F367523

General Info

Members Datasets Scaffolds Average Seq Length
257 195 514 258

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0015404|Ga0495590_0015404_1115_1990
Length 291
Sequence MATVRTDRGGAMDVPRILIKQQADNRRPRRQTMSLAKLQDLHGRVALVTGGSRGLGLQMAEVLGELGARVAITARKANELADAKAHLASMGIEALPVVCDMGDLSTIPTMVEQVVNAFGPIDILVNNAGTSWGAATTEHTLDAWNKVMTLNVSAIFVASQEVGRRCMVPRRKGKVINIASVQGLSGGYPEGTPTIAYNASKGAVVNMTRMLAKEWAAYDINVNAIAPGYFETKMTKYIMENQHDATANLAPLKRTGGPEDLKGVTALLASDACAFITGQTIAVDGGLTAVF

Samples

Sample ID Description Type Environment
1 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
101 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
190 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
191 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
192 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
193 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
194 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
195 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0.78
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.56
Rhizoplane 7
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495590_0015404 3300046457 Bacteria 2775
2 Ga0070658_10010766 3300005327 Bacteria 7332
3 Ga0070676_10157505 3300005328 Bacteria 1459
4 Ga0070670_100042745 3300005331 Bacteria 3896
5 Ga0070677_10042266 3300005333 Bacteria 1804
6 Ga0070680_100010047 3300005336 Bacteria 7291
7 Ga0070680_100052863 3300005336 Bacteria 3315
8 Ga0070668_100400982 3300005347 Bacteria 1171
9 Ga0070675_100028777 3300005354 Bacteria 4475
10 Ga0070671_100032742 3300005355 Bacteria 4296
11 Ga0070659_100093655 3300005366 Bacteria 2411
12 Ga0070709_10021055 3300005434 Bacteria 3795
13 Ga0070709_10379196 3300005434 Bacteria 1051
14 Ga0070714_100250033 3300005435 Bacteria 1639
15 Ga0070713_100295423 3300005436 Bacteria 1490
16 Ga0070710_10013825 3300005437 Bacteria 4051
17 Ga0070710_10172438 3300005437 Bacteria 1349
18 Ga0070711_100009606 3300005439 Bacteria 5962
19 Ga0070711_100153509 3300005439 Bacteria 1739
20 Ga0070705_100008030 3300005440 Bacteria 5217
21 Ga0070694_100018420 3300005444 Bacteria 4431
22 Ga0070708_100049773 3300005445 Bacteria 3708
23 Ga0070663_100741396 3300005455 Bacteria 838
24 Ga0070681_10002769 3300005458 Bacteria 16183
25 Ga0070707_100304988 3300005468 Bacteria 1547
26 Ga0070698_100064755 3300005471 Bacteria 3682
27 Ga0070679_100015644 3300005530 Bacteria 7292
28 Ga0070672_100003143 3300005543 Bacteria 10667
29 Ga0070695_100018622 3300005545 Bacteria 4217
30 Ga0070696_100145637 3300005546 Bacteria 1735
31 Ga0070665_100020613 3300005548 Bacteria 6624
32 Ga0070665_100186706 3300005548 Bacteria 2074
33 Ga0070704_100002202 3300005549 Bacteria 10863
34 Ga0068855_100017402 3300005563 Bacteria 8648
35 Ga0068855_100051082 3300005563 Bacteria 4870
36 Ga0068855_100072795 3300005563 Bacteria 3994
37 Ga0068857_100699176 3300005577 Bacteria 963
38 Ga0068854_100210806 3300005578 Bacteria 1532
39 Ga0068854_100471878 3300005578 Bacteria 1052
40 Ga0068854_100485289 3300005578 Bacteria 1038
41 Ga0068856_100008813 3300005614 Bacteria 9818
42 Ga0068856_100073434 3300005614 Bacteria 3387
43 Ga0068852_100521081 3300005616 Bacteria 1186
44 Ga0068859_100152830 3300005617 Bacteria 2384
45 Ga0068864_100029607 3300005618 Bacteria 4639
46 Ga0068864_100049888 3300005618 Bacteria 3601
47 Ga0068851_10035738 3300005834 Bacteria 2485
48 Ga0068863_100166739 3300005841 Bacteria 2112
49 Ga0081540_1000507 3300005983 Bacteria 38259
50 Ga0081539_10101420 3300005985 Bacteria 1466
51 Ga0070715_10004847 3300006163 Bacteria 4455
52 Ga0070716_100097235 3300006173 Bacteria 1796
53 Ga0070716_100133147 3300006173 Bacteria 1574
54 Ga0070712_100019712 3300006175 Bacteria 4404
55 Ga0097621_100043245 3300006237 Bacteria 3631
56 Ga0068871_100162803 3300006358 Bacteria 1909
57 Ga0075431_100104604 3300006847 Bacteria 2921
58 Ga0075434_100124707 3300006871 Bacteria 2593
59 Ga0068865_100545596 3300006881 Bacteria 973
60 Ga0097620_100152832 3300006931 Bacteria 2384
61 Ga0105240_10186251 3300009093 Bacteria 2445
62 Ga0114129_10011627 3300009147 Bacteria 12531
63 Ga0114129_10078362 3300009147 Bacteria 4596
64 Ga0114129_10610819 3300009147 Bacteria 1412
65 Ga0105242_10313048 3300009176 Bacteria 1437
66 Ga0105242_10708372 3300009176 Bacteria 986
67 Ga0105248_10002744 3300009177 Bacteria 19558
68 Ga0105237_10171689 3300009545 Bacteria 2168
69 Ga0105249_10053846 3300009553 Bacteria 3678
70 Ga0105249_10143918 3300009553 Bacteria 2289
71 Ga0105246_10150124 3300011119 Bacteria 1763
72 Ga0157370_10005538 3300013104 Bacteria 14158
73 Ga0157370_10377568 3300013104 Bacteria 1306
74 Ga0157369_10056282 3300013105 Bacteria 4244
75 Ga0163162_10043703 3300013306 Bacteria 4486
76 Ga0163162_10437280 3300013306 Bacteria 1440
77 Ga0157372_10002118 3300013307 Bacteria 21583
78 Ga0157375_10030758 3300013308 Bacteria 5067
79 Ga0157375_10055966 3300013308 Bacteria 3891
80 Ga0163163_10055154 3300014325 Bacteria 3928
81 Ga0157379_10061945 3300014968 Bacteria 3346
82 Ga0157379_10071714 3300014968 Bacteria 3098
83 Ga0157379_10143239 3300014968 Bacteria 2155
84 Ga0157376_10013097 3300014969 Bacteria 6177
85 Ga0157376_10260234 3300014969 Bacteria 1625
86 Ga0157376_10337209 3300014969 Bacteria 1439
87 Ga0163161_10113568 3300017792 Bacteria 2027
88 Ga0207682_10050447 3300025893 Bacteria 1720
89 Ga0207692_10104104 3300025898 Bacteria 1563
90 Ga0207642_10150342 3300025899 Bacteria 1238
91 Ga0207685_10004546 3300025905 Bacteria 3545
92 Ga0207699_10071890 3300025906 Bacteria 2117
93 Ga0207643_10137508 3300025908 Bacteria 1457
94 Ga0207654_10253987 3300025911 Bacteria 1179
95 Ga0207707_10008590 3300025912 Bacteria 8855
96 Ga0207671_10196173 3300025914 Bacteria 1575
97 Ga0207693_10006258 3300025915 Bacteria 9873
98 Ga0207693_10014249 3300025915 Bacteria 6395
99 Ga0207663_10008360 3300025916 Bacteria 5407
100 Ga0207663_10104056 3300025916 Bacteria 1913
101 Ga0207663_10147178 3300025916 Bacteria 1648
102 Ga0207660_10022162 3300025917 Bacteria 4278
103 Ga0207652_10314183 3300025921 Bacteria 1414
104 Ga0207650_10005655 3300025925 Bacteria 8537
105 Ga0207700_10059254 3300025928 Bacteria 2895
106 Ga0207700_10161901 3300025928 Bacteria 1859
107 Ga0207664_10036247 3300025929 Bacteria 3812
108 Ga0207664_10618524 3300025929 Bacteria 973
109 Ga0207644_10035956 3300025931 Bacteria 3474
110 Ga0207644_10115453 3300025931 Bacteria 2036
111 Ga0207690_10362820 3300025932 Bacteria 1148
112 Ga0207665_10020430 3300025939 Bacteria 4352
113 Ga0207665_10022798 3300025939 Bacteria 4121
114 Ga0207665_10116805 3300025939 Bacteria 1881
115 Ga0207691_10001131 3300025940 Bacteria 26484
116 Ga0207711_10017357 3300025941 Bacteria 5979
117 Ga0207679_10053581 3300025945 Bacteria 2966
118 Ga0207667_10019195 3300025949 Bacteria 7645
119 Ga0207667_10043969 3300025949 Bacteria 4737
120 Ga0207667_10202324 3300025949 Bacteria 2037
121 Ga0207712_10300881 3300025961 Bacteria 1316
122 Ga0207712_10389993 3300025961 Bacteria 1168
123 Ga0207668_10218265 3300025972 Bacteria 1530
124 Ga0207640_10135056 3300025981 Bacteria 1789
125 Ga0207677_10373517 3300026023 Bacteria 1201
126 Ga0207639_10262936 3300026041 Bacteria 1510
127 Ga0207678_10137309 3300026067 Bacteria 2086
128 Ga0207678_10415123 3300026067 Bacteria 1167
129 Ga0207702_10002619 3300026078 Bacteria 16908
130 Ga0207702_10053799 3300026078 Bacteria 3409
131 Ga0207641_10012301 3300026088 Bacteria 7022
132 Ga0207641_10108163 3300026088 Bacteria 2461
133 Ga0207648_10314570 3300026089 Bacteria 1406
134 Ga0207676_10044041 3300026095 Bacteria 3441
135 Ga0207676_10078803 3300026095 Bacteria 2669
136 Ga0207674_10713998 3300026116 Bacteria 968
137 Ga0207698_10174580 3300026142 Bacteria 1896
138 Ga0265356_1001524 3300028017 Bacteria 3382
139 Ga0265355_1004271 3300028036 Bacteria 1074
140 Ga0268266_10028368 3300028379 Bacteria 4758
141 Ga0268266_10315057 3300028379 Bacteria 1463
142 Ga0268264_10000816 3300028381 Bacteria 33573
143 Ga0307515_10000041 3300028794 Bacteria 319110
144 Ga0307515_10000873 3300028794 Bacteria 69237
145 Ga0307515_10006527 3300028794 Bacteria 23330
146 Ga0307515_10020414 3300028794 Bacteria 11820
147 Ga0307515_10102360 3300028794 Bacteria 3446
148 Ga0265770_1000590 3300030878 Bacteria 5014
149 Ga0265760_10001920 3300031090 Bacteria 6098
150 Ga0307513_10001868 3300031456 Bacteria 29930
151 Ga0307513_10075221 3300031456 Bacteria 3508
152 Ga0307509_10018112 3300031507 Bacteria 8084
153 Ga0307508_10000540 3300031616 Bacteria 44861
154 Ga0307516_10000350 3300031730 Bacteria 59867
155 Ga0307405_10007579 3300031731 Bacteria 5441
156 Ga0307410_10004555 3300031852 Bacteria 7186
157 Ga0307406_10003804 3300031901 Bacteria 8218
158 Ga0307412_10008646 3300031911 Bacteria 5821
159 Ga0307409_100009444 3300031995 Bacteria 5992
160 Ga0307415_100016364 3300032126 Bacteria 4419
161 Ga0307507_10105295 3300033179 Bacteria 2336
162 Ga0307510_10205235 3300033180 Bacteria 1499
163 Ga0373926_0101193 3300035083 Bacteria 1078
164 Ga0395905_0001976 3300037471 Bacteria 23436
165 Ga0395901_0143036 3300038443 Bacteria 2514
166 Ga0495605_0025616 3300046474 Bacteria 3073
167 Ga0495664_0088760 3300046477 Bacteria 1858
168 Ga0495608_0009857 3300046511 Bacteria 6669
169 Ga0495630_0039502 3300046517 Bacteria 3528
170 Ga0495632_0001652 3300046519 Bacteria 18276
171 Ga0495621_0007268 3300046539 Bacteria 3273
172 Ga0495621_0096305 3300046539 Bacteria 1121
173 Ga0495645_0259679 3300046543 Bacteria 1151
174 Ga0495625_0071442 3300046660 Bacteria 2436
175 Ga0495670_0024254 3300046691 Bacteria 2998
176 Ga0495649_0001637 3300046694 Bacteria 16659
177 Ga0495660_0103300 3300046810 Bacteria 1464
178 Ga0495674_0170587 3300047319 Bacteria 1816
179 Ga0495674_0239361 3300047319 Bacteria 1496
180 Ga0495687_001439 3300047443 Bacteria 21864
181 Ga0496100_0452836 3300048903 Bacteria 984
182 Ga0496101_0193859 3300048904 Bacteria 1569
183 Ga0496102_0518972 3300048905 Bacteria 1114
184 Ga0496104_0035395 3300048907 Bacteria 4662
185 Ga0496105_0118239 3300048908 Bacteria 2186
186 Ga0496106_0464859 3300048909 Bacteria 1016
187 Ga0496107_0022533 3300048910 Bacteria 4451
188 Ga0496107_0419588 3300048910 Bacteria 995
189 Ga0496108_0018695 3300048911 Bacteria 5679
190 Ga0496109_0038183 3300048912 Bacteria 4341
191 Ga0496109_0108445 3300048912 Bacteria 2580
192 Ga0496109_0727904 3300048912 Bacteria 930
193 Ga0496110_0038682 3300048913 Bacteria 4152
194 Ga0496112_0000218 3300048915 Bacteria 37059
195 Ga0496112_0017558 3300048915 Bacteria 6726
196 Ga0496113_0172905 3300048916 Bacteria 1711
197 Ga0496113_0424512 3300048916 Bacteria 1068
198 Ga0496114_0164535 3300048917 Bacteria 1931
199 Ga0501031_0089204 3300049568 Bacteria 2010
200 Ga0501032_0102879 3300049569 Bacteria 1893
201 Ga0501033_0002890 3300049570 Bacteria 14373
202 Ga0501036_0001779 3300049572 Bacteria 16725
203 Ga0501037_0148075 3300049573 Bacteria 1679
204 Ga0501038_0002922 3300049574 Bacteria 15929
205 Ga0501039_0019522 3300049575 Bacteria 5197
206 Ga0501040_0002971 3300049576 Bacteria 10974
207 Ga0501041_0000992 3300049577 Bacteria 15513
208 Ga0501042_0000167 3300049578 Bacteria 30321
209 Ga0501043_0015020 3300049579 Bacteria 6064
210 Ga0501047_0537514 3300049581 Bacteria 994
211 Ga0501048_0004358 3300049582 Bacteria 10773
212 Ga0501068_0003481 3300049584 Bacteria 8484
213 Ga0501069_0010419 3300049585 Bacteria 4920
214 Ga0501069_0158042 3300049585 Bacteria 1305
215 Ga0501070_0099960 3300049586 Bacteria 2400
216 Ga0501071_0000960 3300049587 Bacteria 15709
217 Ga0501072_0001040 3300049588 Bacteria 20539
218 Ga0501073_0218007 3300049589 Bacteria 1318
219 Ga0501073_0269059 3300049589 Bacteria 1176
220 Ga0501074_0007791 3300049590 Bacteria 7754
221 Ga0501075_0000066 3300049591 Bacteria 45649
222 Ga0501075_0144937 3300049591 Bacteria 1810
223 Ga0501076_0002672 3300049592 Bacteria 12304
224 Ga0501077_0000537 3300049593 Bacteria 22994
225 Ga0501079_0000198 3300049741 Bacteria 34763
226 Ga0501080_0000373 3300049742 Bacteria 34505
227 Ga0501080_0109786 3300049742 Bacteria 2556
228 Ga0501080_0213903 3300049742 Bacteria 1766
229 Ga0501081_0000011 3300049743 Bacteria 67455
230 Ga0501083_0095474 3300049744 Bacteria 1962
231 Ga0501083_0183829 3300049744 Bacteria 1364
232 Ga0501035_0007234 3300049822 Bacteria 10385
233 Ga0501044_0149476 3300049823 Bacteria 2319
234 Ga0501044_0243906 3300049823 Bacteria 1740
235 Ga0501045_0000024 3300049824 Bacteria 63402
236 nmdc:mga05p37_207967_c1 3300050507 Bacteria 2366
237 nmdc:mga05p37_6204_c1 3300050507 Bacteria 14081
238 nmdc:mga0n895_220583_c1 3300050512 Bacteria 1925
239 nmdc:mga0rr50_772959_c1 3300050513 Bacteria 820
240 nmdc:mga08x19_174655_c1 3300050514 Bacteria 1464
241 Ga0495595_0051576 3300053084 Bacteria 1907
242 Ga0495619_0088109 3300053085 Bacteria 2099
243 Ga0500562_004031 3300053108 Bacteria 3701
244 Ga0500616_0105802 3300053153 Bacteria 1368
245 Ga0501084_0001718 3300054114 Bacteria 17396
246 Ga0501084_0068923 3300054114 Bacteria 2961
247 Ga0501082_0004477 3300060353 Bacteria 12204
248 Ga0501082_0275154 3300060353 Bacteria 1466
249 Ga0530510_0000034 3300061734 Bacteria 62610
250 Ga0530510_0008889 3300061734 Bacteria 7032
251 2793071562 2791355197 Bacteria 8420563
252 2885378892 2885374607 Bacteria 8927485
253 2903748910 2903748898 Bacteria 9972761
254 2904699178 2904690495 Bacteria 9412302
255 2906637521 2906635258 Bacteria 8601019
256 2906661172 2906660503 Bacteria 8595048
257 3005477366 3005474847 Bacteria 9259049
258 Ga0495590_0015404
259 Ga0070658_10010766
260 Ga0070676_10157505
261 Ga0070670_100042745
262 Ga0070677_10042266
263 Ga0070680_100010047
264 Ga0070680_100052863
265 Ga0070668_100400982
266 Ga0070675_100028777
267 Ga0070671_100032742
268 Ga0070659_100093655
269 Ga0070709_10021055
270 Ga0070709_10379196
271 Ga0070714_100250033
272 Ga0070713_100295423
273 Ga0070710_10013825
274 Ga0070710_10172438
275 Ga0070711_100009606
276 Ga0070711_100153509
277 Ga0070705_100008030
278 Ga0070694_100018420
279 Ga0070708_100049773
280 Ga0070663_100741396
281 Ga0070681_10002769
282 Ga0070707_100304988
283 Ga0070698_100064755
284 Ga0070679_100015644
285 Ga0070672_100003143
286 Ga0070695_100018622
287 Ga0070696_100145637
288 Ga0070665_100020613
289 Ga0070665_100186706
290 Ga0070704_100002202
291 Ga0068855_100017402
292 Ga0068855_100051082
293 Ga0068855_100072795
294 Ga0068857_100699176
295 Ga0068854_100210806
296 Ga0068854_100471878
297 Ga0068854_100485289
298 Ga0068856_100008813
299 Ga0068856_100073434
300 Ga0068852_100521081
301 Ga0068859_100152830
302 Ga0068864_100029607
303 Ga0068864_100049888
304 Ga0068851_10035738
305 Ga0068863_100166739
306 Ga0081540_1000507
307 Ga0081539_10101420
308 Ga0070715_10004847
309 Ga0070716_100097235
310 Ga0070716_100133147
311 Ga0070712_100019712
312 Ga0097621_100043245
313 Ga0068871_100162803
314 Ga0075431_100104604
315 Ga0075434_100124707
316 Ga0068865_100545596
317 Ga0097620_100152832
318 Ga0105240_10186251
319 Ga0114129_10011627
320 Ga0114129_10078362
321 Ga0114129_10610819
322 Ga0105242_10313048
323 Ga0105242_10708372
324 Ga0105248_10002744
325 Ga0105237_10171689
326 Ga0105249_10053846
327 Ga0105249_10143918
328 Ga0105246_10150124
329 Ga0157370_10005538
330 Ga0157370_10377568
331 Ga0157369_10056282
332 Ga0163162_10043703
333 Ga0163162_10437280
334 Ga0157372_10002118
335 Ga0157375_10030758
336 Ga0157375_10055966
337 Ga0163163_10055154
338 Ga0157379_10061945
339 Ga0157379_10071714
340 Ga0157379_10143239
341 Ga0157376_10013097
342 Ga0157376_10260234
343 Ga0157376_10337209
344 Ga0163161_10113568
345 Ga0207682_10050447
346 Ga0207692_10104104
347 Ga0207642_10150342
348 Ga0207685_10004546
349 Ga0207699_10071890
350 Ga0207643_10137508
351 Ga0207654_10253987
352 Ga0207707_10008590
353 Ga0207671_10196173
354 Ga0207693_10006258
355 Ga0207693_10014249
356 Ga0207663_10008360
357 Ga0207663_10104056
358 Ga0207663_10147178
359 Ga0207660_10022162
360 Ga0207652_10314183
361 Ga0207650_10005655
362 Ga0207700_10059254
363 Ga0207700_10161901
364 Ga0207664_10036247
365 Ga0207664_10618524
366 Ga0207644_10035956
367 Ga0207644_10115453
368 Ga0207690_10362820
369 Ga0207665_10020430
370 Ga0207665_10022798
371 Ga0207665_10116805
372 Ga0207691_10001131
373 Ga0207711_10017357
374 Ga0207679_10053581
375 Ga0207667_10019195
376 Ga0207667_10043969
377 Ga0207667_10202324
378 Ga0207712_10300881
379 Ga0207712_10389993
380 Ga0207668_10218265
381 Ga0207640_10135056
382 Ga0207677_10373517
383 Ga0207639_10262936
384 Ga0207678_10137309
385 Ga0207678_10415123
386 Ga0207702_10002619
387 Ga0207702_10053799
388 Ga0207641_10012301
389 Ga0207641_10108163
390 Ga0207648_10314570
391 Ga0207676_10044041
392 Ga0207676_10078803
393 Ga0207674_10713998
394 Ga0207698_10174580
395 Ga0265356_1001524
396 Ga0265355_1004271
397 Ga0268266_10028368
398 Ga0268266_10315057
399 Ga0268264_10000816
400 Ga0307515_10000041
401 Ga0307515_10000873
402 Ga0307515_10006527
403 Ga0307515_10020414
404 Ga0307515_10102360
405 Ga0265770_1000590
406 Ga0265760_10001920
407 Ga0307513_10001868
408 Ga0307513_10075221
409 Ga0307509_10018112
410 Ga0307508_10000540
411 Ga0307516_10000350
412 Ga0307405_10007579
413 Ga0307410_10004555
414 Ga0307406_10003804
415 Ga0307412_10008646
416 Ga0307409_100009444
417 Ga0307415_100016364
418 Ga0307507_10105295
419 Ga0307510_10205235
420 Ga0373926_0101193
421 Ga0395905_0001976
422 Ga0395901_0143036
423 Ga0495605_0025616
424 Ga0495664_0088760
425 Ga0495608_0009857
426 Ga0495630_0039502
427 Ga0495632_0001652
428 Ga0495621_0007268
429 Ga0495621_0096305
430 Ga0495645_0259679
431 Ga0495625_0071442
432 Ga0495670_0024254
433 Ga0495649_0001637
434 Ga0495660_0103300
435 Ga0495674_0170587
436 Ga0495674_0239361
437 Ga0495687_001439
438 Ga0496100_0452836
439 Ga0496101_0193859
440 Ga0496102_0518972
441 Ga0496104_0035395
442 Ga0496105_0118239
443 Ga0496106_0464859
444 Ga0496107_0022533
445 Ga0496107_0419588
446 Ga0496108_0018695
447 Ga0496109_0038183
448 Ga0496109_0108445
449 Ga0496109_0727904
450 Ga0496110_0038682
451 Ga0496112_0000218
452 Ga0496112_0017558
453 Ga0496113_0172905
454 Ga0496113_0424512
455 Ga0496114_0164535
456 Ga0501031_0089204
457 Ga0501032_0102879
458 Ga0501033_0002890
459 Ga0501036_0001779
460 Ga0501037_0148075
461 Ga0501038_0002922
462 Ga0501039_0019522
463 Ga0501040_0002971
464 Ga0501041_0000992
465 Ga0501042_0000167
466 Ga0501043_0015020
467 Ga0501047_0537514
468 Ga0501048_0004358
469 Ga0501068_0003481
470 Ga0501069_0010419
471 Ga0501069_0158042
472 Ga0501070_0099960
473 Ga0501071_0000960
474 Ga0501072_0001040
475 Ga0501073_0218007
476 Ga0501073_0269059
477 Ga0501074_0007791
478 Ga0501075_0000066
479 Ga0501075_0144937
480 Ga0501076_0002672
481 Ga0501077_0000537
482 Ga0501079_0000198
483 Ga0501080_0000373
484 Ga0501080_0109786
485 Ga0501080_0213903
486 Ga0501081_0000011
487 Ga0501083_0095474
488 Ga0501083_0183829
489 Ga0501035_0007234
490 Ga0501044_0149476
491 Ga0501044_0243906
492 Ga0501045_0000024
493 nmdc:mga05p37_207967_c1
494 nmdc:mga05p37_6204_c1
495 nmdc:mga0n895_220583_c1
496 nmdc:mga0rr50_772959_c1
497 nmdc:mga08x19_174655_c1
498 Ga0495595_0051576
499 Ga0495619_0088109
500 Ga0500562_004031
501 Ga0500616_0105802
502 Ga0501084_0001718
503 Ga0501084_0068923
504 Ga0501082_0004477
505 Ga0501082_0275154
506 Ga0530510_0000034
507 Ga0530510_0008889
508 2793071562
509 2885378892
510 2903748910
511 2904699178
512 2906637521
513 2906661172
514 3005477366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

243

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

288

0.93

PF08659

KR

KR domain

45

226

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.969 8 255
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9675 9 256
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9666 6 255
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9659 7 259
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9655 7 259
ID Description Score Start End Superfamily
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 1 257 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 8 256 3.40.50.720
2pnfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 8 256 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9584 2 259 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 6 259 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X9KFR3-F1-model_v4 SDR family oxidoreductase 0.97 10 256 GO:0016491
AF-A0A439H8B9-F1-model_v4 deleted 0.9688 3 259
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9674 9 132 GO:0005829
GO:0009688
GO:0010301
AF-A0A2L2XDC7-F1-model_v4 3-oxoacyl-reductase 0.9667 1 259 GO:0016616
GO:0030497
AF-A0A1G5T4M5-F1-model_v4 Gluconate 5-dehydrogenase 0.9659 5 258 GO:0016616

Map