F367640

General Info

Members Datasets Scaffolds Average Seq Length
257 165 514 124

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0330160|Ga0501047_0330160_415_810
Length 131
Sequence MLQIKRAYEEPTSKDGQRILVDRLWPRGLTKARAAIDLWMKEVAPSPALRKWFAHDPAKWKQFQQRYFKELQEHPQAVDQLRKKARRGRVTLVHSARDEQHNGALALKAYLERGVQRTSKSRVEPQKRVQS

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.94
Metatranscriptomes 4.67
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.39
Rhizoplane 0.39
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 22.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0330160 3300049581 Bacteria 1364
2 rootH2_10248658 3300003320 Bacteria 2669
3 rootH1_10152172 3300003323 Bacteria 2034
4 rootH1_10248646 3300003323 Bacteria 2198
5 rootH1_10306382 3300003323 Unclassified 1144
6 Ga0070658_10058918 3300005327 Unclassified 3127
7 Ga0070683_100237774 3300005329 Bacteria 1732
8 Ga0070680_100489863 3300005336 Unclassified 1051
9 Ga0070660_100026077 3300005339 Bacteria 4350
10 Ga0070687_100353279 3300005343 Bacteria 949
11 Ga0070675_101228586 3300005354 Unclassified 690
12 Ga0070703_10011920 3300005406 Bacteria 2459
13 Ga0070714_100031378 3300005435 Unclassified 4433
14 Ga0070713_100666513 3300005436 Bacteria 992
15 Ga0070708_100304196 3300005445 Bacteria 1501
16 Ga0070708_100785010 3300005445 Bacteria 895
17 Ga0070681_10058539 3300005458 Bacteria 3833
18 Ga0070681_10154335 3300005458 Bacteria 2222
19 Ga0070681_10168164 3300005458 Bacteria 2115
20 Ga0070706_100069184 3300005467 Unclassified 3265
21 Ga0070699_100065144 3300005518 Unclassified 3161
22 Ga0070679_100000727 3300005530 Bacteria 28440
23 Ga0070679_100044243 3300005530 Bacteria 4436
24 Ga0070684_100908610 3300005535 Unclassified 825
25 Ga0070684_102055369 3300005535 Bacteria 539
26 Ga0070697_100049580 3300005536 Unclassified 3408
27 Ga0070697_100065086 3300005536 Bacteria 2978
28 Ga0070697_100461214 3300005536 Bacteria 1108
29 Ga0068853_100506881 3300005539 Unclassified 1140
30 Ga0070686_100118087 3300005544 Bacteria 1817
31 Ga0070696_100014884 3300005546 Bacteria 5223
32 Ga0070665_100059245 3300005548 Bacteria 3838
33 Ga0068855_100010813 3300005563 Bacteria 11019
34 Ga0068855_100020615 3300005563 Bacteria 7905
35 Ga0068855_100564845 3300005563 Bacteria 1230
36 Ga0068857_100925266 3300005577 Unclassified 837
37 Ga0068854_100231354 3300005578 Bacteria 1467
38 Ga0068856_100037230 3300005614 Bacteria 4773
39 Ga0068856_100526065 3300005614 Bacteria 1204
40 Ga0068852_100000021 3300005616 Bacteria 126061
41 Ga0068852_100189984 3300005616 Unclassified 1937
42 Ga0068852_100533718 3300005616 Bacteria 1172
43 Ga0068861_101173458 3300005719 Unclassified 741
44 Ga0068863_101834825 3300005841 Bacteria 616
45 Ga0070717_10058051 3300006028 Bacteria 3200
46 Ga0070712_100484210 3300006175 Bacteria 1035
47 Ga0075433_10257661 3300006852 Bacteria 1547
48 Ga0075434_100681465 3300006871 Bacteria 1046
49 Ga0068865_100378398 3300006881 Bacteria 1154
50 Ga0075436_100025290 3300006914 Bacteria 4085
51 Ga0105240_10012314 3300009093 Bacteria 11817
52 Ga0111539_10083531 3300009094 Bacteria 3755
53 Ga0105245_11474153 3300009098 Unclassified 731
54 Ga0114129_10038210 3300009147 Bacteria 6773
55 Ga0114129_10382626 3300009147 Unclassified 1858
56 Ga0105237_10024989 3300009545 Bacteria 6111
57 Ga0105237_10292039 3300009545 Unclassified 1633
58 Ga0105237_10637372 3300009545 Bacteria 1073
59 Ga0105237_12132922 3300009545 Bacteria 570
60 Ga0105238_10027816 3300009551 Bacteria 5762
61 Ga0105238_10051450 3300009551 Bacteria 4143
62 Ga0105238_10596710 3300009551 Bacteria 1112
63 Ga0105239_10643723 3300010375 Bacteria 1210
64 Ga0105239_11260549 3300010375 Unclassified 852
65 Ga0105239_11463420 3300010375 Unclassified 789
66 Ga0157373_11323637 3300013100 Unclassified 546
67 Ga0157371_10136439 3300013102 Bacteria 1747
68 Ga0157370_10000067 3300013104 Bacteria 113351
69 Ga0157370_10013909 3300013104 Bacteria 8263
70 Ga0157369_10011102 3300013105 Bacteria 10248
71 Ga0157369_10034716 3300013105 Bacteria 5532
72 Ga0157369_10111657 3300013105 Bacteria 2905
73 Ga0157369_10372577 3300013105 Bacteria 1482
74 Ga0157369_11219154 3300013105 Bacteria 768
75 Ga0157369_11517989 3300013105 Bacteria 681
76 Ga0157369_12265253 3300013105 Unclassified 551
77 Ga0157374_10852704 3300013296 Bacteria 928
78 Ga0157372_10013430 3300013307 Bacteria 8749
79 Ga0157372_10070399 3300013307 Bacteria 3935
80 Ga0157372_10071062 3300013307 Bacteria 3918
81 Ga0157372_10239801 3300013307 Bacteria 2104
82 Ga0157372_10306198 3300013307 Bacteria 1849
83 Ga0157372_10414528 3300013307 Unclassified 1570
84 Ga0157372_10592608 3300013307 Bacteria 1292
85 Ga0157379_10003366 3300014968 Bacteria 13526
86 Ga0209025_1019543 3300025294 Bacteria 3761
87 Ga0209257_1082497 3300025304 Bacteria 821
88 Ga0207705_10407955 3300025909 Bacteria 1051
89 Ga0207684_10095013 3300025910 Bacteria 2543
90 Ga0207707_10014491 3300025912 Bacteria 6866
91 Ga0207695_10036566 3300025913 Bacteria 5308
92 Ga0207695_10369870 3300025913 Bacteria 1320
93 Ga0207671_10444045 3300025914 Unclassified 1033
94 Ga0207657_10030312 3300025919 Bacteria 4910
95 Ga0207657_10375993 3300025919 Unclassified 1119
96 Ga0207646_10023292 3300025922 Bacteria 5690
97 Ga0207694_11429092 3300025924 Unclassified 584
98 Ga0207700_11142387 3300025928 Bacteria 696
99 Ga0207664_10224775 3300025929 Unclassified 1629
100 Ga0207690_11849562 3300025932 Bacteria 504
101 Ga0207670_11598399 3300025936 Bacteria 554
102 Ga0207661_10300027 3300025944 Bacteria 1440
103 Ga0207667_10027597 3300025949 Bacteria 6176
104 Ga0207667_10410164 3300025949 Unclassified 1379
105 Ga0207639_10946062 3300026041 Unclassified 806
106 Ga0207702_10134835 3300026078 Bacteria 2226
107 Ga0207702_10956047 3300026078 Bacteria 849
108 Ga0207674_10259615 3300026116 Unclassified 1684
109 Ga0207674_10684772 3300026116 Unclassified 990
110 Ga0207698_10049306 3300026142 Bacteria 3204
111 Ga0207428_10267748 3300027907 Bacteria 1271
112 Ga0268266_10060634 3300028379 Bacteria 3261
113 Ga0307517_10034329 3300028786 Bacteria 5782
114 Ga0307405_11178272 3300031731 Bacteria 662
115 Ga0307413_10949790 3300031824 Bacteria 733
116 Ga0307407_10034682 3300031903 Bacteria 2765
117 Ga0307409_101144110 3300031995 Bacteria 800
118 Ga0307416_101033012 3300032002 Bacteria 925
119 Ga0307414_10215057 3300032004 Bacteria 1574
120 Ga0307411_10721823 3300032005 Bacteria 870
121 Ga0307415_100439715 3300032126 Bacteria 1124
122 Ga0373959_0084004 3300034820 Bacteria 737
123 Ga0373934_0459535 3300035086 Unclassified 534
124 Ga0373931_0049027 3300035691 Bacteria 2241
125 Ga0373937_0148768 3300036401 Bacteria 2193
126 Ga0395905_0248147 3300037471 Unclassified 1663
127 Ga0395905_1864200 3300037471 Bacteria 507
128 Ga0451577_0020747 3300042876 Bacteria 6023
129 Ga0453683_0336897 3300044673 Bacteria 968
130 Ga0451576_0000319 3300045051 Bacteria 116651
131 Ga0495592_0126383 3300046454 Bacteria 1793
132 Ga0495651_0042845 3300046462 Bacteria 3513
133 Ga0495651_0068247 3300046462 Bacteria 2710
134 Ga0495628_0538954 3300046516 Bacteria 839
135 Ga0495652_0030807 3300046529 Bacteria 4701
136 Ga0495645_0002823 3300046543 Bacteria 11783
137 Ga0495656_0238445 3300046615 Bacteria 915
138 Ga0495668_0083338 3300046616 Bacteria 1754
139 Ga0495599_0626420 3300046678 Unclassified 625
140 Ga0495623_0008896 3300046679 Bacteria 6518
141 Ga0495623_0019730 3300046679 Bacteria 4358
142 Ga0495646_0069010 3300046680 Bacteria 2086
143 Ga0495669_0032412 3300046684 Bacteria 2297
144 Ga0495674_0049201 3300047319 Bacteria 3726
145 Ga0495675_0196228 3300047444 Bacteria 1230
146 Ga0495677_0376460 3300047445 Bacteria 561
147 Ga0495602_0045460 3300048088 Bacteria 3973
148 Ga0495602_0236617 3300048088 Bacteria 1368
149 Ga0496102_1276157 3300048905 Bacteria 654
150 Ga0496116_0012906 3300048919 Bacteria 6782
151 Ga0496116_0044622 3300048919 Bacteria 3009
152 Ga0496117_0058846 3300048920 Bacteria 2659
153 Ga0496118_0156598 3300048921 Unclassified 1416
154 Ga0496119_0077205 3300048922 Bacteria 1930
155 Ga0496120_0157716 3300048923 Bacteria 1134
156 Ga0496122_0127805 3300048925 Unclassified 1622
157 Ga0496123_0052581 3300048926 Bacteria 2701
158 Ga0496124_0000434 3300048927 Bacteria 74161
159 Ga0496125_0003034 3300048928 Bacteria 21003
160 Ga0496126_0148005 3300048929 Bacteria 2015
161 Ga0501032_0329616 3300049569 Bacteria 984
162 Ga0501033_0005076 3300049570 Bacteria 10474
163 Ga0501033_0013659 3300049570 Bacteria 6179
164 Ga0501033_0145964 3300049570 Bacteria 1708
165 Ga0501034_0000429 3300049571 Bacteria 69803
166 Ga0501034_0041544 3300049571 Bacteria 4653
167 Ga0501036_0078736 3300049572 Bacteria 2788
168 Ga0501036_0143460 3300049572 Bacteria 2014
169 Ga0501036_1096401 3300049572 Unclassified 650
170 Ga0501037_0063849 3300049573 Bacteria 2684
171 Ga0501037_0491580 3300049573 Bacteria 833
172 Ga0501038_0019944 3300049574 Bacteria 6034
173 Ga0501038_0020522 3300049574 Bacteria 5938
174 Ga0501039_0035809 3300049575 Bacteria 3831
175 Ga0501040_0218799 3300049576 Archaea 1355
176 Ga0501040_0766341 3300049576 Bacteria 698
177 Ga0501041_0246775 3300049577 Bacteria 1122
178 Ga0501041_0940639 3300049577 Bacteria 556
179 Ga0501042_0405235 3300049578 Unclassified 988
180 Ga0501042_0849720 3300049578 Bacteria 664
181 Ga0501043_0021156 3300049579 Bacteria 5099
182 Ga0501043_0063295 3300049579 Bacteria 2905
183 Ga0501043_0817604 3300049579 Bacteria 673
184 Ga0501043_1269149 3300049579 Bacteria 515
185 Ga0501046_0127887 3300049580 Bacteria 1928
186 Ga0501047_0057775 3300049581 Bacteria 3751
187 Ga0501047_0224102 3300049581 Bacteria 1736
188 Ga0501047_0242399 3300049581 Unclassified 1653
189 Ga0501047_0632161 3300049581 Archaea 890
190 Ga0501048_0038353 3300049582 Bacteria 3437
191 Ga0501048_0077805 3300049582 Bacteria 2341
192 Ga0501067_0002413 3300049583 Bacteria 10330
193 Ga0501069_0070546 3300049585 Bacteria 1957
194 Ga0501070_0009587 3300049586 Bacteria 8179
195 Ga0501070_0028570 3300049586 Bacteria 4678
196 Ga0501070_0921911 3300049586 Bacteria 681
197 Ga0501070_1250840 3300049586 Unclassified 568
198 Ga0501071_0038453 3300049587 Bacteria 3420
199 Ga0501071_0173186 3300049587 Unclassified 1616
200 Ga0501073_0058823 3300049589 Bacteria 2685
201 Ga0501074_0243655 3300049590 Unclassified 1278
202 Ga0501075_0044225 3300049591 Bacteria 3341
203 Ga0501075_0129456 3300049591 Bacteria 1923
204 Ga0501076_0062661 3300049592 Unclassified 2962
205 Ga0501076_0524789 3300049592 Unclassified 976
206 Ga0501077_0408269 3300049593 Unclassified 868
207 Ga0501079_0043585 3300049741 Bacteria 3463
208 Ga0501079_0383893 3300049741 Unclassified 1101
209 Ga0501080_0009051 3300049742 Bacteria 9061
210 Ga0501080_0028638 3300049742 Bacteria 5185
211 Ga0501080_0699044 3300049742 Unclassified 894
212 Ga0501080_0760126 3300049742 Bacteria 852
213 Ga0501080_1288641 3300049742 Unclassified 626
214 Ga0501083_0012906 3300049744 Bacteria 5838
215 Ga0501083_0103657 3300049744 Bacteria 1874
216 Ga0501035_0095212 3300049822 Bacteria 2617
217 Ga0501035_0628514 3300049822 Bacteria 872
218 Ga0501035_0924907 3300049822 Unclassified 689
219 Ga0501044_0003132 3300049823 Bacteria 18736
220 Ga0501044_0009239 3300049823 Bacteria 10766
221 Ga0501044_0035822 3300049823 Bacteria 5195
222 Ga0501044_0040604 3300049823 Bacteria 4848
223 Ga0501044_0185913 3300049823 Bacteria 2043
224 Ga0501044_0368385 3300049823 Bacteria 1353
225 Ga0501044_0427153 3300049823 Archaea 1234
226 Ga0501044_1303546 3300049823 Bacteria 593
227 Ga0501045_0063503 3300049824 Bacteria 2710
228 Ga0501045_0150233 3300049824 Bacteria 1733
229 Ga0501045_0491401 3300049824 Unclassified 911
230 Ga0501045_0899437 3300049824 Unclassified 650
231 nmdc:mga05p37_393530_c1 3300050507 Bacteria 1620
232 nmdc:mga05p37_61720_c1 3300050507 Bacteria 4614
233 nmdc:mga08y16_93365_c1 3300050511 Bacteria 3135
234 nmdc:mga0n895_929572_c1 3300050512 Unclassified 854
235 nmdc:mga0rr50_244646_c1 3300050513 Bacteria 1488
236 nmdc:mga08x19_65626_c1 3300050514 Bacteria 2358
237 Ga0500566_0489029 3300053094 Unclassified 532
238 Ga0500639_322055 3300053163 Bacteria 566
239 Ga0501084_0025473 3300054114 Bacteria 4936
240 Ga0501084_0065267 3300054114 Bacteria 3045
241 Ga0501084_0113726 3300054114 Bacteria 2275
242 Ga0501084_0332855 3300054114 Unclassified 1282
243 Ga0501084_1563448 3300054114 Unclassified 552
244 Ga0587066_050774 3300059490 Bacteria 816
245 Ga0587073_0205602 3300059492 Bacteria 593
246 Ga0587089_015593 3300059509 Unclassified 1004
247 Ga0587090_059110 3300059510 Bacteria 723
248 Ga0587091_012928 3300059511 Bacteria 1331
249 Ga0587098_065393 3300059604 Bacteria 579
250 Ga0587129_022505 3300059608 Bacteria 568
251 Ga0587113_006329 3300059625 Unclassified 1003
252 Ga0587128_005603 3300059630 Bacteria 1509
253 Ga0587067_059510 3300059640 Bacteria 797
254 Ga0587107_018433 3300059652 Unclassified 946
255 Ga0587114_010638 3300059655 Unclassified 1129
256 Ga0501082_0267886 3300060353 Unclassified 1486
257 2616294944 2615840624 Bacteria 6557588
258 Ga0501047_0330160
259 rootH2_10248658
260 rootH1_10152172
261 rootH1_10248646
262 rootH1_10306382
263 Ga0070658_10058918
264 Ga0070683_100237774
265 Ga0070680_100489863
266 Ga0070660_100026077
267 Ga0070687_100353279
268 Ga0070675_101228586
269 Ga0070703_10011920
270 Ga0070714_100031378
271 Ga0070713_100666513
272 Ga0070708_100304196
273 Ga0070708_100785010
274 Ga0070681_10058539
275 Ga0070681_10154335
276 Ga0070681_10168164
277 Ga0070706_100069184
278 Ga0070699_100065144
279 Ga0070679_100000727
280 Ga0070679_100044243
281 Ga0070684_100908610
282 Ga0070684_102055369
283 Ga0070697_100049580
284 Ga0070697_100065086
285 Ga0070697_100461214
286 Ga0068853_100506881
287 Ga0070686_100118087
288 Ga0070696_100014884
289 Ga0070665_100059245
290 Ga0068855_100010813
291 Ga0068855_100020615
292 Ga0068855_100564845
293 Ga0068857_100925266
294 Ga0068854_100231354
295 Ga0068856_100037230
296 Ga0068856_100526065
297 Ga0068852_100000021
298 Ga0068852_100189984
299 Ga0068852_100533718
300 Ga0068861_101173458
301 Ga0068863_101834825
302 Ga0070717_10058051
303 Ga0070712_100484210
304 Ga0075433_10257661
305 Ga0075434_100681465
306 Ga0068865_100378398
307 Ga0075436_100025290
308 Ga0105240_10012314
309 Ga0111539_10083531
310 Ga0105245_11474153
311 Ga0114129_10038210
312 Ga0114129_10382626
313 Ga0105237_10024989
314 Ga0105237_10292039
315 Ga0105237_10637372
316 Ga0105237_12132922
317 Ga0105238_10027816
318 Ga0105238_10051450
319 Ga0105238_10596710
320 Ga0105239_10643723
321 Ga0105239_11260549
322 Ga0105239_11463420
323 Ga0157373_11323637
324 Ga0157371_10136439
325 Ga0157370_10000067
326 Ga0157370_10013909
327 Ga0157369_10011102
328 Ga0157369_10034716
329 Ga0157369_10111657
330 Ga0157369_10372577
331 Ga0157369_11219154
332 Ga0157369_11517989
333 Ga0157369_12265253
334 Ga0157374_10852704
335 Ga0157372_10013430
336 Ga0157372_10070399
337 Ga0157372_10071062
338 Ga0157372_10239801
339 Ga0157372_10306198
340 Ga0157372_10414528
341 Ga0157372_10592608
342 Ga0157379_10003366
343 Ga0209025_1019543
344 Ga0209257_1082497
345 Ga0207705_10407955
346 Ga0207684_10095013
347 Ga0207707_10014491
348 Ga0207695_10036566
349 Ga0207695_10369870
350 Ga0207671_10444045
351 Ga0207657_10030312
352 Ga0207657_10375993
353 Ga0207646_10023292
354 Ga0207694_11429092
355 Ga0207700_11142387
356 Ga0207664_10224775
357 Ga0207690_11849562
358 Ga0207670_11598399
359 Ga0207661_10300027
360 Ga0207667_10027597
361 Ga0207667_10410164
362 Ga0207639_10946062
363 Ga0207702_10134835
364 Ga0207702_10956047
365 Ga0207674_10259615
366 Ga0207674_10684772
367 Ga0207698_10049306
368 Ga0207428_10267748
369 Ga0268266_10060634
370 Ga0307517_10034329
371 Ga0307405_11178272
372 Ga0307413_10949790
373 Ga0307407_10034682
374 Ga0307409_101144110
375 Ga0307416_101033012
376 Ga0307414_10215057
377 Ga0307411_10721823
378 Ga0307415_100439715
379 Ga0373959_0084004
380 Ga0373934_0459535
381 Ga0373931_0049027
382 Ga0373937_0148768
383 Ga0395905_0248147
384 Ga0395905_1864200
385 Ga0451577_0020747
386 Ga0453683_0336897
387 Ga0451576_0000319
388 Ga0495592_0126383
389 Ga0495651_0042845
390 Ga0495651_0068247
391 Ga0495628_0538954
392 Ga0495652_0030807
393 Ga0495645_0002823
394 Ga0495656_0238445
395 Ga0495668_0083338
396 Ga0495599_0626420
397 Ga0495623_0008896
398 Ga0495623_0019730
399 Ga0495646_0069010
400 Ga0495669_0032412
401 Ga0495674_0049201
402 Ga0495675_0196228
403 Ga0495677_0376460
404 Ga0495602_0045460
405 Ga0495602_0236617
406 Ga0496102_1276157
407 Ga0496116_0012906
408 Ga0496116_0044622
409 Ga0496117_0058846
410 Ga0496118_0156598
411 Ga0496119_0077205
412 Ga0496120_0157716
413 Ga0496122_0127805
414 Ga0496123_0052581
415 Ga0496124_0000434
416 Ga0496125_0003034
417 Ga0496126_0148005
418 Ga0501032_0329616
419 Ga0501033_0005076
420 Ga0501033_0013659
421 Ga0501033_0145964
422 Ga0501034_0000429
423 Ga0501034_0041544
424 Ga0501036_0078736
425 Ga0501036_0143460
426 Ga0501036_1096401
427 Ga0501037_0063849
428 Ga0501037_0491580
429 Ga0501038_0019944
430 Ga0501038_0020522
431 Ga0501039_0035809
432 Ga0501040_0218799
433 Ga0501040_0766341
434 Ga0501041_0246775
435 Ga0501041_0940639
436 Ga0501042_0405235
437 Ga0501042_0849720
438 Ga0501043_0021156
439 Ga0501043_0063295
440 Ga0501043_0817604
441 Ga0501043_1269149
442 Ga0501046_0127887
443 Ga0501047_0057775
444 Ga0501047_0224102
445 Ga0501047_0242399
446 Ga0501047_0632161
447 Ga0501048_0038353
448 Ga0501048_0077805
449 Ga0501067_0002413
450 Ga0501069_0070546
451 Ga0501070_0009587
452 Ga0501070_0028570
453 Ga0501070_0921911
454 Ga0501070_1250840
455 Ga0501071_0038453
456 Ga0501071_0173186
457 Ga0501073_0058823
458 Ga0501074_0243655
459 Ga0501075_0044225
460 Ga0501075_0129456
461 Ga0501076_0062661
462 Ga0501076_0524789
463 Ga0501077_0408269
464 Ga0501079_0043585
465 Ga0501079_0383893
466 Ga0501080_0009051
467 Ga0501080_0028638
468 Ga0501080_0699044
469 Ga0501080_0760126
470 Ga0501080_1288641
471 Ga0501083_0012906
472 Ga0501083_0103657
473 Ga0501035_0095212
474 Ga0501035_0628514
475 Ga0501035_0924907
476 Ga0501044_0003132
477 Ga0501044_0009239
478 Ga0501044_0035822
479 Ga0501044_0040604
480 Ga0501044_0185913
481 Ga0501044_0368385
482 Ga0501044_0427153
483 Ga0501044_1303546
484 Ga0501045_0063503
485 Ga0501045_0150233
486 Ga0501045_0491401
487 Ga0501045_0899437
488 nmdc:mga05p37_393530_c1
489 nmdc:mga05p37_61720_c1
490 nmdc:mga08y16_93365_c1
491 nmdc:mga0n895_929572_c1
492 nmdc:mga0rr50_244646_c1
493 nmdc:mga08x19_65626_c1
494 Ga0500566_0489029
495 Ga0500639_322055
496 Ga0501084_0025473
497 Ga0501084_0065267
498 Ga0501084_0113726
499 Ga0501084_0332855
500 Ga0501084_1563448
501 Ga0587066_050774
502 Ga0587073_0205602
503 Ga0587089_015593
504 Ga0587090_059110
505 Ga0587091_012928
506 Ga0587098_065393
507 Ga0587129_022505
508 Ga0587113_006329
509 Ga0587128_005603
510 Ga0587067_059510
511 Ga0587107_018433
512 Ga0587114_010638
513 Ga0501082_0267886
514 2616294944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

3

111

0.98

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

1

129

0.96

PF22751

DUF488-N3a

Active DUF488-N3 subclade

2

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fr8-assembly1.cif.gz_D structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.4873 77 113
8cvm-assembly1.cif.gz_n cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.4608 68 113
5mmm-assembly1.cif.gz_P structure of the 70s chloroplast ribosome 0.4561 71 115
4v4w-assembly1.cif.gz_BM structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.4555 76 113
7pal-assembly1.cif.gz_n 70s ribosome with a- and p-site trnas in mycoplasma pneumoniae cells 0.4545 76 118
ID Description Score Start End Superfamily
af_G5ED36_2031_2223_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4884 48 87 1.25.10.10
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.4828 77 118 3.30.420.100
af_Q6ZPE2_1107_1532_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.4776 9 116 3.90.190.10
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.4764 77 113 3.30.420.100
af_F4I4B6_271_375_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.4613 47 85 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A7V7WUZ4-F1-model_v4 DUF488 family protein 0.9983 1 113
AF-A0A2V9IEJ5-F1-model_v4 DUF488 domain-containing protein 0.9956 1 113
AF-A0A2H5VW72-F1-model_v4 DUF488 domain-containing protein 0.9943 2 113
AF-A0A7C2S619-F1-model_v4 DUF488 domain-containing protein 0.9925 2 113
AF-A0A1S5XZZ7-F1-model_v4 DUF488 domain-containing protein 0.992 2 113

Map