F367507

General Info

Members Datasets Scaffolds Average Seq Length
257 121 514 231

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0018958|Ga0466966_0018958_1743_2528
Length 261
Sequence MTDTARAADKAPYRPKTGDADFPGEAEHLLEATRPDPHDLPKQQVGTTPQMVGRYPTYDILTQANHWDEVTRKVVLDRVANVPPIRFFTETEARTLKAFCDIATAQDSEPRIPVLSYIDEKLHEGKRDGWRYYDLPDDDEVWRRVARGLDDEAQRKSFPSYADLPVMEQAGIVHRFSKAQLHGGVWDTLNVSRAFTVVMRYVVQAFYGHPWAWNEIGFGGPAYPRGYGAFGSPHLGEKEAWETDESVHYDPVQDVKKRGLD

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.56
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0018958 3300044684 Bacteria 4534
2 Ga0070658_10007412 3300005327 Bacteria 8859
3 Ga0070658_10137146 3300005327 Bacteria 2042
4 Ga0070683_100026188 3300005329 Bacteria 5247
5 Ga0070683_100028193 3300005329 Bacteria 5073
6 Ga0070683_100058584 3300005329 Bacteria 3578
7 Ga0070680_100003059 3300005336 Bacteria 12409
8 Ga0070680_100030253 3300005336 Bacteria 4351
9 Ga0070680_100044228 3300005336 Bacteria 3619
10 Ga0070680_100047827 3300005336 Bacteria 3484
11 Ga0070680_100085612 3300005336 Bacteria 2604
12 Ga0070680_100189903 3300005336 Bacteria 1731
13 Ga0070682_100042192 3300005337 Bacteria 2815
14 Ga0070682_100090649 3300005337 Bacteria 2000
15 Ga0070682_100150626 3300005337 Bacteria 1596
16 Ga0070660_100028591 3300005339 Bacteria 4172
17 Ga0070660_100049736 3300005339 Bacteria 3223
18 Ga0070660_100168719 3300005339 Bacteria 1767
19 Ga0070661_100013450 3300005344 Bacteria 5744
20 Ga0070661_100036951 3300005344 Bacteria 3552
21 Ga0070661_100065736 3300005344 Bacteria 2665
22 Ga0070671_100061430 3300005355 Bacteria 3129
23 Ga0070659_100142386 3300005366 Bacteria 1952
24 Ga0070659_100147446 3300005366 Bacteria 1918
25 Ga0070714_100479061 3300005435 Bacteria 1185
26 Ga0070711_100013016 3300005439 Bacteria 5216
27 Ga0070681_10001806 3300005458 Bacteria 19256
28 Ga0070681_10028430 3300005458 Bacteria 5621
29 Ga0070681_10062984 3300005458 Bacteria 3681
30 Ga0070681_10153005 3300005458 Bacteria 2232
31 Ga0070681_10523433 3300005458 Bacteria 1099
32 Ga0070679_100001483 3300005530 Bacteria 20820
33 Ga0070679_100004122 3300005530 Bacteria 13403
34 Ga0070679_100022132 3300005530 Bacteria 6211
35 Ga0070679_100090302 3300005530 Bacteria 3052
36 Ga0070684_100047439 3300005535 Bacteria 3722
37 Ga0070684_100086702 3300005535 Bacteria 2779
38 Ga0070684_100132758 3300005535 Bacteria 2247
39 Ga0070684_100204034 3300005535 Bacteria 1801
40 Ga0068853_100210745 3300005539 Bacteria 1771
41 Ga0070665_100022046 3300005548 Bacteria 6408
42 Ga0068855_100005955 3300005563 Bacteria 14867
43 Ga0068855_100021884 3300005563 Bacteria 7665
44 Ga0068855_100200579 3300005563 Bacteria 2246
45 Ga0068855_100405515 3300005563 Bacteria 1493
46 Ga0068857_100002630 3300005577 Bacteria 14736
47 Ga0068856_100009264 3300005614 Bacteria 9564
48 Ga0068856_100011191 3300005614 Bacteria 8707
49 Ga0068852_100660969 3300005616 Bacteria 1053
50 Ga0068851_10061518 3300005834 Bacteria 1925
51 Ga0070712_100054465 3300006175 Bacteria 2797
52 Ga0105240_10047619 3300009093 Bacteria 5424
53 Ga0105240_10108844 3300009093 Bacteria 3357
54 Ga0105237_10336978 3300009545 Bacteria 1513
55 Ga0105238_10009578 3300009551 Bacteria 9691
56 Ga0105239_10127428 3300010375 Bacteria 2830
57 Ga0157370_10018615 3300013104 Bacteria 6983
58 Ga0157370_10023395 3300013104 Bacteria 6134
59 Ga0157370_10039543 3300013104 Bacteria 4558
60 Ga0157370_10044803 3300013104 Bacteria 4248
61 Ga0157370_10103421 3300013104 Bacteria 2666
62 Ga0157370_10285110 3300013104 Bacteria 1526
63 Ga0157369_10017395 3300013105 Bacteria 8080
64 Ga0157369_10018922 3300013105 Bacteria 7716
65 Ga0157369_10036899 3300013105 Bacteria 5353
66 Ga0157369_10118393 3300013105 Bacteria 2811
67 Ga0157369_10205455 3300013105 Bacteria 2066
68 Ga0157374_10014133 3300013296 Bacteria 6979
69 Ga0157374_10074944 3300013296 Bacteria 3197
70 Ga0157378_10217447 3300013297 Bacteria 1815
71 Ga0157372_10012216 3300013307 Bacteria 9146
72 Ga0157372_10104118 3300013307 Bacteria 3244
73 Ga0157372_10379426 3300013307 Bacteria 1647
74 Ga0157372_10565436 3300013307 Bacteria 1325
75 Ga0182008_10061555 3300014497 Bacteria 1850
76 Ga0197907_10200916 3300020069 Bacteria 4517
77 Ga0197907_10202817 3300020069 Bacteria 3047
78 Ga0197907_10463284 3300020069 Bacteria 1150
79 Ga0206356_10001755 3300020070 Bacteria 1193
80 Ga0206356_10223409 3300020070 Bacteria 3071
81 Ga0206356_11135589 3300020070 Bacteria 1332
82 Ga0206356_11697609 3300020070 Bacteria 2061
83 Ga0206351_10314503 3300020077 Bacteria 1235
84 Ga0206350_11459683 3300020080 Bacteria 1298
85 Ga0206350_11556896 3300020080 Bacteria 1803
86 Ga0206354_11188972 3300020081 Bacteria 3160
87 Ga0206354_11252047 3300020081 Bacteria 6861
88 Ga0206353_11051995 3300020082 Bacteria 4806
89 Ga0206353_11558846 3300020082 Bacteria 1795
90 Ga0206353_11844961 3300020082 Bacteria 4213
91 Ga0154015_1478173 3300020610 Bacteria 965
92 Ga0213871_10028655 3300021441 Bacteria 1439
93 Ga0224712_10000763 3300022467 Bacteria 6728
94 Ga0224712_10004819 3300022467 Bacteria 3685
95 Ga0207705_10025285 3300025909 Bacteria 4240
96 Ga0207705_10038915 3300025909 Bacteria 3407
97 Ga0207705_10067890 3300025909 Bacteria 2581
98 Ga0207707_10003853 3300025912 Bacteria 13298
99 Ga0207707_10015918 3300025912 Bacteria 6559
100 Ga0207695_10114161 3300025913 Bacteria 2677
101 Ga0207695_10152050 3300025913 Bacteria 2253
102 Ga0207671_10091873 3300025914 Bacteria 2288
103 Ga0207693_10066829 3300025915 Bacteria 2815
104 Ga0207660_10031941 3300025917 Bacteria 3631
105 Ga0207660_10130457 3300025917 Bacteria 1913
106 Ga0207660_10154782 3300025917 Bacteria 1764
107 Ga0207660_10214555 3300025917 Bacteria 1508
108 Ga0207657_10001467 3300025919 Bacteria 25216
109 Ga0207657_10013821 3300025919 Bacteria 7901
110 Ga0207657_10015890 3300025919 Bacteria 7271
111 Ga0207657_10151194 3300025919 Bacteria 1891
112 Ga0207657_10360858 3300025919 Bacteria 1145
113 Ga0207652_10001450 3300025921 Bacteria 20983
114 Ga0207652_10107636 3300025921 Bacteria 2469
115 Ga0207652_10146649 3300025921 Bacteria 2112
116 Ga0207694_10120510 3300025924 Bacteria 2094
117 Ga0207700_10036352 3300025928 Bacteria 3556
118 Ga0207664_10077711 3300025929 Bacteria 2690
119 Ga0207664_10437550 3300025929 Bacteria 1166
120 Ga0207644_10166069 3300025931 Bacteria 1720
121 Ga0207690_10039044 3300025932 Bacteria 3095
122 Ga0207690_10040071 3300025932 Bacteria 3060
123 Ga0207661_10068540 3300025944 Bacteria 2889
124 Ga0207667_10075127 3300025949 Bacteria 3509
125 Ga0207667_10139363 3300025949 Bacteria 2497
126 Ga0207639_10282178 3300026041 Bacteria 1461
127 Ga0207678_10195098 3300026067 Bacteria 1731
128 Ga0207702_10259220 3300026078 Bacteria 1636
129 Ga0207674_10005625 3300026116 Bacteria 14858
130 Ga0207698_10131017 3300026142 Bacteria 2143
131 Ga0207698_10879756 3300026142 Bacteria 902
132 Ga0373945_0035571 3300035116 Bacteria 1780
133 Ga0373943_0003021 3300035170 Bacteria 7639
134 Ga0373946_0084655 3300035171 Bacteria 1395
135 Ga0373935_0100135 3300035692 Bacteria 1909
136 Ga0373927_0075439 3300035695 Bacteria 2184
137 Ga0373947_0001971 3300035725 Bacteria 12571
138 Ga0373925_0002371 3300037068 Bacteria 15110
139 Ga0395899_0022609 3300037312 Bacteria 4763
140 Ga0395900_0061784 3300037418 Bacteria 3851
141 Ga0395900_0132879 3300037418 Bacteria 2550
142 Ga0395900_0419553 3300037418 Bacteria 1299
143 Ga0395898_0021396 3300037466 Bacteria 6558
144 Ga0395898_0052557 3300037466 Bacteria 3981
145 Ga0395898_0074286 3300037466 Bacteria 3284
146 Ga0395905_0120057 3300037471 Bacteria 2471
147 Ga0395901_0021843 3300038443 Bacteria 6558
148 Ga0395901_0021944 3300038443 Bacteria 6545
149 Ga0395901_0137291 3300038443 Bacteria 2570
150 Ga0436365_0476980 3300039437 Bacteria 4583
151 Ga0436360_0070468 3300039438 Bacteria 8813
152 Ga0436360_0387295 3300039438 Bacteria 11023
153 Ga0436363_0980879 3300039450 Bacteria 830
154 Ga0436363_1679359 3300039450 Bacteria 3893
155 Ga0439448_0097899 3300042005 Bacteria 995
156 Ga0466969_0050138 3300044656 Bacteria 2058
157 Ga0466969_0070536 3300044656 Bacteria 1681
158 Ga0466965_0053777 3300044683 Bacteria 2002
159 Ga0466966_0030644 3300044684 Bacteria 3489
160 Ga0466966_0245710 3300044684 Bacteria 1078
161 Ga0466961_0002168 3300044693 Bacteria 12212
162 Ga0466961_0005114 3300044693 Bacteria 8257
163 Ga0466961_0091499 3300044693 Bacteria 1921
164 Ga0466961_0100546 3300044693 Bacteria 1822
165 Ga0466961_0183693 3300044693 Bacteria 1298
166 Ga0466961_0184419 3300044693 Bacteria 1295
167 Ga0466963_0006298 3300044694 Bacteria 7015
168 Ga0466963_0007725 3300044694 Bacteria 6425
169 Ga0466963_0010729 3300044694 Bacteria 5559
170 Ga0466963_0013894 3300044694 Bacteria 4957
171 Ga0466963_0033915 3300044694 Bacteria 3319
172 Ga0466963_0047538 3300044694 Bacteria 2832
173 Ga0466963_0120598 3300044694 Bacteria 1804
174 Ga0466963_0351647 3300044694 Bacteria 1038
175 Ga0466963_0554349 3300044694 Bacteria 812
176 Ga0466964_0009364 3300044706 Bacteria 3687
177 Ga0466964_0038334 3300044706 Bacteria 1926
178 Ga0466971_0005404 3300044719 Bacteria 5541
179 Ga0466971_0005922 3300044719 Bacteria 5316
180 Ga0466971_0106439 3300044719 Bacteria 1292
181 Ga0466968_0084749 3300044735 Bacteria 1397
182 Ga0466970_0078150 3300044765 Bacteria 1785
183 Ga0466957_0000801 3300044842 Bacteria 16044
184 Ga0466957_0167024 3300044842 Bacteria 1432
185 Ga0466957_0323194 3300044842 Bacteria 1041
186 Ga0466957_0439946 3300044842 Bacteria 897
187 Ga0466960_0095321 3300044901 Bacteria 1524
188 Ga0466959_0010238 3300045049 Bacteria 6696
189 Ga0466959_0119091 3300045049 Bacteria 1878
190 Ga0466959_0163826 3300045049 Bacteria 1562
191 Ga0466959_0194707 3300045049 Bacteria 1413
192 Ga0466958_0007514 3300045836 Bacteria 6000
193 Ga0466958_0026194 3300045836 Bacteria 3445
194 Ga0466958_0027263 3300045836 Bacteria 3381
195 Ga0466958_0051593 3300045836 Bacteria 2491
196 Ga0466958_0099293 3300045836 Bacteria 1808
197 Ga0466967_0000742 3300045976 Bacteria 16747
198 Ga0466967_0002783 3300045976 Bacteria 11083
199 Ga0466967_0004466 3300045976 Bacteria 9439
200 Ga0466967_0047085 3300045976 Bacteria 3758
201 Ga0466967_0189059 3300045976 Bacteria 1945
202 Ga0466967_0212944 3300045976 Bacteria 1833
203 Ga0466967_0218897 3300045976 Bacteria 1808
204 Ga0466967_0241785 3300045976 Bacteria 1722
205 Ga0466967_0313557 3300045976 Bacteria 1511
206 Ga0495641_0050571 3300046461 Bacteria 1899
207 Ga0495582_0052154 3300046473 Bacteria 2256
208 Ga0495630_0293917 3300046517 Bacteria 1241
209 Ga0495658_0013966 3300046683 Bacteria 4095
210 Ga0495684_0588888 3300047471 Bacteria 752
211 Ga0495614_0105555 3300048089 Bacteria 1234
212 Ga0496100_0007683 3300048903 Bacteria 5966
213 Ga0496100_0235806 3300048903 Bacteria 1348
214 Ga0496102_0003700 3300048905 Bacteria 12927
215 Ga0496104_0004564 3300048907 Bacteria 12069
216 Ga0496104_0630569 3300048907 Bacteria 981
217 Ga0496105_0035836 3300048908 Bacteria 4086
218 Ga0496106_0014334 3300048909 Bacteria 5857
219 Ga0496107_0252259 3300048910 Bacteria 1313
220 Ga0496108_0004801 3300048911 Bacteria 10903
221 Ga0496108_0152232 3300048911 Bacteria 1996
222 Ga0496109_0007333 3300048912 Bacteria 9327
223 Ga0496109_0078501 3300048912 Bacteria 3040
224 Ga0496109_0143557 3300048912 Bacteria 2233
225 Ga0496110_0004690 3300048913 Bacteria 10634
226 Ga0496110_0034134 3300048913 Bacteria 4405
227 Ga0496112_0067465 3300048915 Bacteria 3531
228 Ga0496112_0132621 3300048915 Bacteria 2462
229 Ga0496112_0608622 3300048915 Bacteria 1024
230 Ga0496113_0025603 3300048916 Bacteria 4208
231 Ga0496113_0168279 3300048916 Bacteria 1735
232 Ga0496114_0042552 3300048917 Bacteria 3765
233 Ga0496115_0002737 3300048918 Bacteria 12656
234 Ga0501047_0051961 3300049581 Bacteria 3961
235 Ga0501067_0007778 3300049583 Bacteria 5962
236 Ga0501067_0032026 3300049583 Bacteria 2917
237 Ga0501067_0041496 3300049583 Bacteria 2555
238 Ga0501067_0050849 3300049583 Bacteria 2297
239 Ga0501069_0064200 3300049585 Bacteria 2052
240 Ga0501070_0000463 3300049586 Bacteria 36856
241 Ga0501070_0005858 3300049586 Bacteria 10477
242 Ga0501070_0023676 3300049586 Bacteria 5145
243 Ga0501072_0056083 3300049588 Bacteria 3105
244 Ga0501074_0031549 3300049590 Bacteria 3838
245 Ga0501074_0077379 3300049590 Bacteria 2387
246 Ga0501074_0624119 3300049590 Bacteria 762
247 Ga0501079_0067975 3300049741 Bacteria 2750
248 Ga0501080_0023513 3300049742 Bacteria 5711
249 Ga0501080_0313022 3300049742 Bacteria 1423
250 Ga0501083_0003199 3300049744 Bacteria 11404
251 Ga0501083_0141615 3300049744 Bacteria 1575
252 Ga0501084_0089702 3300054114 Bacteria 2581
253 Ga0501082_0087943 3300060353 Bacteria 2681
254 Ga0466962_0000126 3300061719 Bacteria 31190
255 Ga0466962_0001261 3300061719 Bacteria 11686
256 Ga0466962_0019918 3300061719 Bacteria 3224
257 Ga0466962_0034795 3300061719 Bacteria 2412
258 Ga0466966_0018958
259 Ga0070658_10007412
260 Ga0070658_10137146
261 Ga0070683_100026188
262 Ga0070683_100028193
263 Ga0070683_100058584
264 Ga0070680_100003059
265 Ga0070680_100030253
266 Ga0070680_100044228
267 Ga0070680_100047827
268 Ga0070680_100085612
269 Ga0070680_100189903
270 Ga0070682_100042192
271 Ga0070682_100090649
272 Ga0070682_100150626
273 Ga0070660_100028591
274 Ga0070660_100049736
275 Ga0070660_100168719
276 Ga0070661_100013450
277 Ga0070661_100036951
278 Ga0070661_100065736
279 Ga0070671_100061430
280 Ga0070659_100142386
281 Ga0070659_100147446
282 Ga0070714_100479061
283 Ga0070711_100013016
284 Ga0070681_10001806
285 Ga0070681_10028430
286 Ga0070681_10062984
287 Ga0070681_10153005
288 Ga0070681_10523433
289 Ga0070679_100001483
290 Ga0070679_100004122
291 Ga0070679_100022132
292 Ga0070679_100090302
293 Ga0070684_100047439
294 Ga0070684_100086702
295 Ga0070684_100132758
296 Ga0070684_100204034
297 Ga0068853_100210745
298 Ga0070665_100022046
299 Ga0068855_100005955
300 Ga0068855_100021884
301 Ga0068855_100200579
302 Ga0068855_100405515
303 Ga0068857_100002630
304 Ga0068856_100009264
305 Ga0068856_100011191
306 Ga0068852_100660969
307 Ga0068851_10061518
308 Ga0070712_100054465
309 Ga0105240_10047619
310 Ga0105240_10108844
311 Ga0105237_10336978
312 Ga0105238_10009578
313 Ga0105239_10127428
314 Ga0157370_10018615
315 Ga0157370_10023395
316 Ga0157370_10039543
317 Ga0157370_10044803
318 Ga0157370_10103421
319 Ga0157370_10285110
320 Ga0157369_10017395
321 Ga0157369_10018922
322 Ga0157369_10036899
323 Ga0157369_10118393
324 Ga0157369_10205455
325 Ga0157374_10014133
326 Ga0157374_10074944
327 Ga0157378_10217447
328 Ga0157372_10012216
329 Ga0157372_10104118
330 Ga0157372_10379426
331 Ga0157372_10565436
332 Ga0182008_10061555
333 Ga0197907_10200916
334 Ga0197907_10202817
335 Ga0197907_10463284
336 Ga0206356_10001755
337 Ga0206356_10223409
338 Ga0206356_11135589
339 Ga0206356_11697609
340 Ga0206351_10314503
341 Ga0206350_11459683
342 Ga0206350_11556896
343 Ga0206354_11188972
344 Ga0206354_11252047
345 Ga0206353_11051995
346 Ga0206353_11558846
347 Ga0206353_11844961
348 Ga0154015_1478173
349 Ga0213871_10028655
350 Ga0224712_10000763
351 Ga0224712_10004819
352 Ga0207705_10025285
353 Ga0207705_10038915
354 Ga0207705_10067890
355 Ga0207707_10003853
356 Ga0207707_10015918
357 Ga0207695_10114161
358 Ga0207695_10152050
359 Ga0207671_10091873
360 Ga0207693_10066829
361 Ga0207660_10031941
362 Ga0207660_10130457
363 Ga0207660_10154782
364 Ga0207660_10214555
365 Ga0207657_10001467
366 Ga0207657_10013821
367 Ga0207657_10015890
368 Ga0207657_10151194
369 Ga0207657_10360858
370 Ga0207652_10001450
371 Ga0207652_10107636
372 Ga0207652_10146649
373 Ga0207694_10120510
374 Ga0207700_10036352
375 Ga0207664_10077711
376 Ga0207664_10437550
377 Ga0207644_10166069
378 Ga0207690_10039044
379 Ga0207690_10040071
380 Ga0207661_10068540
381 Ga0207667_10075127
382 Ga0207667_10139363
383 Ga0207639_10282178
384 Ga0207678_10195098
385 Ga0207702_10259220
386 Ga0207674_10005625
387 Ga0207698_10131017
388 Ga0207698_10879756
389 Ga0373945_0035571
390 Ga0373943_0003021
391 Ga0373946_0084655
392 Ga0373935_0100135
393 Ga0373927_0075439
394 Ga0373947_0001971
395 Ga0373925_0002371
396 Ga0395899_0022609
397 Ga0395900_0061784
398 Ga0395900_0132879
399 Ga0395900_0419553
400 Ga0395898_0021396
401 Ga0395898_0052557
402 Ga0395898_0074286
403 Ga0395905_0120057
404 Ga0395901_0021843
405 Ga0395901_0021944
406 Ga0395901_0137291
407 Ga0436365_0476980
408 Ga0436360_0070468
409 Ga0436360_0387295
410 Ga0436363_0980879
411 Ga0436363_1679359
412 Ga0439448_0097899
413 Ga0466969_0050138
414 Ga0466969_0070536
415 Ga0466965_0053777
416 Ga0466966_0030644
417 Ga0466966_0245710
418 Ga0466961_0002168
419 Ga0466961_0005114
420 Ga0466961_0091499
421 Ga0466961_0100546
422 Ga0466961_0183693
423 Ga0466961_0184419
424 Ga0466963_0006298
425 Ga0466963_0007725
426 Ga0466963_0010729
427 Ga0466963_0013894
428 Ga0466963_0033915
429 Ga0466963_0047538
430 Ga0466963_0120598
431 Ga0466963_0351647
432 Ga0466963_0554349
433 Ga0466964_0009364
434 Ga0466964_0038334
435 Ga0466971_0005404
436 Ga0466971_0005922
437 Ga0466971_0106439
438 Ga0466968_0084749
439 Ga0466970_0078150
440 Ga0466957_0000801
441 Ga0466957_0167024
442 Ga0466957_0323194
443 Ga0466957_0439946
444 Ga0466960_0095321
445 Ga0466959_0010238
446 Ga0466959_0119091
447 Ga0466959_0163826
448 Ga0466959_0194707
449 Ga0466958_0007514
450 Ga0466958_0026194
451 Ga0466958_0027263
452 Ga0466958_0051593
453 Ga0466958_0099293
454 Ga0466967_0000742
455 Ga0466967_0002783
456 Ga0466967_0004466
457 Ga0466967_0047085
458 Ga0466967_0189059
459 Ga0466967_0212944
460 Ga0466967_0218897
461 Ga0466967_0241785
462 Ga0466967_0313557
463 Ga0495641_0050571
464 Ga0495582_0052154
465 Ga0495630_0293917
466 Ga0495658_0013966
467 Ga0495684_0588888
468 Ga0495614_0105555
469 Ga0496100_0007683
470 Ga0496100_0235806
471 Ga0496102_0003700
472 Ga0496104_0004564
473 Ga0496104_0630569
474 Ga0496105_0035836
475 Ga0496106_0014334
476 Ga0496107_0252259
477 Ga0496108_0004801
478 Ga0496108_0152232
479 Ga0496109_0007333
480 Ga0496109_0078501
481 Ga0496109_0143557
482 Ga0496110_0004690
483 Ga0496110_0034134
484 Ga0496112_0067465
485 Ga0496112_0132621
486 Ga0496112_0608622
487 Ga0496113_0025603
488 Ga0496113_0168279
489 Ga0496114_0042552
490 Ga0496115_0002737
491 Ga0501047_0051961
492 Ga0501067_0007778
493 Ga0501067_0032026
494 Ga0501067_0041496
495 Ga0501067_0050849
496 Ga0501069_0064200
497 Ga0501070_0000463
498 Ga0501070_0005858
499 Ga0501070_0023676
500 Ga0501072_0056083
501 Ga0501074_0031549
502 Ga0501074_0077379
503 Ga0501074_0624119
504 Ga0501079_0067975
505 Ga0501080_0023513
506 Ga0501080_0313022
507 Ga0501083_0003199
508 Ga0501083_0141615
509 Ga0501084_0089702
510 Ga0501082_0087943
511 Ga0466962_0000126
512 Ga0466962_0001261
513 Ga0466962_0019918
514 Ga0466962_0034795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

90

220

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qjd-assembly1.cif.gz_n structure of recombinant human gamma-tubulin ring complex without actin 0.3232 29 111
4yzd-assembly2.cif.gz_B crystal structure of human phosphorylated ire1alpha in complex with adp-mg 0.3193 53 184
4z7h-assembly2.cif.gz_B crystal structure of human ire1 cytoplasmic kinase-rnase region - complex with imidazopyridine compound 3 0.3058 53 174
6exu-assembly1.cif.gz_A crystal structure of the dna binding domain of fission yeast sap1 0.3049 54 171
7nzm-assembly1.cif.gz_E cryo-em structure of pre-dephosphorylation complex of phosphorylated eif2alpha with trapped holophosphatase (pp1a_d64a/ppp1r15a/g-actin/dnase i) 0.3001 79 162
ID Description Score Start End Superfamily
af_P03018_114_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4091 54 123 3.40.50.300
af_P03018_114_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3889 54 123 3.40.50.300
af_P9WPR1_187_501_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3491 105 170 3.40.50.300
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.3179 33 171 1.10.340.30
af_Q551C5_1189_1387_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3028 59 185 1.20.1640.10
ID Description Score Start End GO Terms
AF-C3U0R5-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9137 23 184
AF-A0A7L5DXK3-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9135 50 183
AF-A0A1P9X1J9-F1-model_v4 Gluconate 2-dehydrogenase 0.912 24 184
AF-A0A2M7T9S6-F1-model_v4 Gluconate 2-dehydrogenase 0.8974 20 190
AF-A0A4Q2ZQ69-F1-model_v4 deleted 0.8952 25 184

Map