F367541

General Info

Members Datasets Scaffolds Average Seq Length
257 234 514 305

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0135645|Ga0495606_0135645_440_1429
Length 329
Sequence LFQRILLRRVIKNKGKTNWEYRMAFLFNSDAERARIFAAEFKRELPQLPFLTDPQTVDPADVRYLLTWTVPPDMARYRNLEVLFSIGAGVDQFSTGTLPDTVKLVRMVEDGIVRMMQEYVTLAVLSLHRDLPGYLDQQRQGVWKTRAVRQAAERRVGVLGLGMLGQAVLERLKPFGFPLSGWSRSRREIAGVACLHGEAQLDDFLAGTDILICLLPLTAQTRGFLNAGLFSRLPAGASLVHAGRGPQLDQHDLIEALDSGHLAGAVLDVSDPEPLPADHMLWRHPKVVLTPHIASVTQAETAAKAVIANILRHEAGQEPIGLVDRTLGY

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
17 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
38 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
50 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
51 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
52 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
58 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
59 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
60 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
61 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
62 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
63 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
68 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
69 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
70 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
71 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
72 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
73 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
74 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
75 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
76 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
77 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
78 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
79 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
80 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
81 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
82 2512875024
83 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
84 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
85 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
86 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
87 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
88 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
89 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
90 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
91 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
92 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
95 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
96 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
97 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
98 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
99 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
100 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
103 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
104 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
105 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
106 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
107 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
108 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
109 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
110 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
111 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
112 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
113 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
114 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
115 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
116 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
117 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
118 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
119 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
120 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
121 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
122 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
123 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
124 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
125 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
126 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
127 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
128 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
129 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
130 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
131 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
132 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
133 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
134 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
135 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
136 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
137 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
138 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
139 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
140 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
141 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
142 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
143 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
144 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
145 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
146 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
147 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
148 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
149 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
150 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
151 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
152 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
153 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
154 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
155 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
156 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
157 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
158 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
159 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
160 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
161 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
162 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
163 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
164 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
165 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
166 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
167 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
168 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
169 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
170 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
171 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
172 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
173 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
174 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
175 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
176 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
177 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
178 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
179 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
180 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
181 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
182 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
183 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
184 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
185 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
186 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
187 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
188 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
189 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
190 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
191 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
192 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
193 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
194 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
195 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
196 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
197 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
198 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
199 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
200 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
201 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
202 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
203 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
204 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
205 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
206 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
207 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
208 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
209 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
210 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
211 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
212 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
213 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
214 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
215 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
216 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
217 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
218 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
219 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
220 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
221 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
222 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
223 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
224 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
225 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
226 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
227 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
228 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
229 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
230 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
231 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
232 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
233 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
234 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.35
Metatranscriptomes 0
Isolates 62.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 50.97
Rhizoplane 2.33
Rhizosphere 23.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0135645 3300046507 Bacteria 1458
2 JGI24739J22299_10015926 3300001989 Bacteria 2728
3 JGI25165J46597_1000372 3300003214 Bacteria 50057
4 JGI25165J46597_1002548 3300003214 Bacteria 5681
5 rootH1_10220397 3300003323 Bacteria 4213
6 Ga0070658_10317160 3300005327 Bacteria 1331
7 Ga0068853_100011249 3300005539 Bacteria 7263
8 Ga0070665_100049661 3300005548 Bacteria 4209
9 Ga0068855_100124326 3300005563 Bacteria 2951
10 Ga0068856_100456556 3300005614 Bacteria 1298
11 Ga0075365_10003493 3300006038 Bacteria 8117
12 Ga0075365_10035479 3300006038 Bacteria 3227
13 Ga0075367_10053422 3300006178 Bacteria 2394
14 Ga0075369_10002030 3300006186 Bacteria 7132
15 Ga0099795_10014981 3300007788 Bacteria 2417
16 Ga0105240_10050403 3300009093 Bacteria 5249
17 Ga0105237_10018848 3300009545 Bacteria 7138
18 Ga0105237_10029482 3300009545 Bacteria 5578
19 Ga0105237_10051943 3300009545 Bacteria 4117
20 Ga0123340_1053851 3300009763 Bacteria 1365
21 Ga0123341_1019227 3300009765 Bacteria 5887
22 Ga0105239_10004483 3300010375 Bacteria 16667
23 Ga0105239_10066942 3300010375 Bacteria 3946
24 Ga0105239_10092330 3300010375 Bacteria 3342
25 Ga0105239_10200563 3300010375 Bacteria 2235
26 Ga0157370_10001439 3300013104 Bacteria 29445
27 Ga0157369_10051904 3300013105 Bacteria 4437
28 Ga0157369_10138303 3300013105 Bacteria 2578
29 Ga0182008_10013129 3300014497 Bacteria 4356
30 Ga0182007_10000324 3300015262 Bacteria 30329
31 Ga0182007_10071036 3300015262 Bacteria 1140
32 Ga0209437_108506 3300025233 Bacteria 1639
33 Ga0209233_1000324 3300025261 Bacteria 51086
34 Ga0209233_1000330 3300025261 Bacteria 48662
35 Ga0207647_10102661 3300025904 Bacteria 1696
36 Ga0207705_10104044 3300025909 Bacteria 2091
37 Ga0207671_10002148 3300025914 Bacteria 21513
38 Ga0207671_10034144 3300025914 Bacteria 3781
39 Ga0207694_10012678 3300025924 Bacteria 6351
40 Ga0207669_10072423 3300025937 Bacteria 2170
41 Ga0207667_10101759 3300025949 Bacteria 2964
42 Ga0207639_10016642 3300026041 Bacteria 5207
43 Ga0207639_10066740 3300026041 Bacteria 2797
44 Ga0207702_10537336 3300026078 Bacteria 1142
45 Ga0207698_10020097 3300026142 Bacteria 4590
46 Ga0209371_1002566 3300027312 Bacteria 10023
47 Ga0268266_10186205 3300028379 Bacteria 1893
48 Ga0307515_10018607 3300028794 Bacteria 12551
49 Ga0268256_1002446 3300030500 Bacteria 9465
50 Ga0307511_10041879 3300030521 Bacteria 3858
51 Ga0307408_100014552 3300031548 Bacteria 5227
52 Ga0307508_10076133 3300031616 Bacteria 2932
53 Ga0307405_10045860 3300031731 Bacteria 2681
54 Ga0373935_0035245 3300035692 Bacteria 3123
55 Ga0373935_0097135 3300035692 Bacteria 1937
56 Ga0373927_0059955 3300035695 Bacteria 2461
57 Ga0373925_0003491 3300037068 Bacteria 12149
58 Ga0395898_0300198 3300037466 Bacteria 1532
59 Ga0395905_0080290 3300037471 Bacteria 3057
60 Ga0395905_0148187 3300037471 Bacteria 2208
61 Ga0395901_0037605 3300038443 Bacteria 5006
62 Ga0495629_0007628 3300046459 Bacteria 7966
63 Ga0495583_0001961 3300046506 Bacteria 18902
64 Ga0495654_0000251 3300046530 Bacteria 49575
65 Ga0495657_0017412 3300046675 Bacteria 5219
66 Ga0495604_0027236 3300047317 Bacteria 4547
67 Ga0496102_0028679 3300048905 Bacteria 4973
68 Ga0496103_0028041 3300048906 Bacteria 3415
69 Ga0496112_0273124 3300048915 Bacteria 1638
70 Ga0496113_0012428 3300048916 Bacteria 5721
71 Ga0496116_0052164 3300048919 Bacteria 2711
72 Ga0496117_0002753 3300048920 Bacteria 21547
73 Ga0496118_0001953 3300048921 Bacteria 29213
74 Ga0496118_0008224 3300048921 Bacteria 10826
75 Ga0496119_0019550 3300048922 Bacteria 4982
76 Ga0496120_0039359 3300048923 Bacteria 2789
77 Ga0496121_0021560 3300048924 Bacteria 6303
78 Ga0496122_0003859 3300048925 Bacteria 19238
79 Ga0496122_0016456 3300048925 Bacteria 6994
80 Ga0496123_0019980 3300048926 Bacteria 5257
81 Ga0496125_0021688 3300048928 Bacteria 5980
82 Ga0496125_0044833 3300048928 Bacteria 3732
83 Ga0501035_0000381 3300049822 Bacteria 50879
84 nmdc:mga03n38_29085_c1 3300050490 Bacteria 2309
85 nmdc:mga00v17_92194_c1 3300050491 Bacteria 1904
86 nmdc:mga0yw44_46083_c1 3300050492 Bacteria 2617
87 nmdc:mga0yw44_9402_c1 3300050492 Bacteria 4940
88 nmdc:mga06z11_22507_c1 3300050494 Bacteria 2945
89 nmdc:mga0sz30_12070_c1 3300050516 Bacteria 2947
90 Ga0495619_0024223 3300053085 Bacteria 3893
91 Ga0500572_006064 3300053111 Bacteria 2757
92 Ga0500618_000605 3300053125 Bacteria 22012
93 Ga0500590_000115 3300053148 Bacteria 21632
94 Ga0500636_0000001 3300053177 Bacteria 324086
95 Ga0500636_0000588 3300053177 Bacteria 19928
96 Ga0500636_0095450 3300053177 Bacteria 1697
97 2503200948 2503198000 Bacteria 6884444
98 2509110606 2508501122 Bacteria 6292184
99 2509118387 2508501123 Bacteria 6283661
100 2510841883 2510461069 Bacteria 5505000
101 2512929149 2512875016 Bacteria 6529530
102 2512963947 2512875024 Bacteria 7195110
103 2513611570 2513237090 Bacteria 7096802
104 2513867656 2513237138 Bacteria 7368160
105 2513883189 2513237140 Bacteria 7076289
106 2513904247 2513237143 Bacteria 6664116
107 2513929304 2513237146 Bacteria 7166346
108 2514035824 2513237164 Bacteria 7563725
109 2585232674 2582581299 Bacteria 6518058
110 2585281219 2582581308 Bacteria 7413247
111 2585396250 2582581866 Bacteria 6859583
112 2585403813 2582581867 Bacteria 7184437
113 2585536121 2585427527 Bacteria 7273426
114 2585557606 2585427530 Bacteria 7383882
115 2585823305 2585427590 Bacteria 6824633
116 2599419297 2599185170 Bacteria 7295545
117 2599940088 2599185301 Bacteria 6161860
118 2600197389 2599185352 Bacteria 7228948
119 2616310979 2615840626 Bacteria 7921970
120 2616555581 2615840698 Bacteria 7319877
121 2643810636 2643221558 Bacteria 5460675
122 2657686225 2657244999 Bacteria 5946535
123 2692318323 2690316117 Bacteria 6800650
124 2753462787 2751185821 Bacteria 6189929
125 2792583740 2791355082 Bacteria 5973319
126 2804755078 2802429268 Bacteria 6094027
127 2819641755 2818991453 Bacteria 7181617
128 2838040170 2838035591 Bacteria 7166484
129 2838665901 2838661181 Bacteria 7385261
130 2847423175 2847417321 Bacteria 6913799
131 2847674879 2847670302 Bacteria 6165597
132 2847688699 2847686936 Bacteria 6278406
133 2854902262 2854896431 Bacteria 5869725
134 2855845749 2855839649 Bacteria 7135830
135 2856317237 2856314179 Bacteria 6477897
136 2856354413 2856349417 Bacteria 6230045
137 2856360844 2856356410 Bacteria 6297484
138 2856366191 2856364286 Bacteria 6939991
139 2857350031 2857349434 Bacteria 7926032
140 2857354398 2857349434 Bacteria 7926032
141 2869163902 2869162929 Bacteria 6399702
142 2869257474 2869256925 Bacteria 6981691
143 2869287225 2869285874 Bacteria 6901219
144 2871430525 2871429161 Bacteria 6547891
145 2871441699 2871435913 Bacteria 6880295
146 2871446759 2871444079 Bacteria 6423508
147 2871489481 2871488783 Bacteria 6929816
148 2871496309 2871495908 Bacteria 6935695
149 2874103456 2874102143 Bacteria 6342645
150 2874149198 2874146452 Bacteria 7533118
151 2874156017 2874155637 Bacteria 6724144
152 2876367293 2876363079 Bacteria 6544991
153 2876415379 2876413966 Bacteria 6831344
154 2878038275 2878035449 Bacteria 6555736
155 2878742322 2878738818 Bacteria 7136951
156 2878746957 2878745973 Bacteria 6867388
157 2878754114 2878753008 Bacteria 6922523
158 2878760538 2878760144 Bacteria 6823465
159 2878767501 2878767105 Bacteria 6898628
160 2881161519 2881155292 Bacteria 6461656
161 2881846721 2881845957 Bacteria 6611900
162 2881859990 2881853255 Bacteria 6698367
163 2881862771 2881861095 Bacteria 7128710
164 2882917119 2882912400 Bacteria 6801539
165 2885305837 2885305155 Bacteria 7348390
166 2885327330 2885326080 Bacteria 7134805
167 2885340330 2885334103 Bacteria 7216818
168 2885348899 2885342637 Bacteria 7011821
169 2885357816 2885350715 Bacteria 6787678
170 2888338843 2888337043 Bacteria 6629336
171 2889020780 2889016732 Bacteria 6700763
172 2894821745 2894817345 Bacteria 4892941
173 2903453237 2903448605 Bacteria 7357801
174 2903494583 2903492973 Bacteria 13473544
175 2903500526 2903492973 Bacteria 13473544
176 2903526784 2903521522 Bacteria 6525694
177 2903530597 2903528002 Bacteria 6586099
178 2903541103 2903540706 Bacteria 7062119
179 2906309771 2906308376 Bacteria 6841989
180 2906322406 2906321335 Bacteria 6579571
181 2906331860 2906328253 Bacteria 6585166
182 2906417299 2906414383 Bacteria 6580790
183 2922163064 2922158528 Bacteria 6573167
184 2924710196 2924710171 Bacteria 6752351
185 2924729560 2924726620 Bacteria 6271473
186 2924780122 2924776078 Bacteria 7492003
187 2924788808 2924784321 Bacteria 7416538
188 2937814932 2937813078 Bacteria 7783518
189 2937848793 2937848649 Bacteria 6983481
190 2937882642 2937877337 Bacteria 7246526
191 2937891531 2937891427 Bacteria 6357007
192 2937994956 2937994558 Bacteria 7036190
193 2957390208 2957388812 Bacteria 6778072
194 2957420478 2957415311 Bacteria 6991633
195 2957445375 2957443900 Bacteria 6869977
196 2958053370 2958041894 Bacteria 13082850
197 2958064864 2958064165 Bacteria 7158582
198 2958089767 2958084443 Bacteria 7312792
199 2958094026 2958092219 Bacteria 6861151
200 2958121525 2958115193 Bacteria 6923548
201 2958131725 2958130278 Bacteria 6897202
202 2958152105 2958144490 Bacteria 6677056
203 2958165436 2958165035 Bacteria 6906348
204 2958180785 2958179912 Bacteria 6874908
205 2960619154 2960617483 Bacteria 6727748
206 2960662080 2960660292 Bacteria 7041660
207 2961078623 2961077736 Bacteria 7079850
208 2961132279 2961127735 Bacteria 7196641
209 2961163894 2961163497 Bacteria 6901077
210 2961171746 2961170736 Bacteria 7072258
211 2963650086 2963644680 Bacteria 6530403
212 2964634175 2964628898 Bacteria 7083044
213 2964672964 2964670856 Bacteria 6851364
214 2965018699 2965018300 Bacteria 6883036
215 2965062820 2965062239 Bacteria 7412989
216 2967739747 2967735183 Bacteria 6827012
217 2967996549 2967996073 Bacteria 6787468
218 2968010240 2968003550 Bacteria 6929263
219 2968086603 2968083720 Bacteria 7351627
220 2968095346 2968091066 Bacteria 6052692
221 2968103078 2968097103 Bacteria 6107094
222 2968128537 2968128360 Bacteria 6270294
223 2968172300 2968171901 Bacteria 6894245
224 2970504342 2970503327 Bacteria 7099517
225 2970555390 2970554993 Bacteria 6814252
226 2977525257 2977523885 Bacteria 6960446
227 2977823329 2977821940 Bacteria 6906439
228 2977830399 2977828996 Bacteria 7007971
229 2977845608 2977843712 Bacteria 6753583
230 2977862569 2977858184 Bacteria 6215359
231 2977899429 2977898635 Bacteria 6675551
232 2977928372 2977922695 Bacteria 6956781
233 2979783914 2979779861 Bacteria 6219781
234 2979808979 2979808191 Bacteria 7179355
235 2987637130 2987636660 Bacteria 8088555
236 2987642193 2987636660 Bacteria 8088555
237 2987659906 2987659509 Bacteria 6966464
238 2996345373 2996341866 Bacteria 6643098
239 2996393816 2996386984 Bacteria 6978667
240 3000140985 3000135777 Bacteria 6891109
241 3004188953 3004188549 Bacteria 6952365
242 3004204099 3004203850 Bacteria 7307914
243 3004215621 3004211236 Bacteria 7417683
244 3004222075 3004218560 Bacteria 7421728
245 3004335156 3004334049 Bacteria 8449246
246 637078910 637000159 Bacteria 7596297
247 643600614 643348564 Bacteria 8839022
248 643822500 643692032 Bacteria 6891900
249 8004318434 8004312739 Bacteria 7444653
250 8004375690 8004374579 Bacteria 6898112
251 8004389062 8004387939 Bacteria 7049250
252 8004451946 8004445564 Bacteria 6322258
253 8004713258 8004703790 Bacteria 8006957
254 8004716125 8004714634 Bacteria 6776161
255 8005686036 8005682033 Bacteria 6726518
256 8024493041 8024486573 Bacteria 6540512
257 8049298113 8049293176 Bacteria 6128433
258 Ga0495606_0135645
259 JGI24739J22299_10015926
260 JGI25165J46597_1000372
261 JGI25165J46597_1002548
262 rootH1_10220397
263 Ga0070658_10317160
264 Ga0068853_100011249
265 Ga0070665_100049661
266 Ga0068855_100124326
267 Ga0068856_100456556
268 Ga0075365_10003493
269 Ga0075365_10035479
270 Ga0075367_10053422
271 Ga0075369_10002030
272 Ga0099795_10014981
273 Ga0105240_10050403
274 Ga0105237_10018848
275 Ga0105237_10029482
276 Ga0105237_10051943
277 Ga0123340_1053851
278 Ga0123341_1019227
279 Ga0105239_10004483
280 Ga0105239_10066942
281 Ga0105239_10092330
282 Ga0105239_10200563
283 Ga0157370_10001439
284 Ga0157369_10051904
285 Ga0157369_10138303
286 Ga0182008_10013129
287 Ga0182007_10000324
288 Ga0182007_10071036
289 Ga0209437_108506
290 Ga0209233_1000324
291 Ga0209233_1000330
292 Ga0207647_10102661
293 Ga0207705_10104044
294 Ga0207671_10002148
295 Ga0207671_10034144
296 Ga0207694_10012678
297 Ga0207669_10072423
298 Ga0207667_10101759
299 Ga0207639_10016642
300 Ga0207639_10066740
301 Ga0207702_10537336
302 Ga0207698_10020097
303 Ga0209371_1002566
304 Ga0268266_10186205
305 Ga0307515_10018607
306 Ga0268256_1002446
307 Ga0307511_10041879
308 Ga0307408_100014552
309 Ga0307508_10076133
310 Ga0307405_10045860
311 Ga0373935_0035245
312 Ga0373935_0097135
313 Ga0373927_0059955
314 Ga0373925_0003491
315 Ga0395898_0300198
316 Ga0395905_0080290
317 Ga0395905_0148187
318 Ga0395901_0037605
319 Ga0495629_0007628
320 Ga0495583_0001961
321 Ga0495654_0000251
322 Ga0495657_0017412
323 Ga0495604_0027236
324 Ga0496102_0028679
325 Ga0496103_0028041
326 Ga0496112_0273124
327 Ga0496113_0012428
328 Ga0496116_0052164
329 Ga0496117_0002753
330 Ga0496118_0001953
331 Ga0496118_0008224
332 Ga0496119_0019550
333 Ga0496120_0039359
334 Ga0496121_0021560
335 Ga0496122_0003859
336 Ga0496122_0016456
337 Ga0496123_0019980
338 Ga0496125_0021688
339 Ga0496125_0044833
340 Ga0501035_0000381
341 nmdc:mga03n38_29085_c1
342 nmdc:mga00v17_92194_c1
343 nmdc:mga0yw44_46083_c1
344 nmdc:mga0yw44_9402_c1
345 nmdc:mga06z11_22507_c1
346 nmdc:mga0sz30_12070_c1
347 Ga0495619_0024223
348 Ga0500572_006064
349 Ga0500618_000605
350 Ga0500590_000115
351 Ga0500636_0000001
352 Ga0500636_0000588
353 Ga0500636_0095450
354 2503200948
355 2509110606
356 2509118387
357 2510841883
358 2512929149
359 2512963947
360 2513611570
361 2513867656
362 2513883189
363 2513904247
364 2513929304
365 2514035824
366 2585232674
367 2585281219
368 2585396250
369 2585403813
370 2585536121
371 2585557606
372 2585823305
373 2599419297
374 2599940088
375 2600197389
376 2616310979
377 2616555581
378 2643810636
379 2657686225
380 2692318323
381 2753462787
382 2792583740
383 2804755078
384 2819641755
385 2838040170
386 2838665901
387 2847423175
388 2847674879
389 2847688699
390 2854902262
391 2855845749
392 2856317237
393 2856354413
394 2856360844
395 2856366191
396 2857350031
397 2857354398
398 2869163902
399 2869257474
400 2869287225
401 2871430525
402 2871441699
403 2871446759
404 2871489481
405 2871496309
406 2874103456
407 2874149198
408 2874156017
409 2876367293
410 2876415379
411 2878038275
412 2878742322
413 2878746957
414 2878754114
415 2878760538
416 2878767501
417 2881161519
418 2881846721
419 2881859990
420 2881862771
421 2882917119
422 2885305837
423 2885327330
424 2885340330
425 2885348899
426 2885357816
427 2888338843
428 2889020780
429 2894821745
430 2903453237
431 2903494583
432 2903500526
433 2903526784
434 2903530597
435 2903541103
436 2906309771
437 2906322406
438 2906331860
439 2906417299
440 2922163064
441 2924710196
442 2924729560
443 2924780122
444 2924788808
445 2937814932
446 2937848793
447 2937882642
448 2937891531
449 2937994956
450 2957390208
451 2957420478
452 2957445375
453 2958053370
454 2958064864
455 2958089767
456 2958094026
457 2958121525
458 2958131725
459 2958152105
460 2958165436
461 2958180785
462 2960619154
463 2960662080
464 2961078623
465 2961132279
466 2961163894
467 2961171746
468 2963650086
469 2964634175
470 2964672964
471 2965018699
472 2965062820
473 2967739747
474 2967996549
475 2968010240
476 2968086603
477 2968095346
478 2968103078
479 2968128537
480 2968172300
481 2970504342
482 2970555390
483 2977525257
484 2977823329
485 2977830399
486 2977845608
487 2977862569
488 2977899429
489 2977928372
490 2979783914
491 2979808979
492 2987637130
493 2987642193
494 2987659906
495 2996345373
496 2996393816
497 3000140985
498 3004188953
499 3004204099
500 3004215621
501 3004222075
502 3004335156
503 637078910
504 643600614
505 643822500
506 8004318434
507 8004375690
508 8004389062
509 8004451946
510 8004713258
511 8004716125
512 8005686036
513 8024493041
514 8049298113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

121

294

0.95

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

155

265

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vg6-assembly5.cif.gz_G crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with nadph and mes. 0.9282 66 307
5vg6-assembly5.cif.gz_G crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with nadph and mes. 0.9246 66 307
5vg6-assembly2.cif.gz_B crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with nadph and mes. 0.9233 2 307
6oxn-assembly1.cif.gz_A-2 2.6 angstrom structure of w45f/h46s glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with glyoxylate and nadp 0.9196 1 307
5vg6-assembly2.cif.gz_B crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with nadph and mes. 0.9176 2 307
ID Description Score Start End Superfamily
4n18A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9659 94 271 3.40.50.720
5vg6D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 92 272 3.40.50.720
4n18A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 94 271 3.40.50.720
af_P75913_105_277_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9438 102 271 3.30.420.40
5vg6D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 92 272 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527GGF5-F1-model_v4 Glyoxylate/hydroxypyruvate reductase A 0.969 130 207 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A5R2MZB9-F1-model_v4 Glyoxylate/hydroxypyruvate reductase A 0.9576 1 101
AF-A0A531K9N1-F1-model_v4 deleted 0.9562 35 220
AF-A0A531K9N1-F1-model_v4 deleted 0.9513 35 220
AF-A0A0P9R1N3-F1-model_v4 D-3-phosphoglycerate dehydrogenase 0.9486 44 307 GO:0016491
GO:0051287

Map