F367805
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 149 | 258 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10059479|Ga0065707_100594791 |
| Length | 187 |
| Sequence | VALHVSRFMSVEYQLMTETTLTPSRLWKRMSSDQRQRAALAFWADPEATDDQVQAAFLIAQQKKFRPKTVIGLDLDRKAKHLATVAGVPDQIAARALVTYHLAEQRPMMGAFLDALGIAHENGLIQEENVKPDTARMKGAVEKISAEFPAEDVQIYLNTLLCQDPETWGGLEETVKTFEESGLGARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 109 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 136 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 149 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 91.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10120900 | 3300005289 | Bacteria | 1775 |
| 2 | Ga0065707_10059479 | 3300005295 | Bacteria | 697 |
| 3 | Ga0065707_10172228 | 3300005295 | Bacteria | 1476 |
| 4 | Ga0070670_100211667 | 3300005331 | Unclassified | 1686 |
| 5 | Ga0070670_100623366 | 3300005331 | Bacteria | 966 |
| 6 | Ga0070670_100694837 | 3300005331 | Bacteria | 914 |
| 7 | Ga0070666_10163769 | 3300005335 | Bacteria | 1555 |
| 8 | Ga0070680_100226937 | 3300005336 | Bacteria | 1577 |
| 9 | Ga0068868_100016003 | 3300005338 | Bacteria | 5562 |
| 10 | Ga0070689_100046429 | 3300005340 | Bacteria | 3347 |
| 11 | Ga0070689_100469369 | 3300005340 | Bacteria | 1073 |
| 12 | Ga0070687_100171682 | 3300005343 | Bacteria | 1291 |
| 13 | Ga0070668_100365913 | 3300005347 | Bacteria | 1224 |
| 14 | Ga0070669_100180548 | 3300005353 | Bacteria | 1651 |
| 15 | Ga0070675_100632812 | 3300005354 | Bacteria | 972 |
| 16 | Ga0070675_101193378 | 3300005354 | Bacteria | 701 |
| 17 | Ga0070671_100008670 | 3300005355 | Bacteria | 8157 |
| 18 | Ga0070671_100144692 | 3300005355 | Bacteria | 2006 |
| 19 | Ga0070673_100085137 | 3300005364 | Bacteria | 2573 |
| 20 | Ga0070673_100864767 | 3300005364 | Unclassified | 837 |
| 21 | Ga0070688_100429520 | 3300005365 | Bacteria | 983 |
| 22 | Ga0070659_101169893 | 3300005366 | Bacteria | 679 |
| 23 | Ga0070667_100025944 | 3300005367 | Bacteria | 4874 |
| 24 | Ga0070667_100502880 | 3300005367 | Bacteria | 1111 |
| 25 | Ga0070709_10016431 | 3300005434 | Bacteria | 4225 |
| 26 | Ga0070709_10227081 | 3300005434 | Bacteria | 1334 |
| 27 | Ga0070713_100088413 | 3300005436 | Bacteria | 2659 |
| 28 | Ga0070713_100153260 | 3300005436 | Bacteria | 2052 |
| 29 | Ga0070713_101341992 | 3300005436 | Unclassified | 693 |
| 30 | Ga0070701_10209242 | 3300005438 | Bacteria | 1157 |
| 31 | Ga0070705_100019049 | 3300005440 | Bacteria | 3607 |
| 32 | Ga0070705_100158275 | 3300005440 | Unclassified | 1511 |
| 33 | Ga0070694_100003652 | 3300005444 | Bacteria | 9181 |
| 34 | Ga0070708_100018010 | 3300005445 | Bacteria | 5906 |
| 35 | Ga0070708_100044930 | 3300005445 | Bacteria | 3889 |
| 36 | Ga0070681_10033755 | 3300005458 | Bacteria | 5137 |
| 37 | Ga0070681_10137419 | 3300005458 | Bacteria | 2374 |
| 38 | Ga0070685_10282475 | 3300005466 | Bacteria | 1112 |
| 39 | Ga0070706_101093054 | 3300005467 | Bacteria | 734 |
| 40 | Ga0070707_100734462 | 3300005468 | Unclassified | 950 |
| 41 | Ga0070698_100099386 | 3300005471 | Bacteria | 2883 |
| 42 | Ga0070698_100117016 | 3300005471 | Bacteria | 2628 |
| 43 | Ga0070698_100307881 | 3300005471 | Bacteria | 1515 |
| 44 | Ga0070699_100018755 | 3300005518 | Bacteria | 5942 |
| 45 | Ga0070699_100509278 | 3300005518 | Bacteria | 1094 |
| 46 | Ga0070699_100545210 | 3300005518 | Bacteria | 1055 |
| 47 | Ga0070679_100082745 | 3300005530 | Bacteria | 3199 |
| 48 | Ga0070672_100008648 | 3300005543 | Bacteria | 6977 |
| 49 | Ga0070686_100651728 | 3300005544 | Bacteria | 835 |
| 50 | Ga0070686_100758065 | 3300005544 | Bacteria | 779 |
| 51 | Ga0070695_100013654 | 3300005545 | Bacteria | 4882 |
| 52 | Ga0070696_100034335 | 3300005546 | Bacteria | 3489 |
| 53 | Ga0070696_100081492 | 3300005546 | Bacteria | 2293 |
| 54 | Ga0070665_100084939 | 3300005548 | Unclassified | 3170 |
| 55 | Ga0070704_100051968 | 3300005549 | Bacteria | 2889 |
| 56 | Ga0070704_100425589 | 3300005549 | Unclassified | 1138 |
| 57 | Ga0068859_100295685 | 3300005617 | Bacteria | 1712 |
| 58 | Ga0068859_100794957 | 3300005617 | Bacteria | 1034 |
| 59 | Ga0068859_101505912 | 3300005617 | Bacteria | 743 |
| 60 | Ga0068866_10095940 | 3300005718 | Bacteria | 1625 |
| 61 | Ga0068866_10209308 | 3300005718 | Bacteria | 1170 |
| 62 | Ga0068861_100296397 | 3300005719 | Bacteria | 1399 |
| 63 | Ga0068861_100587654 | 3300005719 | Bacteria | 1020 |
| 64 | Ga0068863_100004492 | 3300005841 | Bacteria | 13762 |
| 65 | Ga0068863_100472284 | 3300005841 | Bacteria | 1233 |
| 66 | Ga0068858_100171626 | 3300005842 | Unclassified | 2045 |
| 67 | Ga0068858_101100802 | 3300005842 | Bacteria | 780 |
| 68 | Ga0068860_100058408 | 3300005843 | Unclassified | 3667 |
| 69 | Ga0068860_100350189 | 3300005843 | Bacteria | 1453 |
| 70 | Ga0068860_101056929 | 3300005843 | Unclassified | 831 |
| 71 | Ga0068860_101194079 | 3300005843 | Bacteria | 781 |
| 72 | Ga0068862_100004877 | 3300005844 | Bacteria | 11296 |
| 73 | Ga0081455_10087453 | 3300005937 | Bacteria | 2535 |
| 74 | Ga0081455_10114921 | 3300005937 | Bacteria | 2131 |
| 75 | Ga0081539_10007146 | 3300005985 | Bacteria | 10302 |
| 76 | Ga0075432_10065282 | 3300006058 | Bacteria | 1301 |
| 77 | Ga0070712_100314412 | 3300006175 | Unclassified | 1272 |
| 78 | Ga0075367_10067912 | 3300006178 | Bacteria | 2138 |
| 79 | Ga0075366_10037241 | 3300006195 | Bacteria | 2871 |
| 80 | Ga0097621_100003790 | 3300006237 | Bacteria | 10468 |
| 81 | Ga0097621_100206553 | 3300006237 | Bacteria | 1707 |
| 82 | Ga0068871_100000268 | 3300006358 | Bacteria | 35785 |
| 83 | Ga0068871_100105106 | 3300006358 | Unclassified | 2369 |
| 84 | Ga0068871_100111937 | 3300006358 | Bacteria | 2297 |
| 85 | Ga0068871_100116588 | 3300006358 | Bacteria | 2252 |
| 86 | Ga0068871_100465483 | 3300006358 | Bacteria | 1135 |
| 87 | Ga0075428_100021428 | 3300006844 | Bacteria | 7153 |
| 88 | Ga0075428_100056298 | 3300006844 | Bacteria | 4307 |
| 89 | Ga0075431_100110040 | 3300006847 | Bacteria | 2843 |
| 90 | Ga0075433_10028551 | 3300006852 | Bacteria | 4744 |
| 91 | Ga0075433_10036668 | 3300006852 | Bacteria | 4226 |
| 92 | Ga0075433_10177420 | 3300006852 | Bacteria | 1896 |
| 93 | Ga0075434_100160829 | 3300006871 | Bacteria | 2265 |
| 94 | Ga0075434_100411677 | 3300006871 | Bacteria | 1373 |
| 95 | Ga0075434_100880220 | 3300006871 | Bacteria | 911 |
| 96 | Ga0075429_100017657 | 3300006880 | Bacteria | 6170 |
| 97 | Ga0068865_100034553 | 3300006881 | Unclassified | 3392 |
| 98 | Ga0068865_100492522 | 3300006881 | Bacteria | 1020 |
| 99 | Ga0075436_100662069 | 3300006914 | Bacteria | 772 |
| 100 | Ga0097620_100295706 | 3300006931 | Bacteria | 1712 |
| 101 | Ga0097620_100795028 | 3300006931 | Bacteria | 1034 |
| 102 | Ga0097620_101505748 | 3300006931 | Bacteria | 743 |
| 103 | Ga0075435_100005531 | 3300007076 | Bacteria | 8834 |
| 104 | Ga0075435_100378527 | 3300007076 | Bacteria | 1216 |
| 105 | Ga0099795_10197036 | 3300007788 | Bacteria | 848 |
| 106 | Ga0105240_10344252 | 3300009093 | Bacteria | 1693 |
| 107 | Ga0111539_10009026 | 3300009094 | Bacteria | 12619 |
| 108 | Ga0105245_10852422 | 3300009098 | Unclassified | 951 |
| 109 | Ga0105245_11604540 | 3300009098 | Unclassified | 702 |
| 110 | Ga0105247_10192201 | 3300009101 | Bacteria | 1367 |
| 111 | Ga0114129_10012455 | 3300009147 | Bacteria | 12109 |
| 112 | Ga0114129_10034394 | 3300009147 | Bacteria | 7158 |
| 113 | Ga0114129_10101456 | 3300009147 | Bacteria | 3981 |
| 114 | Ga0114129_10102942 | 3300009147 | Bacteria | 3948 |
| 115 | Ga0114129_10128011 | 3300009147 | Bacteria | 3490 |
| 116 | Ga0114129_10135645 | 3300009147 | Bacteria | 3377 |
| 117 | Ga0105243_11027496 | 3300009148 | Bacteria | 828 |
| 118 | Ga0105242_10024730 | 3300009176 | Bacteria | 4745 |
| 119 | Ga0105242_10848162 | 3300009176 | Bacteria | 909 |
| 120 | Ga0105248_10039033 | 3300009177 | Bacteria | 5316 |
| 121 | Ga0105248_10329741 | 3300009177 | Bacteria | 1719 |
| 122 | Ga0105248_10348954 | 3300009177 | Unclassified | 1666 |
| 123 | Ga0105248_10514431 | 3300009177 | Bacteria | 1350 |
| 124 | Ga0105248_10654189 | 3300009177 | Unclassified | 1186 |
| 125 | Ga0105248_10894707 | 3300009177 | Bacteria | 1002 |
| 126 | Ga0105249_11807397 | 3300009553 | Bacteria | 684 |
| 127 | Ga0163162_10862045 | 3300013306 | Bacteria | 1020 |
| 128 | Ga0163162_11169686 | 3300013306 | Bacteria | 872 |
| 129 | Ga0157375_10223071 | 3300013308 | Bacteria | 2044 |
| 130 | Ga0157375_10472253 | 3300013308 | Bacteria | 1419 |
| 131 | Ga0157375_11814180 | 3300013308 | Bacteria | 723 |
| 132 | Ga0157380_10703128 | 3300014326 | Bacteria | 1016 |
| 133 | Ga0157379_10006336 | 3300014968 | Bacteria | 10190 |
| 134 | Ga0157376_10031147 | 3300014969 | Bacteria | 4267 |
| 135 | Ga0157376_10589281 | 3300014969 | Bacteria | 1105 |
| 136 | Ga0157376_10941152 | 3300014969 | Bacteria | 884 |
| 137 | Ga0157376_11258291 | 3300014969 | Bacteria | 769 |
| 138 | Ga0207697_10115594 | 3300025315 | Bacteria | 1152 |
| 139 | Ga0207710_10009537 | 3300025900 | Bacteria | 4082 |
| 140 | Ga0207710_10288317 | 3300025900 | Bacteria | 827 |
| 141 | Ga0207688_10098767 | 3300025901 | Bacteria | 1684 |
| 142 | Ga0207688_10297095 | 3300025901 | Unclassified | 987 |
| 143 | Ga0207680_10175069 | 3300025903 | Bacteria | 1447 |
| 144 | Ga0207699_10013570 | 3300025906 | Bacteria | 4175 |
| 145 | Ga0207699_10333631 | 3300025906 | Bacteria | 1067 |
| 146 | Ga0207645_10472309 | 3300025907 | Unclassified | 848 |
| 147 | Ga0207707_10251454 | 3300025912 | Bacteria | 1535 |
| 148 | Ga0207671_10212302 | 3300025914 | Bacteria | 1514 |
| 149 | Ga0207660_10662486 | 3300025917 | Bacteria | 851 |
| 150 | Ga0207662_10126100 | 3300025918 | Bacteria | 1610 |
| 151 | Ga0207687_10060377 | 3300025927 | Bacteria | 2674 |
| 152 | Ga0207687_10197447 | 3300025927 | Bacteria | 1570 |
| 153 | Ga0207690_11128070 | 3300025932 | Bacteria | 654 |
| 154 | Ga0207706_10144396 | 3300025933 | Bacteria | 2094 |
| 155 | Ga0207686_10031122 | 3300025934 | Unclassified | 3166 |
| 156 | Ga0207709_11423366 | 3300025935 | Bacteria | 574 |
| 157 | Ga0207670_10058223 | 3300025936 | Bacteria | 2624 |
| 158 | Ga0207669_10515419 | 3300025937 | Bacteria | 959 |
| 159 | Ga0207669_10919511 | 3300025937 | Bacteria | 732 |
| 160 | Ga0207704_10096852 | 3300025938 | Bacteria | 1955 |
| 161 | Ga0207704_10099031 | 3300025938 | Bacteria | 1938 |
| 162 | Ga0207704_10169819 | 3300025938 | Bacteria | 1563 |
| 163 | Ga0207665_10585692 | 3300025939 | Unclassified | 870 |
| 164 | Ga0207665_10777397 | 3300025939 | Bacteria | 756 |
| 165 | Ga0207665_11244013 | 3300025939 | Bacteria | 594 |
| 166 | Ga0207691_10010163 | 3300025940 | Bacteria | 9030 |
| 167 | Ga0207711_10010953 | 3300025941 | Bacteria | 7535 |
| 168 | Ga0207711_10018229 | 3300025941 | Bacteria | 5835 |
| 169 | Ga0207711_10161730 | 3300025941 | Bacteria | 2027 |
| 170 | Ga0207711_10291923 | 3300025941 | Unclassified | 1503 |
| 171 | Ga0207711_10587985 | 3300025941 | Bacteria | 1038 |
| 172 | Ga0207711_10796555 | 3300025941 | Bacteria | 880 |
| 173 | Ga0207689_10772713 | 3300025942 | Bacteria | 811 |
| 174 | Ga0207651_10057920 | 3300025960 | Bacteria | 2675 |
| 175 | Ga0207658_10020576 | 3300025986 | Bacteria | 4569 |
| 176 | Ga0207703_10009261 | 3300026035 | Bacteria | 7743 |
| 177 | Ga0207703_10368954 | 3300026035 | Unclassified | 1325 |
| 178 | Ga0207641_10021930 | 3300026088 | Bacteria | 5250 |
| 179 | Ga0207641_10045599 | 3300026088 | Bacteria | 3692 |
| 180 | Ga0207641_11130343 | 3300026088 | Bacteria | 782 |
| 181 | Ga0207676_10028443 | 3300026095 | Bacteria | 4175 |
| 182 | Ga0207675_100317396 | 3300026118 | Bacteria | 1521 |
| 183 | Ga0207428_10063672 | 3300027907 | Bacteria | 2913 |
| 184 | Ga0207428_10220321 | 3300027907 | Bacteria | 1422 |
| 185 | Ga0268265_10200096 | 3300028380 | Bacteria | 1732 |
| 186 | Ga0268265_10916869 | 3300028380 | Bacteria | 861 |
| 187 | Ga0268264_10148083 | 3300028381 | Bacteria | 2101 |
| 188 | Ga0268264_11199349 | 3300028381 | Bacteria | 768 |
| 189 | Ga0265314_10033193 | 3300031711 | Bacteria | 3789 |
| 190 | Ga0307412_10641447 | 3300031911 | Bacteria | 905 |
| 191 | Ga0373938_0040316 | 3300034957 | Bacteria | 1036 |
| 192 | Ga0373932_0059733 | 3300035112 | Bacteria | 1155 |
| 193 | Ga0373956_0257192 | 3300035119 | Bacteria | 830 |
| 194 | Ga0373960_0106325 | 3300035121 | Bacteria | 916 |
| 195 | Ga0373962_0306430 | 3300035242 | Bacteria | 565 |
| 196 | Ga0373931_0248328 | 3300035691 | Bacteria | 1081 |
| 197 | Ga0373937_0144345 | 3300036401 | Bacteria | 2228 |
| 198 | Ga0373937_0721937 | 3300036401 | Bacteria | 943 |
| 199 | Ga0436365_1646641 | 3300039437 | Unclassified | 1362 |
| 200 | Ga0466967_0510556 | 3300045976 | Bacteria | 1180 |
| 201 | Ga0495629_0217112 | 3300046459 | Bacteria | 1320 |
| 202 | Ga0495580_0212178 | 3300046472 | Bacteria | 1332 |
| 203 | Ga0495580_0341931 | 3300046472 | Bacteria | 1015 |
| 204 | Ga0495639_0172834 | 3300046475 | Bacteria | 1049 |
| 205 | Ga0495630_0096183 | 3300046517 | Bacteria | 2239 |
| 206 | Ga0495598_0002694 | 3300046537 | Bacteria | 3682 |
| 207 | Ga0495659_0116483 | 3300046664 | Bacteria | 1048 |
| 208 | Ga0495647_0067605 | 3300046681 | Bacteria | 1424 |
| 209 | Ga0495669_0295831 | 3300046684 | Bacteria | 780 |
| 210 | Ga0495624_0707614 | 3300046690 | Unclassified | 598 |
| 211 | Ga0496101_0299337 | 3300048904 | Bacteria | 1260 |
| 212 | Ga0496102_0152811 | 3300048905 | Bacteria | 2169 |
| 213 | Ga0496104_0041694 | 3300048907 | Bacteria | 4305 |
| 214 | Ga0496106_0076311 | 3300048909 | Bacteria | 2569 |
| 215 | Ga0496108_0008240 | 3300048911 | Bacteria | 8458 |
| 216 | Ga0496108_0218988 | 3300048911 | Bacteria | 1654 |
| 217 | Ga0496109_0117863 | 3300048912 | Bacteria | 2472 |
| 218 | Ga0496109_0212097 | 3300048912 | Bacteria | 1821 |
| 219 | Ga0496112_0000346 | 3300048915 | Bacteria | 30207 |
| 220 | Ga0496112_0105207 | 3300048915 | Bacteria | 2792 |
| 221 | Ga0496113_0046881 | 3300048916 | Bacteria | 3210 |
| 222 | Ga0496114_0038580 | 3300048917 | Bacteria | 3953 |
| 223 | Ga0496114_0064195 | 3300048917 | Unclassified | 3075 |
| 224 | Ga0496114_1624725 | 3300048917 | Unclassified | 534 |
| 225 | Ga0501291_128524 | 3300049514 | Bacteria | 556 |
| 226 | Ga0501076_0950785 | 3300049592 | Bacteria | 708 |
| 227 | Ga0501081_0646364 | 3300049743 | Bacteria | 793 |
| 228 | nmdc:mga00v17_69262_c1 | 3300050491 | Bacteria | 2183 |
| 229 | nmdc:mga0k408_183784_c1 | 3300050493 | Bacteria | 1247 |
| 230 | nmdc:mga07m45_239255_c1 | 3300050496 | Bacteria | 1056 |
| 231 | nmdc:mga05p37_190332_c1 | 3300050507 | Bacteria | 2492 |
| 232 | nmdc:mga05p37_2733_c1 | 3300050507 | Bacteria | 20505 |
| 233 | nmdc:mga05p37_453896_c1 | 3300050507 | Bacteria | 1483 |
| 234 | nmdc:mga05p37_45488_c1 | 3300050507 | Bacteria | 5398 |
| 235 | nmdc:mga05p37_9449_c1 | 3300050507 | Bacteria | 11545 |
| 236 | nmdc:mga05p37_982003_c1 | 3300050507 | Bacteria | 900 |
| 237 | nmdc:mga09592_108770_c1 | 3300050508 | Bacteria | 2378 |
| 238 | nmdc:mga09592_182768_c1 | 3300050508 | Bacteria | 1814 |
| 239 | nmdc:mga08y16_12669_c1 | 3300050511 | Bacteria | 8870 |
| 240 | nmdc:mga08y16_96659_c1 | 3300050511 | Bacteria | 3076 |
| 241 | nmdc:mga0n895_22526_c1 | 3300050512 | Bacteria | 5909 |
| 242 | nmdc:mga0n895_28604_c1 | 3300050512 | Bacteria | 5303 |
| 243 | nmdc:mga0n895_538363_c1 | 3300050512 | Bacteria | 1174 |
| 244 | nmdc:mga0n895_545794_c1 | 3300050512 | Bacteria | 1165 |
| 245 | nmdc:mga0n895_56219_c1 | 3300050512 | Bacteria | 3876 |
| 246 | nmdc:mga0rr50_3951_c1 | 3300050513 | Bacteria | 8624 |
| 247 | nmdc:mga0rr50_545560_c1 | 3300050513 | Bacteria | 987 |
| 248 | nmdc:mga0rr50_772881_c1 | 3300050513 | Bacteria | 820 |
| 249 | nmdc:mga08x19_100151_c1 | 3300050514 | Bacteria | 1922 |
| 250 | nmdc:mga0a205_115617_c1 | 3300050515 | Bacteria | 2581 |
| 251 | nmdc:mga0a205_13264_c1 | 3300050515 | Bacteria | 7663 |
| 252 | nmdc:mga0a205_23584_c1 | 3300050515 | Bacteria | 5836 |
| 253 | nmdc:mga0a205_384614_c1 | 3300050515 | Bacteria | 1268 |
| 254 | nmdc:mga0a205_48979_c1 | 3300050515 | Bacteria | 4078 |
| 255 | nmdc:mga0a205_765584_c1 | 3300050515 | Bacteria | 814 |
| 256 | nmdc:mga0a205_99809_c1 | 3300050515 | Bacteria | 2802 |
| 257 | Ga0500566_0462275 | 3300053094 | Bacteria | 553 |
| 258 | Ga0500658_0229935 | 3300053134 | Bacteria | 851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10641447 | Ga0307412_106414471 | 145 |
| 2 | 3300006914 | Ga0075436_100662069 | Ga0075436_1006620692 | 148 |
| 3 | 3300031711 | Ga0265314_10033193 | Ga0265314_100331932 | 149 |
| 4 | 3300035119 | Ga0373956_0257192 | Ga0373956_0257192_206_712 | 149 |
| 5 | 3300036401 | Ga0373937_0144345 | Ga0373937_0144345_1534_2040 | 149 |
| 6 | 3300046459 | Ga0495629_0217112 | Ga0495629_0217112_396_902 | 149 |
| 7 | 3300046517 | Ga0495630_0096183 | Ga0495630_0096183_1570_2076 | 149 |
| 8 | 3300005338 | Ga0068868_100016003 | Ga0068868_1000160032 | 150 |
| 9 | 3300005367 | Ga0070667_100502880 | Ga0070667_1005028802 | 150 |
| 10 | 3300005434 | Ga0070709_10227081 | Ga0070709_102270812 | 150 |
| 11 | 3300005436 | Ga0070713_101341992 | Ga0070713_1013419921 | 150 |
| 12 | 3300005440 | Ga0070705_100019049 | Ga0070705_1000190494 | 150 |
| 13 | 3300005468 | Ga0070707_100734462 | Ga0070707_1007344622 | 150 |
| 14 | 3300005471 | Ga0070698_100307881 | Ga0070698_1003078812 | 150 |
| 15 | 3300005518 | Ga0070699_100545210 | Ga0070699_1005452101 | 150 |
| 16 | 3300005544 | Ga0070686_100758065 | Ga0070686_1007580651 | 150 |
| 17 | 3300005546 | Ga0070696_100081492 | Ga0070696_1000814923 | 150 |
| 18 | 3300005718 | Ga0068866_10095940 | Ga0068866_100959402 | 150 |
| 19 | 3300005719 | Ga0068861_100587654 | Ga0068861_1005876542 | 150 |
| 20 | 3300005843 | Ga0068860_100058408 | Ga0068860_1000584082 | 150 |
| 21 | 3300014326 | Ga0157380_10703128 | Ga0157380_107031282 | 150 |
| 22 | 3300025906 | Ga0207699_10333631 | Ga0207699_103336311 | 150 |
| 23 | 3300025935 | Ga0207709_11423366 | Ga0207709_114233661 | 150 |
| 24 | 3300025939 | Ga0207665_10777397 | Ga0207665_107773971 | 150 |
| 25 | 3300005295 | Ga0065707_10172228 | Ga0065707_101722282 | 152 |
| 26 | 3300005354 | Ga0070675_101193378 | Ga0070675_1011933781 | 152 |
| 27 | 3300005434 | Ga0070709_10016431 | Ga0070709_100164312 | 152 |
| 28 | 3300005436 | Ga0070713_100088413 | Ga0070713_1000884134 | 152 |
| 29 | 3300005440 | Ga0070705_100158275 | Ga0070705_1001582752 | 152 |
| 30 | 3300005458 | Ga0070681_10137419 | Ga0070681_101374193 | 152 |
| 31 | 3300005549 | Ga0070704_100425589 | Ga0070704_1004255892 | 152 |
| 32 | 3300005841 | Ga0068863_100004492 | Ga0068863_1000044926 | 152 |
| 33 | 3300005937 | Ga0081455_10114921 | Ga0081455_101149212 | 152 |
| 34 | 3300006358 | Ga0068871_100116588 | Ga0068871_1001165882 | 152 |
| 35 | 3300006844 | Ga0075428_100021428 | Ga0075428_1000214288 | 152 |
| 36 | 3300006847 | Ga0075431_100110040 | Ga0075431_1001100404 | 152 |
| 37 | 3300006852 | Ga0075433_10028551 | Ga0075433_100285512 | 152 |
| 38 | 3300006852 | Ga0075433_10036668 | Ga0075433_100366683 | 152 |
| 39 | 3300006871 | Ga0075434_100880220 | Ga0075434_1008802202 | 152 |
| 40 | 3300006880 | Ga0075429_100017657 | Ga0075429_1000176579 | 152 |
| 41 | 3300007076 | Ga0075435_100378527 | Ga0075435_1003785272 | 152 |
| 42 | 3300009094 | Ga0111539_10009026 | Ga0111539_100090266 | 152 |
| 43 | 3300025901 | Ga0207688_10297095 | Ga0207688_102970953 | 152 |
| 44 | 3300025906 | Ga0207699_10013570 | Ga0207699_100135706 | 152 |
| 45 | 3300025937 | Ga0207669_10919511 | Ga0207669_109195112 | 152 |
| 46 | 3300025939 | Ga0207665_10585692 | Ga0207665_105856922 | 152 |
| 47 | 3300026088 | Ga0207641_10021930 | Ga0207641_100219302 | 152 |
| 48 | 3300027907 | Ga0207428_10063672 | Ga0207428_100636722 | 152 |
| 49 | 3300035242 | Ga0373962_0306430 | Ga0373962_0306430_14_490 | 152 |
| 50 | 3300048917 | Ga0496114_1624725 | Ga0496114_1624725_51_512 | 152 |
| 51 | 3300049743 | Ga0501081_0646364 | Ga0501081_0646364_15_482 | 152 |
| 52 | 3300050511 | nmdc:mga08y16_12669_c1 | nmdc:mga08y16_12669_c1_6782_7246 | 152 |
| 53 | 3300050512 | nmdc:mga0n895_538363_c1 | nmdc:mga0n895_538363_c1_408_872 | 152 |
| 54 | 3300050512 | nmdc:mga0n895_545794_c1 | nmdc:mga0n895_545794_c1_335_802 | 152 |
| 55 | 3300050513 | nmdc:mga0rr50_545560_c1 | nmdc:mga0rr50_545560_c1_291_767 | 152 |
| 56 | 3300050515 | nmdc:mga0a205_765584_c1 | nmdc:mga0a205_765584_c1_207_683 | 152 |
| 57 | 3300005843 | Ga0068860_101056929 | Ga0068860_1010569291 | 153 |
| 58 | 3300049592 | Ga0501076_0950785 | Ga0501076_0950785_197_694 | 153 |
| 59 | 3300005444 | Ga0070694_100003652 | Ga0070694_1000036522 | 160 |
| 60 | 3300005545 | Ga0070695_100013654 | Ga0070695_1000136544 | 160 |
| 61 | 3300005546 | Ga0070696_100034335 | Ga0070696_1000343354 | 160 |
| 62 | 3300005549 | Ga0070704_100051968 | Ga0070704_1000519684 | 160 |
| 63 | 3300006058 | Ga0075432_10065282 | Ga0075432_100652821 | 160 |
| 64 | 3300007076 | Ga0075435_100005531 | Ga0075435_1000055313 | 160 |
| 65 | 3300009147 | Ga0114129_10101456 | Ga0114129_101014563 | 160 |
| 66 | 3300027907 | Ga0207428_10220321 | Ga0207428_102203211 | 160 |
| 67 | 3300050507 | nmdc:mga05p37_982003_c1 | nmdc:mga05p37_982003_c1_331_816 | 160 |
| 68 | 3300050512 | nmdc:mga0n895_22526_c1 | nmdc:mga0n895_22526_c1_1865_2350 | 160 |
| 69 | 3300050513 | nmdc:mga0rr50_3951_c1 | nmdc:mga0rr50_3951_c1_4868_5353 | 160 |
| 70 | 3300050515 | nmdc:mga0a205_99809_c1 | nmdc:mga0a205_99809_c1_73_558 | 160 |
| 71 | 3300005467 | Ga0070706_101093054 | Ga0070706_1010930541 | 161 |
| 72 | 3300005985 | Ga0081539_10007146 | Ga0081539_100071466 | 161 |
| 73 | 3300050507 | nmdc:mga05p37_453896_c1 | nmdc:mga05p37_453896_c1_203_688 | 161 |
| 74 | 3300005331 | Ga0070670_100211667 | Ga0070670_1002116672 | 162 |
| 75 | 3300005336 | Ga0070680_100226937 | Ga0070680_1002269372 | 162 |
| 76 | 3300005364 | Ga0070673_100864767 | Ga0070673_1008647672 | 162 |
| 77 | 3300005366 | Ga0070659_101169893 | Ga0070659_1011698931 | 162 |
| 78 | 3300005458 | Ga0070681_10033755 | Ga0070681_100337552 | 162 |
| 79 | 3300005530 | Ga0070679_100082745 | Ga0070679_1000827454 | 162 |
| 80 | 3300005544 | Ga0070686_100651728 | Ga0070686_1006517282 | 162 |
| 81 | 3300005548 | Ga0070665_100084939 | Ga0070665_1000849392 | 162 |
| 82 | 3300005842 | Ga0068858_100171626 | Ga0068858_1001716262 | 162 |
| 83 | 3300006237 | Ga0097621_100206553 | Ga0097621_1002065532 | 162 |
| 84 | 3300006358 | Ga0068871_100105106 | Ga0068871_1001051062 | 162 |
| 85 | 3300006881 | Ga0068865_100034553 | Ga0068865_1000345531 | 162 |
| 86 | 3300009098 | Ga0105245_10852422 | Ga0105245_108524222 | 162 |
| 87 | 3300009098 | Ga0105245_11604540 | Ga0105245_116045401 | 162 |
| 88 | 3300009148 | Ga0105243_11027496 | Ga0105243_110274962 | 162 |
| 89 | 3300009176 | Ga0105242_10024730 | Ga0105242_100247302 | 162 |
| 90 | 3300009177 | Ga0105248_10039033 | Ga0105248_100390332 | 162 |
| 91 | 3300009177 | Ga0105248_10514431 | Ga0105248_105144312 | 162 |
| 92 | 3300013306 | Ga0163162_10862045 | Ga0163162_108620452 | 162 |
| 93 | 3300013308 | Ga0157375_10472253 | Ga0157375_104722532 | 162 |
| 94 | 3300013308 | Ga0157375_11814180 | Ga0157375_118141801 | 162 |
| 95 | 3300014969 | Ga0157376_10589281 | Ga0157376_105892812 | 162 |
| 96 | 3300014969 | Ga0157376_10941152 | Ga0157376_109411522 | 162 |
| 97 | 3300025912 | Ga0207707_10251454 | Ga0207707_102514542 | 162 |
| 98 | 3300025917 | Ga0207660_10662486 | Ga0207660_106624861 | 162 |
| 99 | 3300025927 | Ga0207687_10197447 | Ga0207687_101974472 | 162 |
| 100 | 3300025932 | Ga0207690_11128070 | Ga0207690_111280702 | 162 |
| 101 | 3300025934 | Ga0207686_10031122 | Ga0207686_100311223 | 162 |
| 102 | 3300025937 | Ga0207669_10515419 | Ga0207669_105154192 | 162 |
| 103 | 3300025938 | Ga0207704_10096852 | Ga0207704_100968522 | 162 |
| 104 | 3300025938 | Ga0207704_10099031 | Ga0207704_100990312 | 162 |
| 105 | 3300025941 | Ga0207711_10018229 | Ga0207711_100182295 | 162 |
| 106 | 3300026035 | Ga0207703_10368954 | Ga0207703_103689542 | 162 |
| 107 | 3300026088 | Ga0207641_11130343 | Ga0207641_111303432 | 162 |
| 108 | 3300046681 | Ga0495647_0067605 | Ga0495647_0067605_342_830 | 162 |
| 109 | 3300046690 | Ga0495624_0707614 | Ga0495624_0707614_90_578 | 162 |
| 110 | 3300048905 | Ga0496102_0152811 | Ga0496102_0152811_1119_1607 | 162 |
| 111 | 3300048909 | Ga0496106_0076311 | Ga0496106_0076311_918_1406 | 162 |
| 112 | 3300048911 | Ga0496108_0218988 | Ga0496108_0218988_74_562 | 162 |
| 113 | 3300048912 | Ga0496109_0117863 | Ga0496109_0117863_1504_1992 | 162 |
| 114 | 3300048915 | Ga0496112_0105207 | Ga0496112_0105207_1241_1729 | 162 |
| 115 | 3300048917 | Ga0496114_0064195 | Ga0496114_0064195_307_795 | 162 |
| 116 | 3300050496 | nmdc:mga07m45_239255_c1 | nmdc:mga07m45_239255_c1_502_990 | 162 |
| 117 | 3300053094 | Ga0500566_0462275 | Ga0500566_0462275_36_524 | 162 |
| 118 | 3300053134 | Ga0500658_0229935 | Ga0500658_0229935_337_825 | 162 |
| 119 | 3300005331 | Ga0070670_100623366 | Ga0070670_1006233662 | 163 |
| 120 | 3300005331 | Ga0070670_100694837 | Ga0070670_1006948372 | 163 |
| 121 | 3300005354 | Ga0070675_100632812 | Ga0070675_1006328121 | 163 |
| 122 | 3300005445 | Ga0070708_100044930 | Ga0070708_1000449303 | 163 |
| 123 | 3300005617 | Ga0068859_101505912 | Ga0068859_1015059121 | 163 |
| 124 | 3300005719 | Ga0068861_100296397 | Ga0068861_1002963972 | 163 |
| 125 | 3300005843 | Ga0068860_101194079 | Ga0068860_1011940792 | 163 |
| 126 | 3300006931 | Ga0097620_101505748 | Ga0097620_1015057481 | 163 |
| 127 | 3300025900 | Ga0207710_10009537 | Ga0207710_100095373 | 163 |
| 128 | 3300025939 | Ga0207665_11244013 | Ga0207665_112440131 | 163 |
| 129 | 3300025941 | Ga0207711_10010953 | Ga0207711_100109535 | 163 |
| 130 | 3300025942 | Ga0207689_10772713 | Ga0207689_107727132 | 163 |
| 131 | 3300026035 | Ga0207703_10009261 | Ga0207703_100092617 | 163 |
| 132 | 3300026088 | Ga0207641_10045599 | Ga0207641_100455993 | 163 |
| 133 | 3300026095 | Ga0207676_10028443 | Ga0207676_100284433 | 163 |
| 134 | 3300026118 | Ga0207675_100317396 | Ga0207675_1003173962 | 163 |
| 135 | 3300028381 | Ga0268264_11199349 | Ga0268264_111993492 | 163 |
| 136 | 3300048907 | Ga0496104_0041694 | Ga0496104_0041694_2431_2922 | 163 |
| 137 | 3300048911 | Ga0496108_0008240 | Ga0496108_0008240_7398_7889 | 163 |
| 138 | 3300048915 | Ga0496112_0000346 | Ga0496112_0000346_18960_19451 | 163 |
| 139 | 3300048916 | Ga0496113_0046881 | Ga0496113_0046881_317_808 | 163 |
| 140 | 3300048917 | Ga0496114_0038580 | Ga0496114_0038580_2374_2865 | 163 |
| 141 | 3300005347 | Ga0070668_100365913 | Ga0070668_1003659131 | 164 |
| 142 | 3300005471 | Ga0070698_100099386 | Ga0070698_1000993862 | 164 |
| 143 | 3300005471 | Ga0070698_100117016 | Ga0070698_1001170162 | 164 |
| 144 | 3300005518 | Ga0070699_100018755 | Ga0070699_1000187552 | 164 |
| 145 | 3300005617 | Ga0068859_100794957 | Ga0068859_1007949572 | 164 |
| 146 | 3300006871 | Ga0075434_100411677 | Ga0075434_1004116773 | 164 |
| 147 | 3300006931 | Ga0097620_100795028 | Ga0097620_1007950282 | 164 |
| 148 | 3300009147 | Ga0114129_10034394 | Ga0114129_100343946 | 164 |
| 149 | 3300009176 | Ga0105242_10848162 | Ga0105242_108481621 | 164 |
| 150 | 3300009177 | Ga0105248_10348954 | Ga0105248_103489543 | 164 |
| 151 | 3300009177 | Ga0105248_10654189 | Ga0105248_106541891 | 164 |
| 152 | 3300009177 | Ga0105248_10894707 | Ga0105248_108947072 | 164 |
| 153 | 3300025907 | Ga0207645_10472309 | Ga0207645_104723092 | 164 |
| 154 | 3300025941 | Ga0207711_10291923 | Ga0207711_102919232 | 164 |
| 155 | 3300025941 | Ga0207711_10796555 | Ga0207711_107965551 | 164 |
| 156 | 3300028380 | Ga0268265_10916869 | Ga0268265_109168691 | 164 |
| 157 | 3300039437 | Ga0436365_1646641 | Ga0436365_1646641_672_1172 | 164 |
| 158 | 3300045976 | Ga0466967_0510556 | Ga0466967_0510556_561_1055 | 164 |
| 159 | 3300050507 | nmdc:mga05p37_2733_c1 | nmdc:mga05p37_2733_c1_6091_6594 | 164 |
| 160 | 3300050512 | nmdc:mga0n895_28604_c1 | nmdc:mga0n895_28604_c1_1158_1652 | 164 |
| 161 | 3300050514 | nmdc:mga08x19_100151_c1 | nmdc:mga08x19_100151_c1_368_862 | 164 |
| 162 | 3300050515 | nmdc:mga0a205_115617_c1 | nmdc:mga0a205_115617_c1_328_831 | 164 |
| 163 | 3300049514 | Ga0501291_128524 | Ga0501291_128524_22_525 | 165 |
| 164 | 3300005295 | Ga0065707_10059479 | Ga0065707_100594791 | 166 |
| 165 | 3300005335 | Ga0070666_10163769 | Ga0070666_101637692 | 166 |
| 166 | 3300005340 | Ga0070689_100046429 | Ga0070689_1000464293 | 166 |
| 167 | 3300005340 | Ga0070689_100469369 | Ga0070689_1004693692 | 166 |
| 168 | 3300005343 | Ga0070687_100171682 | Ga0070687_1001716822 | 166 |
| 169 | 3300005353 | Ga0070669_100180548 | Ga0070669_1001805482 | 166 |
| 170 | 3300005355 | Ga0070671_100008670 | Ga0070671_1000086701 | 166 |
| 171 | 3300005364 | Ga0070673_100085137 | Ga0070673_1000851372 | 166 |
| 172 | 3300005365 | Ga0070688_100429520 | Ga0070688_1004295202 | 166 |
| 173 | 3300005367 | Ga0070667_100025944 | Ga0070667_1000259443 | 166 |
| 174 | 3300005436 | Ga0070713_100153260 | Ga0070713_1001532602 | 166 |
| 175 | 3300005438 | Ga0070701_10209242 | Ga0070701_102092422 | 166 |
| 176 | 3300005445 | Ga0070708_100018010 | Ga0070708_1000180102 | 166 |
| 177 | 3300005466 | Ga0070685_10282475 | Ga0070685_102824751 | 166 |
| 178 | 3300005518 | Ga0070699_100509278 | Ga0070699_1005092782 | 166 |
| 179 | 3300005543 | Ga0070672_100008648 | Ga0070672_1000086486 | 166 |
| 180 | 3300005617 | Ga0068859_100295685 | Ga0068859_1002956851 | 166 |
| 181 | 3300005718 | Ga0068866_10209308 | Ga0068866_102093082 | 166 |
| 182 | 3300005842 | Ga0068858_101100802 | Ga0068858_1011008022 | 166 |
| 183 | 3300005843 | Ga0068860_100350189 | Ga0068860_1003501892 | 166 |
| 184 | 3300005844 | Ga0068862_100004877 | Ga0068862_1000048776 | 166 |
| 185 | 3300005937 | Ga0081455_10087453 | Ga0081455_100874533 | 166 |
| 186 | 3300006175 | Ga0070712_100314412 | Ga0070712_1003144122 | 166 |
| 187 | 3300006237 | Ga0097621_100003790 | Ga0097621_10000379013 | 166 |
| 188 | 3300006358 | Ga0068871_100000268 | Ga0068871_10000026813 | 166 |
| 189 | 3300006358 | Ga0068871_100111937 | Ga0068871_1001119372 | 166 |
| 190 | 3300006844 | Ga0075428_100056298 | Ga0075428_1000562983 | 166 |
| 191 | 3300006852 | Ga0075433_10177420 | Ga0075433_101774202 | 166 |
| 192 | 3300006871 | Ga0075434_100160829 | Ga0075434_1001608292 | 166 |
| 193 | 3300006881 | Ga0068865_100492522 | Ga0068865_1004925222 | 166 |
| 194 | 3300006931 | Ga0097620_100295706 | Ga0097620_1002957063 | 166 |
| 195 | 3300007788 | Ga0099795_10197036 | Ga0099795_101970362 | 166 |
| 196 | 3300009093 | Ga0105240_10344252 | Ga0105240_103442522 | 166 |
| 197 | 3300009101 | Ga0105247_10192201 | Ga0105247_101922012 | 166 |
| 198 | 3300009147 | Ga0114129_10012455 | Ga0114129_100124555 | 166 |
| 199 | 3300009147 | Ga0114129_10102942 | Ga0114129_101029424 | 166 |
| 200 | 3300009147 | Ga0114129_10128011 | Ga0114129_101280112 | 166 |
| 201 | 3300009147 | Ga0114129_10135645 | Ga0114129_101356453 | 166 |
| 202 | 3300009177 | Ga0105248_10329741 | Ga0105248_103297412 | 166 |
| 203 | 3300009553 | Ga0105249_11807397 | Ga0105249_118073971 | 166 |
| 204 | 3300013306 | Ga0163162_11169686 | Ga0163162_111696861 | 166 |
| 205 | 3300013308 | Ga0157375_10223071 | Ga0157375_102230713 | 166 |
| 206 | 3300014968 | Ga0157379_10006336 | Ga0157379_1000633610 | 166 |
| 207 | 3300014969 | Ga0157376_11258291 | Ga0157376_112582911 | 166 |
| 208 | 3300025315 | Ga0207697_10115594 | Ga0207697_101155941 | 166 |
| 209 | 3300025900 | Ga0207710_10288317 | Ga0207710_102883172 | 166 |
| 210 | 3300025901 | Ga0207688_10098767 | Ga0207688_100987672 | 166 |
| 211 | 3300025903 | Ga0207680_10175069 | Ga0207680_101750692 | 166 |
| 212 | 3300025914 | Ga0207671_10212302 | Ga0207671_102123022 | 166 |
| 213 | 3300025918 | Ga0207662_10126100 | Ga0207662_101261003 | 166 |
| 214 | 3300025927 | Ga0207687_10060377 | Ga0207687_100603772 | 166 |
| 215 | 3300025933 | Ga0207706_10144396 | Ga0207706_101443962 | 166 |
| 216 | 3300025936 | Ga0207670_10058223 | Ga0207670_100582233 | 166 |
| 217 | 3300025938 | Ga0207704_10169819 | Ga0207704_101698192 | 166 |
| 218 | 3300025940 | Ga0207691_10010163 | Ga0207691_100101638 | 166 |
| 219 | 3300025941 | Ga0207711_10161730 | Ga0207711_101617302 | 166 |
| 220 | 3300025941 | Ga0207711_10587985 | Ga0207711_105879851 | 166 |
| 221 | 3300025960 | Ga0207651_10057920 | Ga0207651_100579202 | 166 |
| 222 | 3300025986 | Ga0207658_10020576 | Ga0207658_100205763 | 166 |
| 223 | 3300028380 | Ga0268265_10200096 | Ga0268265_102000962 | 166 |
| 224 | 3300028381 | Ga0268264_10148083 | Ga0268264_101480832 | 166 |
| 225 | 3300034957 | Ga0373938_0040316 | Ga0373938_0040316_433_951 | 166 |
| 226 | 3300035112 | Ga0373932_0059733 | Ga0373932_0059733_27_554 | 166 |
| 227 | 3300035121 | Ga0373960_0106325 | Ga0373960_0106325_198_716 | 166 |
| 228 | 3300035691 | Ga0373931_0248328 | Ga0373931_0248328_268_795 | 166 |
| 229 | 3300036401 | Ga0373937_0721937 | Ga0373937_0721937_276_803 | 166 |
| 230 | 3300046472 | Ga0495580_0341931 | Ga0495580_0341931_11_529 | 166 |
| 231 | 3300046664 | Ga0495659_0116483 | Ga0495659_0116483_78_593 | 166 |
| 232 | 3300046684 | Ga0495669_0295831 | Ga0495669_0295831_21_539 | 166 |
| 233 | 3300048904 | Ga0496101_0299337 | Ga0496101_0299337_164_682 | 166 |
| 234 | 3300048912 | Ga0496109_0212097 | Ga0496109_0212097_1128_1646 | 166 |
| 235 | 3300050507 | nmdc:mga05p37_190332_c1 | nmdc:mga05p37_190332_c1_1180_1695 | 166 |
| 236 | 3300050507 | nmdc:mga05p37_45488_c1 | nmdc:mga05p37_45488_c1_3911_4429 | 166 |
| 237 | 3300050507 | nmdc:mga05p37_9449_c1 | nmdc:mga05p37_9449_c1_7813_8319 | 166 |
| 238 | 3300050508 | nmdc:mga09592_182768_c1 | nmdc:mga09592_182768_c1_936_1454 | 166 |
| 239 | 3300050511 | nmdc:mga08y16_96659_c1 | nmdc:mga08y16_96659_c1_2417_2935 | 166 |
| 240 | 3300050512 | nmdc:mga0n895_56219_c1 | nmdc:mga0n895_56219_c1_254_772 | 166 |
| 241 | 3300050513 | nmdc:mga0rr50_772881_c1 | nmdc:mga0rr50_772881_c1_58_576 | 166 |
| 242 | 3300050515 | nmdc:mga0a205_13264_c1 | nmdc:mga0a205_13264_c1_5970_6488 | 166 |
| 243 | 3300050515 | nmdc:mga0a205_23584_c1 | nmdc:mga0a205_23584_c1_4842_5357 | 166 |
| 244 | 3300050515 | nmdc:mga0a205_384614_c1 | nmdc:mga0a205_384614_c1_34_552 | 166 |
| 245 | 3300050515 | nmdc:mga0a205_48979_c1 | nmdc:mga0a205_48979_c1_1296_1802 | 166 |
| 246 | 3300006178 | Ga0075367_10067912 | Ga0075367_100679122 | 167 |
| 247 | 3300006195 | Ga0075366_10037241 | Ga0075366_100372412 | 167 |
| 248 | 3300050491 | nmdc:mga00v17_69262_c1 | nmdc:mga00v17_69262_c1_643_1287 | 167 |
| 249 | 3300050493 | nmdc:mga0k408_183784_c1 | nmdc:mga0k408_183784_c1_213_737 | 167 |
| 250 | 3300006358 | Ga0068871_100465483 | Ga0068871_1004654832 | 170 |
| 251 | 3300014969 | Ga0157376_10031147 | Ga0157376_100311474 | 170 |
| 252 | 3300046472 | Ga0495580_0212178 | Ga0495580_0212178_80_607 | 170 |
| 253 | 3300046475 | Ga0495639_0172834 | Ga0495639_0172834_384_911 | 170 |
| 254 | 3300005289 | Ga0065704_10120900 | Ga0065704_101209002 | 171 |
| 255 | 3300005355 | Ga0070671_100144692 | Ga0070671_1001446922 | 171 |
| 256 | 3300005841 | Ga0068863_100472284 | Ga0068863_1004722842 | 171 |
| 257 | 3300046537 | Ga0495598_0002694 | Ga0495598_0002694_1340_1864 | 171 |
| 258 | 3300050508 | nmdc:mga09592_108770_c1 | nmdc:mga09592_108770_c1_1849_2364 | 171 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bdd-assembly1.cif.gz_A | crystal structure of fe(ii) unliganded h-nox protein from k. algicida | 0.3487 | 95 | 161 |
| 3nav-assembly1.cif.gz_B | crystal structure of an alpha subunit of tryptophan synthase from vibrio cholerae o1 biovar el tor str. n16961 | 0.3284 | 95 | 157 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.2699 | 13 | 171 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.2588 | 13 | 171 |
| 7a0g-assembly1.cif.gz_GGG | structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.2519 | 23 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8INF0_1_188_3.90.1520.10 | Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain | 0.4147 | 85 | 164 | 3.90.1520.10 |
| af_A0A2R8Q077_776_1057_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3161 | 61 | 158 | 1.25.10.10 |
| af_K7KEV4_655_834_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2938 | 56 | 171 | 1.25.40.10 |
| af_A0A1D6L3Q1_393_597_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2679 | 66 | 160 | 1.25.40.10 |
| af_O88575_48_624_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.266 | 61 | 165 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521TC89-F1-model_v4 | Uncharacterized protein | 0.9571 | 8 | 166 |
|
| AF-A0A1F2U2G6-F1-model_v4 | Uncharacterized protein | 0.948 | 19 | 166 |
|
| AF-A0A2W4RWJ5-F1-model_v4 | Uncharacterized protein | 0.9474 | 19 | 167 |
|
| AF-A0A2V7UHB1-F1-model_v4 | Uncharacterized protein | 0.9385 | 55 | 163 |
|
| AF-A0A2V8GAG0-F1-model_v4 | Uncharacterized protein | 0.9242 | 11 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar