2W4RWJ5-F1-model_v4 Uncharacterized protein 0.9474 19 167
AF-A0A2V7UHB1-F1-model_v4 Uncharacterized protein 0.9385 55 163
AF-A0A2V8GAG0-F1-model_v4 Uncharacterized protein 0.9242 11 170

Feature Viewer

pLDDT pTM Quality
89.49 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map