F367668

General Info

Members Datasets Scaffolds Average Seq Length
257 183 514 249

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_463821_c1|nmdc:mga05p37_463821_c1_322_1170
Length 282
Sequence MVWFNWTGIDDPXXXVEDRHTPPDTAARLPLVPAPGPFGWLVLLEFGLAVLTFVGLQFVVAPYGRHGRSGWGPTVPAWVGWLVMESPASLVFLGVYLAGSHRAELAPLVLLALWQAHYAQRAFVYPFLMRPGARMPVTVMGMAIAFNVLNASINAWWISELGSYPVGWLADPRFVAGLALFVLGYALNRSADRTLRGLRRPGESGYRIPHGRAYRWVSSPNYLGEIIEWTGWALATWSLPGLAFAVYTIANLAPRALANHHWYHERFPDYPPRRRALIPYVL

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
179 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
180 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 2643221616 Leifsonia sp. Root227 Isolate Unclassified
183 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.39
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.23
Nodule 0
Rhizoplane 8.56
Rhizosphere 81.71
Stem 0
Stem Tuber 0.39
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_463821_c1 3300050507 Bacteria 1463
2 JGI25164J39214_1002693 3300002772 Bacteria 2566
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 Ga0055527_1000001 3300003760 Bacteria 850044
5 Ga0055529_1000065 3300003763 Bacteria 173112
6 Ga0070658_10002929 3300005327 Bacteria 14147
7 Ga0070683_100016870 3300005329 Bacteria 6443
8 Ga0070690_100001450 3300005330 Bacteria 12374
9 Ga0070680_100526052 3300005336 Bacteria 1013
10 Ga0068868_100001220 3300005338 Bacteria 17685
11 Ga0068868_100018822 3300005338 Bacteria 5167
12 Ga0070671_100002341 3300005355 Bacteria 14634
13 Ga0070673_100000709 3300005364 Bacteria 18402
14 Ga0070688_100000003 3300005365 Bacteria 100517
15 Ga0070659_100244074 3300005366 Bacteria 1487
16 Ga0070667_100001950 3300005367 Bacteria 18314
17 Ga0070714_100271240 3300005435 Bacteria 1573
18 Ga0070713_100017542 3300005436 Bacteria 5416
19 Ga0070713_100378741 3300005436 Unclassified 1318
20 Ga0070701_10031070 3300005438 Unclassified 2648
21 Ga0070705_100002717 3300005440 Bacteria 8839
22 Ga0070700_100015189 3300005441 Bacteria 4362
23 Ga0070663_100005387 3300005455 Bacteria 7601
24 Ga0070678_100016616 3300005456 Bacteria 4714
25 Ga0070681_10028885 3300005458 Bacteria 5572
26 Ga0070681_10126127 3300005458 Bacteria 2492
27 Ga0070684_100345309 3300005535 Bacteria 1368
28 Ga0070693_100007921 3300005547 Bacteria 5215
29 Ga0070704_100005675 3300005549 Bacteria 7290
30 Ga0070664_100002572 3300005564 Bacteria 14634
31 Ga0068857_100182498 3300005577 Bacteria 1910
32 Ga0068857_100412151 3300005577 Bacteria 1258
33 Ga0068852_100018391 3300005616 Bacteria 5505
34 Ga0068864_100016260 3300005618 Bacteria 6193
35 Ga0068864_100126872 3300005618 Unclassified 2287
36 Ga0068864_100209217 3300005618 Bacteria 1795
37 Ga0068866_10000754 3300005718 Bacteria 14613
38 Ga0068851_10000440 3300005834 Bacteria 18571
39 Ga0068870_10000275 3300005840 Bacteria 18998
40 Ga0068863_100003835 3300005841 Bacteria 14866
41 Ga0068863_100003874 3300005841 Bacteria 14800
42 Ga0068858_100030013 3300005842 Bacteria 5048
43 Ga0068858_100544855 3300005842 Unclassified 1123
44 Ga0068860_100484966 3300005843 Bacteria 1232
45 Ga0068862_100002035 3300005844 Bacteria 18314
46 Ga0081455_10000321 3300005937 Bacteria 62752
47 Ga0081540_1000254 3300005983 Bacteria 56367
48 Ga0081540_1000920 3300005983 Bacteria 26480
49 Ga0081540_1013064 3300005983 Bacteria 5422
50 Ga0081539_10001503 3300005985 Bacteria 39376
51 Ga0097621_100071038 3300006237 Bacteria 2876
52 Ga0075428_100002606 3300006844 Bacteria 19615
53 Ga0075428_100044414 3300006844 Bacteria 4884
54 Ga0075428_100214824 3300006844 Bacteria 2078
55 Ga0075430_100000934 3300006846 Bacteria 22921
56 Ga0075431_100083341 3300006847 Bacteria 3301
57 Ga0075431_100182867 3300006847 Bacteria 2151
58 Ga0075434_100732810 3300006871 Bacteria 1006
59 Ga0075429_100001143 3300006880 Bacteria 21414
60 Ga0068865_100000099 3300006881 Bacteria 44846
61 Ga0105244_10065205 3300009036 Bacteria 1825
62 Ga0105245_10002940 3300009098 Bacteria 15301
63 Ga0105247_10000107 3300009101 Bacteria 86628
64 Ga0114129_10000039 3300009147 Bacteria 108531
65 Ga0114129_10005416 3300009147 Bacteria 18023
66 Ga0114129_10135643 3300009147 Bacteria 3377
67 Ga0114129_10724675 3300009147 Bacteria 1276
68 Ga0114129_10863656 3300009147 Bacteria 1149
69 Ga0105243_10005360 3300009148 Bacteria 10009
70 Ga0105242_10040697 3300009176 Bacteria 3745
71 Ga0105242_10178550 3300009176 Bacteria 1872
72 Ga0105248_10166559 3300009177 Bacteria 2484
73 Ga0105237_10000262 3300009545 Bacteria 74323
74 Ga0105238_10000326 3300009551 Bacteria 52090
75 Ga0105238_10487345 3300009551 Unclassified 1233
76 Ga0105249_10002809 3300009553 Bacteria 15034
77 Ga0105239_10000336 3300010375 Bacteria 68782
78 Ga0105239_11157082 3300010375 Bacteria 891
79 Ga0105246_10025852 3300011119 Bacteria 3828
80 Ga0157371_10000127 3300013102 Bacteria 116489
81 Ga0157370_10336612 3300013104 Bacteria 1391
82 Ga0157369_10032329 3300013105 Bacteria 5755
83 Ga0157369_10037141 3300013105 Bacteria 5334
84 Ga0157374_10002755 3300013296 Bacteria 14756
85 Ga0157378_10004955 3300013297 Bacteria 11675
86 Ga0157372_10137185 3300013307 Bacteria 2818
87 Ga0163163_10001933 3300014325 Bacteria 17550
88 Ga0163163_10680019 3300014325 Unclassified 1093
89 Ga0157377_10048118 3300014745 Unclassified 2391
90 Ga0157379_10097740 3300014968 Bacteria 2636
91 Ga0157379_10178401 3300014968 Bacteria 1919
92 Ga0157376_10000274 3300014969 Bacteria 35090
93 Ga0157376_10419147 3300014969 Unclassified 1299
94 Ga0206356_11867912 3300020070 Bacteria 2016
95 Ga0213874_10068362 3300021377 Bacteria 1128
96 Ga0209672_100006 3300025228 Bacteria 1004497
97 Ga0209147_101156 3300025229 Bacteria 10837
98 Ga0207427_100052 3300025231 Bacteria 218228
99 Ga0209437_100821 3300025233 Bacteria 13822
100 Ga0209148_1000015 3300025254 Bacteria 850103
101 Ga0209233_1000001 3300025261 Bacteria 2992747
102 Ga0209455_1000013 3300025272 Bacteria 850103
103 Ga0207656_10042590 3300025321 Unclassified 1932
104 Ga0207682_10000365 3300025893 Bacteria 20788
105 Ga0207642_10000984 3300025899 Bacteria 8900
106 Ga0207710_10017996 3300025900 Unclassified 3002
107 Ga0207688_10000895 3300025901 Bacteria 15047
108 Ga0207680_10300304 3300025903 Bacteria 1119
109 Ga0207647_10001454 3300025904 Bacteria 18192
110 Ga0207647_10161638 3300025904 Bacteria 1306
111 Ga0207643_10000080 3300025908 Bacteria 62631
112 Ga0207705_10107842 3300025909 Bacteria 2055
113 Ga0207707_10114440 3300025912 Bacteria 2357
114 Ga0207671_10007946 3300025914 Bacteria 9095
115 Ga0207693_10011782 3300025915 Bacteria 7068
116 Ga0207662_10000705 3300025918 Bacteria 15283
117 Ga0207657_10000036 3300025919 Bacteria 125256
118 Ga0207657_10279367 3300025919 Bacteria 1326
119 Ga0207649_10061043 3300025920 Bacteria 2371
120 Ga0207681_10061443 3300025923 Unclassified 2582
121 Ga0207694_10002458 3300025924 Bacteria 15122
122 Ga0207650_10000344 3300025925 Bacteria 44987
123 Ga0207659_10027637 3300025926 Unclassified 3844
124 Ga0207687_10402633 3300025927 Bacteria 1126
125 Ga0207700_10171071 3300025928 Bacteria 1812
126 Ga0207690_10483280 3300025932 Bacteria 1000
127 Ga0207706_10003659 3300025933 Bacteria 14687
128 Ga0207686_10021590 3300025934 Bacteria 3697
129 Ga0207709_10411278 3300025935 Bacteria 1037
130 Ga0207670_10000537 3300025936 Bacteria 20898
131 Ga0207669_10000668 3300025937 Bacteria 14791
132 Ga0207704_10355323 3300025938 Bacteria 1142
133 Ga0207711_10000145 3300025941 Bacteria 74476
134 Ga0207711_10195888 3300025941 Bacteria 1842
135 Ga0207689_10003338 3300025942 Bacteria 14703
136 Ga0207661_10016590 3300025944 Bacteria 5436
137 Ga0207661_10028454 3300025944 Bacteria 4280
138 Ga0207679_10000848 3300025945 Bacteria 19662
139 Ga0207679_10040801 3300025945 Bacteria 3325
140 Ga0207679_10042411 3300025945 Bacteria 3270
141 Ga0207667_10002328 3300025949 Bacteria 23800
142 Ga0207651_10000622 3300025960 Bacteria 14937
143 Ga0207712_10001726 3300025961 Bacteria 14647
144 Ga0207640_10015032 3300025981 Bacteria 4471
145 Ga0207658_10003503 3300025986 Bacteria 11075
146 Ga0207677_10000829 3300026023 Bacteria 17693
147 Ga0207703_10000175 3300026035 Bacteria 74610
148 Ga0207703_10033369 3300026035 Bacteria 4080
149 Ga0207703_10419288 3300026035 Unclassified 1245
150 Ga0207639_10027489 3300026041 Bacteria 4145
151 Ga0207678_10004030 3300026067 Bacteria 13215
152 Ga0207702_10006402 3300026078 Bacteria 10155
153 Ga0207641_10030114 3300026088 Bacteria 4494
154 Ga0207641_10252635 3300026088 Unclassified 1647
155 Ga0207648_10004287 3300026089 Bacteria 14703
156 Ga0207676_10002014 3300026095 Bacteria 14793
157 Ga0207676_10068741 3300026095 Bacteria 2834
158 Ga0207676_10109682 3300026095 Bacteria 2307
159 Ga0207674_10000745 3300026116 Bacteria 42703
160 Ga0207674_10031050 3300026116 Bacteria 5614
161 Ga0207674_10036536 3300026116 Bacteria 5115
162 Ga0207674_10080967 3300026116 Bacteria 3250
163 Ga0207675_100000083 3300026118 Bacteria 74568
164 Ga0207675_100800466 3300026118 Bacteria 956
165 Ga0207683_10002967 3300026121 Bacteria 14801
166 Ga0207698_10023140 3300026142 Bacteria 4335
167 Ga0268266_10000284 3300028379 Bacteria 83400
168 Ga0268265_10013254 3300028380 Bacteria 5601
169 Ga0268264_10002161 3300028381 Bacteria 17528
170 Ga0265323_10013602 3300028653 Bacteria 3242
171 Ga0265323_10036203 3300028653 Bacteria 1816
172 Ga0265322_10011390 3300028654 Bacteria 2579
173 Ga0265322_10058588 3300028654 Unclassified 1092
174 Ga0265330_10030264 3300031235 Bacteria 2432
175 Ga0265330_10034923 3300031235 Unclassified 2245
176 Ga0265329_10036863 3300031242 Bacteria 1576
177 Ga0265316_10006027 3300031344 Bacteria 11650
178 Ga0265316_10016496 3300031344 Bacteria 6402
179 Ga0265316_10019564 3300031344 Bacteria 5784
180 Ga0265316_10049379 3300031344 Bacteria 3315
181 Ga0307408_100926125 3300031548 Bacteria 799
182 Ga0265342_10053779 3300031712 Bacteria 2395
183 Ga0265342_10118540 3300031712 Bacteria 1492
184 Ga0316576_10086365 3300031727 Bacteria 2333
185 Ga0316576_10200833 3300031727 Bacteria 1502
186 Ga0316576_10279263 3300031727 Unclassified 1251
187 Ga0316577_10114992 3300031733 Bacteria 1510
188 Ga0307416_100052332 3300032002 Bacteria 3269
189 Ga0307416_100429686 3300032002 Bacteria 1368
190 Ga0373949_0028985 3300035090 Bacteria 1309
191 Ga0373943_0029549 3300035170 Bacteria 2590
192 Ga0373933_0026119 3300035724 Bacteria 3352
193 Ga0316584_0036884 3300036712 Bacteria 3629
194 Ga0316584_0125360 3300036712 Bacteria 1918
195 Ga0373925_0053882 3300037068 Bacteria 3008
196 Ga0373925_0416870 3300037068 Unclassified 1097
197 Ga0400489_41162 3300039093 Bacteria 4079
198 Ga0436363_0133799 3300039450 Bacteria 5918
199 Ga0451577_0012129 3300042876 Bacteria 8106
200 Ga0451577_0025121 3300042876 Bacteria 5407
201 Ga0466972_0107861 3300044658 Unclassified 1316
202 Ga0453684_0001166 3300044712 Bacteria 81618
203 Ga0453684_0001794 3300044712 Bacteria 57029
204 Ga0453684_0005267 3300044712 Bacteria 25858
205 Ga0453684_0013906 3300044712 Bacteria 12982
206 Ga0453684_0042905 3300044712 Bacteria 6088
207 Ga0453684_0129527 3300044712 Bacteria 3030
208 Ga0453684_0216834 3300044712 Bacteria 2220
209 Ga0466959_0247366 3300045049 Bacteria 1230
210 Ga0451576_0304498 3300045051 Bacteria 1667
211 Ga0495630_0434164 3300046517 Unclassified 1006
212 Ga0495581_0110973 3300047315 Unclassified 1595
213 Ga0495581_0220820 3300047315 Bacteria 1108
214 Ga0495593_0083859 3300047673 Bacteria 1646
215 Ga0496100_0446727 3300048903 Bacteria 991
216 Ga0496101_0035220 3300048904 Bacteria 3539
217 Ga0496102_0001135 3300048905 Bacteria 24387
218 Ga0496102_0132818 3300048905 Bacteria 2331
219 Ga0496102_0237859 3300048905 Bacteria 1717
220 Ga0496104_0005590 3300048907 Bacteria 11006
221 Ga0496104_0507899 3300048907 Bacteria 1117
222 Ga0496104_0535232 3300048907 Unclassified 1082
223 Ga0496105_0124794 3300048908 Bacteria 2122
224 Ga0496105_0157704 3300048908 Bacteria 1863
225 Ga0496105_0385388 3300048908 Unclassified 1115
226 Ga0496108_0137885 3300048911 Bacteria 2100
227 Ga0496108_0359855 3300048911 Unclassified 1270
228 Ga0496109_0004239 3300048912 Bacteria 11974
229 Ga0496110_0084057 3300048913 Bacteria 2841
230 Ga0496112_0062771 3300048915 Bacteria 3665
231 Ga0496112_0082730 3300048915 Bacteria 3174
232 Ga0496112_0092165 3300048915 Bacteria 2999
233 Ga0496112_0419419 3300048915 Unclassified 1277
234 Ga0496113_0005121 3300048916 Bacteria 8144
235 Ga0496113_0040631 3300048916 Bacteria 3429
236 Ga0496114_0037468 3300048917 Bacteria 4010
237 Ga0496117_0026347 3300048920 Bacteria 4551
238 Ga0496118_0005080 3300048921 Bacteria 15150
239 Ga0496119_0099455 3300048922 Bacteria 1636
240 Ga0496126_0086511 3300048929 Bacteria 2762
241 Ga0501047_0266835 3300049581 Bacteria 1558
242 Ga0501070_0000191 3300049586 Bacteria 57453
243 nmdc:mga03n38_211344_c1 3300050490 Bacteria 1008
244 nmdc:mga05p37_153_c1 3300050507 Bacteria 65478
245 nmdc:mga05p37_501116_c1 3300050507 Bacteria 1394
246 nmdc:mga05p37_662612_c1 3300050507 Bacteria 1166
247 nmdc:mga09592_4_c1 3300050508 Bacteria 133185
248 nmdc:mga0qj67_3_c2 3300050509 Bacteria 152036
249 nmdc:mga06r32_182412_c1 3300050510 Bacteria 2085
250 nmdc:mga06r32_6_c2 3300050510 Bacteria 109995
251 nmdc:mga0n895_341485_c1 3300050512 Bacteria 1516
252 Ga0500635_0000023 3300053080 Bacteria 108024
253 Ga0500583_0013252 3300053092 Bacteria 3182
254 Ga0500654_125838 3300053099 Bacteria 989
255 Ga0500594_0056751 3300053118 Bacteria 1118
256 2644096000 2643221616 Bacteria 4066575
257 2884765360 2884763398 Bacteria 4091164
258 nmdc:mga05p37_463821_c1
259 JGI25164J39214_1002693
260 JGI25165J46597_1000002
261 Ga0055527_1000001
262 Ga0055529_1000065
263 Ga0070658_10002929
264 Ga0070683_100016870
265 Ga0070690_100001450
266 Ga0070680_100526052
267 Ga0068868_100001220
268 Ga0068868_100018822
269 Ga0070671_100002341
270 Ga0070673_100000709
271 Ga0070688_100000003
272 Ga0070659_100244074
273 Ga0070667_100001950
274 Ga0070714_100271240
275 Ga0070713_100017542
276 Ga0070713_100378741
277 Ga0070701_10031070
278 Ga0070705_100002717
279 Ga0070700_100015189
280 Ga0070663_100005387
281 Ga0070678_100016616
282 Ga0070681_10028885
283 Ga0070681_10126127
284 Ga0070684_100345309
285 Ga0070693_100007921
286 Ga0070704_100005675
287 Ga0070664_100002572
288 Ga0068857_100182498
289 Ga0068857_100412151
290 Ga0068852_100018391
291 Ga0068864_100016260
292 Ga0068864_100126872
293 Ga0068864_100209217
294 Ga0068866_10000754
295 Ga0068851_10000440
296 Ga0068870_10000275
297 Ga0068863_100003835
298 Ga0068863_100003874
299 Ga0068858_100030013
300 Ga0068858_100544855
301 Ga0068860_100484966
302 Ga0068862_100002035
303 Ga0081455_10000321
304 Ga0081540_1000254
305 Ga0081540_1000920
306 Ga0081540_1013064
307 Ga0081539_10001503
308 Ga0097621_100071038
309 Ga0075428_100002606
310 Ga0075428_100044414
311 Ga0075428_100214824
312 Ga0075430_100000934
313 Ga0075431_100083341
314 Ga0075431_100182867
315 Ga0075434_100732810
316 Ga0075429_100001143
317 Ga0068865_100000099
318 Ga0105244_10065205
319 Ga0105245_10002940
320 Ga0105247_10000107
321 Ga0114129_10000039
322 Ga0114129_10005416
323 Ga0114129_10135643
324 Ga0114129_10724675
325 Ga0114129_10863656
326 Ga0105243_10005360
327 Ga0105242_10040697
328 Ga0105242_10178550
329 Ga0105248_10166559
330 Ga0105237_10000262
331 Ga0105238_10000326
332 Ga0105238_10487345
333 Ga0105249_10002809
334 Ga0105239_10000336
335 Ga0105239_11157082
336 Ga0105246_10025852
337 Ga0157371_10000127
338 Ga0157370_10336612
339 Ga0157369_10032329
340 Ga0157369_10037141
341 Ga0157374_10002755
342 Ga0157378_10004955
343 Ga0157372_10137185
344 Ga0163163_10001933
345 Ga0163163_10680019
346 Ga0157377_10048118
347 Ga0157379_10097740
348 Ga0157379_10178401
349 Ga0157376_10000274
350 Ga0157376_10419147
351 Ga0206356_11867912
352 Ga0213874_10068362
353 Ga0209672_100006
354 Ga0209147_101156
355 Ga0207427_100052
356 Ga0209437_100821
357 Ga0209148_1000015
358 Ga0209233_1000001
359 Ga0209455_1000013
360 Ga0207656_10042590
361 Ga0207682_10000365
362 Ga0207642_10000984
363 Ga0207710_10017996
364 Ga0207688_10000895
365 Ga0207680_10300304
366 Ga0207647_10001454
367 Ga0207647_10161638
368 Ga0207643_10000080
369 Ga0207705_10107842
370 Ga0207707_10114440
371 Ga0207671_10007946
372 Ga0207693_10011782
373 Ga0207662_10000705
374 Ga0207657_10000036
375 Ga0207657_10279367
376 Ga0207649_10061043
377 Ga0207681_10061443
378 Ga0207694_10002458
379 Ga0207650_10000344
380 Ga0207659_10027637
381 Ga0207687_10402633
382 Ga0207700_10171071
383 Ga0207690_10483280
384 Ga0207706_10003659
385 Ga0207686_10021590
386 Ga0207709_10411278
387 Ga0207670_10000537
388 Ga0207669_10000668
389 Ga0207704_10355323
390 Ga0207711_10000145
391 Ga0207711_10195888
392 Ga0207689_10003338
393 Ga0207661_10016590
394 Ga0207661_10028454
395 Ga0207679_10000848
396 Ga0207679_10040801
397 Ga0207679_10042411
398 Ga0207667_10002328
399 Ga0207651_10000622
400 Ga0207712_10001726
401 Ga0207640_10015032
402 Ga0207658_10003503
403 Ga0207677_10000829
404 Ga0207703_10000175
405 Ga0207703_10033369
406 Ga0207703_10419288
407 Ga0207639_10027489
408 Ga0207678_10004030
409 Ga0207702_10006402
410 Ga0207641_10030114
411 Ga0207641_10252635
412 Ga0207648_10004287
413 Ga0207676_10002014
414 Ga0207676_10068741
415 Ga0207676_10109682
416 Ga0207674_10000745
417 Ga0207674_10031050
418 Ga0207674_10036536
419 Ga0207674_10080967
420 Ga0207675_100000083
421 Ga0207675_100800466
422 Ga0207683_10002967
423 Ga0207698_10023140
424 Ga0268266_10000284
425 Ga0268265_10013254
426 Ga0268264_10002161
427 Ga0265323_10013602
428 Ga0265323_10036203
429 Ga0265322_10011390
430 Ga0265322_10058588
431 Ga0265330_10030264
432 Ga0265330_10034923
433 Ga0265329_10036863
434 Ga0265316_10006027
435 Ga0265316_10016496
436 Ga0265316_10019564
437 Ga0265316_10049379
438 Ga0307408_100926125
439 Ga0265342_10053779
440 Ga0265342_10118540
441 Ga0316576_10086365
442 Ga0316576_10200833
443 Ga0316576_10279263
444 Ga0316577_10114992
445 Ga0307416_100052332
446 Ga0307416_100429686
447 Ga0373949_0028985
448 Ga0373943_0029549
449 Ga0373933_0026119
450 Ga0316584_0036884
451 Ga0316584_0125360
452 Ga0373925_0053882
453 Ga0373925_0416870
454 Ga0400489_41162
455 Ga0436363_0133799
456 Ga0451577_0012129
457 Ga0451577_0025121
458 Ga0466972_0107861
459 Ga0453684_0001166
460 Ga0453684_0001794
461 Ga0453684_0005267
462 Ga0453684_0013906
463 Ga0453684_0042905
464 Ga0453684_0129527
465 Ga0453684_0216834
466 Ga0466959_0247366
467 Ga0451576_0304498
468 Ga0495630_0434164
469 Ga0495581_0110973
470 Ga0495581_0220820
471 Ga0495593_0083859
472 Ga0496100_0446727
473 Ga0496101_0035220
474 Ga0496102_0001135
475 Ga0496102_0132818
476 Ga0496102_0237859
477 Ga0496104_0005590
478 Ga0496104_0507899
479 Ga0496104_0535232
480 Ga0496105_0124794
481 Ga0496105_0157704
482 Ga0496105_0385388
483 Ga0496108_0137885
484 Ga0496108_0359855
485 Ga0496109_0004239
486 Ga0496110_0084057
487 Ga0496112_0062771
488 Ga0496112_0082730
489 Ga0496112_0092165
490 Ga0496112_0419419
491 Ga0496113_0005121
492 Ga0496113_0040631
493 Ga0496114_0037468
494 Ga0496117_0026347
495 Ga0496118_0005080
496 Ga0496119_0099455
497 Ga0496126_0086511
498 Ga0501047_0266835
499 Ga0501070_0000191
500 nmdc:mga03n38_211344_c1
501 nmdc:mga05p37_153_c1
502 nmdc:mga05p37_501116_c1
503 nmdc:mga05p37_662612_c1
504 nmdc:mga09592_4_c1
505 nmdc:mga0qj67_3_c2
506 nmdc:mga06r32_182412_c1
507 nmdc:mga06r32_6_c2
508 nmdc:mga0n895_341485_c1
509 Ga0500635_0000023
510 Ga0500583_0013252
511 Ga0500654_125838
512 Ga0500594_0056751
513 2644096000
514 2884765360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

133

282

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.8694 25 205
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.8255 24 205
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.772 25 205
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.7378 24 205
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.6668 107 190
ID Description Score Start End Superfamily
af_Q9SI62_223_343_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9013 101 205 1.20.120.550
af_P31213_110_253_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.88 69 204 1.20.120.1630
af_Q566Z4_76_251_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8734 35 204 1.20.120.1630
af_Q19605_72_242_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8556 40 202 1.20.120.1630
af_Q566Z4_76_251_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8411 35 204 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A523XKY7-F1-model_v4 DUF1295 domain-containing protein 0.9203 93 205 GO:0006629
GO:0016020
GO:0016627
AF-A0A7L2RJ17-F1-model_v4 S5A1 dehydrogenase 0.9168 104 205 GO:0003865
GO:0006694
GO:0016020
AF-A0A2E6P0L0-F1-model_v4 3-oxo-5-alpha-steroid 4-dehydrogenase C-terminal domain-containing protein 0.9139 106 205 GO:0006629
GO:0016020
GO:0016627
AF-A0A523JAT5-F1-model_v4 3-oxo-5-alpha-steroid 4-dehydrogenase 0.9135 95 205 GO:0006629
GO:0016020
GO:0016627
AF-A0A1A8GFW2-F1-model_v4 3-oxo-5-alpha-steroid 4-dehydrogenase C-terminal domain-containing protein 0.9114 93 205 GO:0003865
GO:0006694
GO:0016020

Map